F466635

General Info

Members Datasets Scaffolds Average Seq Length
587 347 572 159

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100116477|Ga0070671_1001164772
Length 180
Sequence MAPRLIVYLHHSFRFGDFFMPRFLILASAVIAMLATSVAGTSAQSSMTRVQVGILECRGGASVGFIVGSVTNLGCVLRAEGMPEDRYIATIRKVGLDLGITAESALAWGVYAPVARLGPGDLAGDYAGAQGSATLGVGVGGNVLVGGSANSIALQPLSVQGQVGVSVAAGLESLELRPGR

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
4 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
5 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
6 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
7 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
8 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
9 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
10 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
11 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
12 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
13 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
14 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
15 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
171 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
172 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
205 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
212 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
230 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
239 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
241 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
242 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
245 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
285 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
288 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
289 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
290 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
291 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
299 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
300 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
301 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
302 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
303 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
304 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
305 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
310 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
311 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
312 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
313 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
314 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
315 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
316 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
317 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
318 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
319 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
320 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
321 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
322 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
323 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
324 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
325 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
326 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
327 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
328 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
329 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
330 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
331 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
332 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
333 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
334 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
335 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
338 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
339 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
340 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
341 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
342 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
343 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
344 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
345 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
346 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
347 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.76
Metatranscriptomes 0.68
Isolates 2.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.44
Nodule 1.7
Rhizoplane 7.84
Rhizosphere 69.51
Stem 0
Stem Tuber 0
Unclassified 8.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1008496 3300000549 Bacteria 1248
2 JGI25404J52841_10018792 3300003659 Bacteria 1498
3 Ga0065165_1023758 3300005262 Bacteria 2072
4 Ga0065715_10833558 3300005293 Bacteria 598
5 Ga0070683_101029509 3300005329 Bacteria 791
6 Ga0070690_100362053 3300005330 Bacteria 1056
7 Ga0070666_10113509 3300005335 Bacteria 1875
8 Ga0070680_100013024 3300005336 Bacteria 6472
9 Ga0070680_100101388 3300005336 Bacteria 2390
10 Ga0070680_100151637 3300005336 Bacteria 1946
11 Ga0070680_100253650 3300005336 Bacteria 1488
12 Ga0070680_100610041 3300005336 Bacteria 937
13 Ga0070680_101429010 3300005336 Bacteria 599
14 Ga0070680_101699734 3300005336 Bacteria 547
15 Ga0070682_100031969 3300005337 Bacteria 3187
16 Ga0070682_100577607 3300005337 Bacteria 884
17 Ga0068868_100101930 3300005338 Bacteria 2323
18 Ga0070660_100006991 3300005339 Bacteria 7831
19 Ga0070689_100825001 3300005340 Bacteria 817
20 Ga0070691_10049020 3300005341 Bacteria 2011
21 Ga0070691_10560839 3300005341 Bacteria 669
22 Ga0070661_100039476 3300005344 Bacteria 3439
23 Ga0070661_100107153 3300005344 Bacteria 2084
24 Ga0070692_10829176 3300005345 Bacteria 634
25 Ga0070668_100093836 3300005347 Bacteria 2369
26 Ga0070668_100765446 3300005347 Bacteria 856
27 Ga0070669_100077905 3300005353 Bacteria 2463
28 Ga0070671_100116477 3300005355 Bacteria 2247
29 Ga0070671_100281825 3300005355 Bacteria 1414
30 Ga0070674_100297958 3300005356 Bacteria 1284
31 Ga0070674_101133613 3300005356 Bacteria 692
32 Ga0070673_100195432 3300005364 Bacteria 1740
33 Ga0070673_101220536 3300005364 Bacteria 705
34 Ga0070688_100379400 3300005365 Bacteria 1042
35 Ga0070659_100129339 3300005366 Bacteria 2050
36 Ga0070659_100216618 3300005366 Bacteria 1579
37 Ga0070667_100083186 3300005367 Bacteria 2741
38 Ga0070667_100237719 3300005367 Bacteria 1626
39 Ga0070709_10002338 3300005434 Bacteria 10273
40 Ga0070709_10629021 3300005434 Bacteria 829
41 Ga0070709_11163347 3300005434 Bacteria 619
42 Ga0070714_100066550 3300005435 Bacteria 3105
43 Ga0070713_100397034 3300005436 Bacteria 1287
44 Ga0070710_10005939 3300005437 Bacteria 5829
45 Ga0070710_10109550 3300005437 Bacteria 1657
46 Ga0070711_100002208 3300005439 Bacteria 11048
47 Ga0070711_100051142 3300005439 Bacteria 2836
48 Ga0070705_100525593 3300005440 Bacteria 903
49 Ga0070694_100867171 3300005444 Bacteria 744
50 Ga0070708_100514024 3300005445 Bacteria 1130
51 Ga0070663_100251085 3300005455 Bacteria 1400
52 Ga0070663_100303529 3300005455 Bacteria 1279
53 Ga0070663_100779159 3300005455 Bacteria 819
54 Ga0070678_100238015 3300005456 Bacteria 1521
55 Ga0070678_100334684 3300005456 Bacteria 1297
56 Ga0070678_100573215 3300005456 Bacteria 1005
57 Ga0070681_10057197 3300005458 Bacteria 3880
58 Ga0070685_10278521 3300005466 Bacteria 1119
59 Ga0070698_100492898 3300005471 Bacteria 1163
60 Ga0070699_101135331 3300005518 Bacteria 717
61 Ga0070679_100083419 3300005530 Bacteria 3184
62 Ga0070679_100099081 3300005530 Bacteria 2902
63 Ga0070679_100148109 3300005530 Bacteria 2325
64 Ga0070679_100184985 3300005530 Bacteria 2055
65 Ga0070679_100210094 3300005530 Bacteria 1910
66 Ga0068853_100002207 3300005539 Bacteria 14542
67 Ga0068853_100006767 3300005539 Bacteria 9133
68 Ga0068853_100091422 3300005539 Bacteria 2676
69 Ga0068853_100272578 3300005539 Bacteria 1559
70 Ga0068853_100978694 3300005539 Bacteria 814
71 Ga0070686_100147014 3300005544 Bacteria 1646
72 Ga0070695_100487240 3300005545 Bacteria 951
73 Ga0070695_101488598 3300005545 Bacteria 563
74 Ga0070696_101245527 3300005546 Bacteria 630
75 Ga0070696_101319510 3300005546 Bacteria 613
76 Ga0070696_101408141 3300005546 Bacteria 595
77 Ga0070693_100068028 3300005547 Bacteria 2090
78 Ga0070665_100151870 3300005548 Bacteria 2319
79 Ga0070665_100255745 3300005548 Bacteria 1752
80 Ga0070665_100356008 3300005548 Bacteria 1469
81 Ga0068855_100110807 3300005563 Bacteria 3150
82 Ga0068855_100112947 3300005563 Bacteria 3117
83 Ga0068855_100187469 3300005563 Bacteria 2336
84 Ga0068855_100386088 3300005563 Bacteria 1537
85 Ga0068855_101139469 3300005563 Bacteria 814
86 Ga0070664_100098130 3300005564 Bacteria 2545
87 Ga0068857_100044284 3300005577 Bacteria 3947
88 Ga0068854_100008629 3300005578 Bacteria 6559
89 Ga0068854_100451514 3300005578 Bacteria 1074
90 Ga0068856_100054109 3300005614 Bacteria 3958
91 Ga0068856_100116648 3300005614 Bacteria 2670
92 Ga0068856_100182397 3300005614 Bacteria 2113
93 Ga0070702_100060854 3300005615 Bacteria 2197
94 Ga0070702_100983130 3300005615 Bacteria 667
95 Ga0068852_100011735 3300005616 Bacteria 6614
96 Ga0068852_100152915 3300005616 Bacteria 2147
97 Ga0068852_100212069 3300005616 Bacteria 1838
98 Ga0068852_100225372 3300005616 Bacteria 1784
99 Ga0068852_100655435 3300005616 Bacteria 1058
100 Ga0068859_100057352 3300005617 Bacteria 3923
101 Ga0068866_10503710 3300005718 Bacteria 802
102 Ga0068861_100020959 3300005719 Bacteria 4691
103 Ga0068861_100051542 3300005719 Bacteria 3124
104 Ga0068861_101110147 3300005719 Bacteria 760
105 Ga0068851_10017739 3300005834 Bacteria 3423
106 Ga0068863_100042307 3300005841 Bacteria 4329
107 Ga0068858_100072672 3300005842 Bacteria 3191
108 Ga0068860_100333005 3300005843 Bacteria 1491
109 Ga0068860_100821145 3300005843 Bacteria 943
110 Ga0081540_1053672 3300005983 Bacteria 1975
111 Ga0070717_10022827 3300006028 Bacteria 4950
112 Ga0070717_10223200 3300006028 Bacteria 1657
113 Ga0075365_10020835 3300006038 Bacteria 4074
114 Ga0075365_10327183 3300006038 Bacteria 1079
115 Ga0075365_10795019 3300006038 Bacteria 668
116 Ga0075368_10325398 3300006042 Bacteria 666
117 Ga0075363_100162596 3300006048 Bacteria 1265
118 Ga0075364_10069634 3300006051 Bacteria 2315
119 Ga0075364_10075732 3300006051 Bacteria 2220
120 Ga0075364_10860063 3300006051 Bacteria 617
121 Ga0070715_10000762 3300006163 Bacteria 8717
122 Ga0070716_100038130 3300006173 Bacteria 2659
123 Ga0070716_100169405 3300006173 Bacteria 1424
124 Ga0070716_100190831 3300006173 Bacteria 1354
125 Ga0070716_100595356 3300006173 Bacteria 831
126 Ga0070712_100033040 3300006175 Bacteria 3497
127 Ga0070712_100306226 3300006175 Bacteria 1287
128 Ga0070712_100681618 3300006175 Bacteria 875
129 Ga0075367_10081962 3300006178 Bacteria 1953
130 Ga0075367_10847157 3300006178 Bacteria 583
131 Ga0075369_10006028 3300006186 Bacteria 4565
132 Ga0075369_10097985 3300006186 Bacteria 1313
133 Ga0075366_10038074 3300006195 Bacteria 2840
134 Ga0097621_100130302 3300006237 Bacteria 2140
135 Ga0075370_10196716 3300006353 Bacteria 1189
136 Ga0075370_10264025 3300006353 Bacteria 1021
137 Ga0068871_100261466 3300006358 Bacteria 1510
138 Ga0075434_100845158 3300006871 Bacteria 931
139 Ga0068865_101184368 3300006881 Bacteria 676
140 Ga0097620_100057352 3300006931 Bacteria 3923
141 Ga0099794_10039886 3300007265 Bacteria 2231
142 Ga0105240_10012128 3300009093 Bacteria 11932
143 Ga0105240_10044810 3300009093 Bacteria 5616
144 Ga0105245_10058082 3300009098 Bacteria 3482
145 Ga0105247_10006919 3300009101 Bacteria 6984
146 Ga0105243_10074303 3300009148 Bacteria 2757
147 Ga0105243_11067632 3300009148 Bacteria 814
148 Ga0105241_10054562 3300009174 Bacteria 3059
149 Ga0105241_10242460 3300009174 Bacteria 1524
150 Ga0105242_10252974 3300009176 Bacteria 1588
151 Ga0105237_10078243 3300009545 Bacteria 3296
152 Ga0105237_10179551 3300009545 Bacteria 2117
153 Ga0105237_10577958 3300009545 Bacteria 1130
154 Ga0105238_10040525 3300009551 Bacteria 4719
155 Ga0105238_11233256 3300009551 Bacteria 773
156 Ga0105238_11659595 3300009551 Bacteria 670
157 Ga0105249_10022931 3300009553 Bacteria 5596
158 Ga0105249_10595320 3300009553 Bacteria 1160
159 Ga0105239_10056734 3300010375 Bacteria 4296
160 Ga0105239_10064895 3300010375 Bacteria 4008
161 Ga0105246_10030323 3300011119 Bacteria 3570
162 Ga0105246_11185711 3300011119 Bacteria 702
163 Ga0157370_10109082 3300013104 Bacteria 2588
164 Ga0157369_10006388 3300013105 Bacteria 13666
165 Ga0157369_10044612 3300013105 Bacteria 4824
166 Ga0157369_10158875 3300013105 Bacteria 2386
167 Ga0157369_10802110 3300013105 Bacteria 967
168 Ga0157378_10328789 3300013297 Bacteria 1487
169 Ga0157372_10149159 3300013307 Bacteria 2698
170 Ga0157375_10045330 3300013308 Bacteria 4279
171 Ga0157380_10101682 3300014326 Bacteria 2395
172 Ga0157380_11474009 3300014326 Bacteria 733
173 Ga0157376_10858234 3300014969 Bacteria 924
174 Ga0163161_10200638 3300017792 Bacteria 1537
175 Ga0163161_10316643 3300017792 Bacteria 1232
176 Ga0206354_11284064 3300020081 Bacteria 1027
177 Ga0224712_10087246 3300022467 Bacteria 1300
178 Ga0209233_1036920 3300025261 Bacteria 1091
179 Ga0209564_1000397 3300025295 Bacteria 77778
180 Ga0209564_1008259 3300025295 Bacteria 5177
181 Ga0207656_10004387 3300025321 Bacteria 4924
182 Ga0207692_10019957 3300025898 Bacteria 3039
183 Ga0207692_10083953 3300025898 Bacteria 1710
184 Ga0207642_10146538 3300025899 Bacteria 1251
185 Ga0207642_10260852 3300025899 Bacteria 988
186 Ga0207710_10070725 3300025900 Bacteria 1600
187 Ga0207688_10560341 3300025901 Bacteria 718
188 Ga0207680_10081903 3300025903 Bacteria 2030
189 Ga0207647_10055549 3300025904 Bacteria 2433
190 Ga0207699_10003036 3300025906 Bacteria 7971
191 Ga0207699_10046371 3300025906 Bacteria 2542
192 Ga0207699_10153939 3300025906 Bacteria 1524
193 Ga0207699_10678623 3300025906 Bacteria 753
194 Ga0207699_10800436 3300025906 Bacteria 693
195 Ga0207645_10122652 3300025907 Bacteria 1688
196 Ga0207654_10001136 3300025911 Bacteria 14369
197 Ga0207654_10075482 3300025911 Bacteria 2015
198 Ga0207654_10164125 3300025911 Bacteria 1437
199 Ga0207707_10002224 3300025912 Bacteria 17529
200 Ga0207707_10084314 3300025912 Bacteria 2775
201 Ga0207695_10004577 3300025913 Bacteria 18798
202 Ga0207695_10137453 3300025913 Bacteria 2396
203 Ga0207695_10879181 3300025913 Bacteria 776
204 Ga0207671_10250349 3300025914 Bacteria 1393
205 Ga0207671_10586616 3300025914 Bacteria 888
206 Ga0207693_10060842 3300025915 Bacteria 2958
207 Ga0207693_10110049 3300025915 Bacteria 2160
208 Ga0207693_10114738 3300025915 Bacteria 2114
209 Ga0207693_10132194 3300025915 Bacteria 1962
210 Ga0207663_10000239 3300025916 Bacteria 24165
211 Ga0207663_10193366 3300025916 Bacteria 1462
212 Ga0207660_10022785 3300025917 Bacteria 4222
213 Ga0207660_10179444 3300025917 Bacteria 1644
214 Ga0207660_10211996 3300025917 Bacteria 1517
215 Ga0207660_10676250 3300025917 Bacteria 842
216 Ga0207657_10005246 3300025919 Bacteria 13576
217 Ga0207649_10196687 3300025920 Bacteria 1421
218 Ga0207652_10004348 3300025921 Bacteria 11546
219 Ga0207652_10052869 3300025921 Bacteria 3488
220 Ga0207652_10120190 3300025921 Bacteria 2337
221 Ga0207652_10129972 3300025921 Bacteria 2246
222 Ga0207652_10758183 3300025921 Bacteria 863
223 Ga0207681_10195828 3300025923 Bacteria 1549
224 Ga0207694_10000263 3300025924 Bacteria 50099
225 Ga0207694_11232027 3300025924 Bacteria 633
226 Ga0207687_10042859 3300025927 Bacteria 3116
227 Ga0207700_10005825 3300025928 Bacteria 7404
228 Ga0207700_10231565 3300025928 Bacteria 1571
229 Ga0207664_10010462 3300025929 Bacteria 6554
230 Ga0207664_10560936 3300025929 Bacteria 1025
231 Ga0207644_10073099 3300025931 Bacteria 2513
232 Ga0207644_10532583 3300025931 Bacteria 971
233 Ga0207644_10642325 3300025931 Bacteria 883
234 Ga0207690_10076892 3300025932 Bacteria 2319
235 Ga0207706_10154767 3300025933 Bacteria 2016
236 Ga0207706_10581869 3300025933 Bacteria 962
237 Ga0207709_10537243 3300025935 Bacteria 918
238 Ga0207709_10710385 3300025935 Bacteria 805
239 Ga0207669_10221830 3300025937 Bacteria 1388
240 Ga0207704_10605344 3300025938 Bacteria 898
241 Ga0207665_10016227 3300025939 Bacteria 4890
242 Ga0207665_10191928 3300025939 Bacteria 1484
243 Ga0207665_10648429 3300025939 Bacteria 827
244 Ga0207665_10808577 3300025939 Bacteria 741
245 Ga0207691_10041060 3300025940 Bacteria 4274
246 Ga0207689_10046118 3300025942 Bacteria 3603
247 Ga0207661_10054826 3300025944 Bacteria 3195
248 Ga0207679_10168553 3300025945 Bacteria 1800
249 Ga0207667_10042856 3300025949 Bacteria 4807
250 Ga0207667_10173858 3300025949 Bacteria 2213
251 Ga0207667_10203698 3300025949 Bacteria 2029
252 Ga0207712_10210246 3300025961 Bacteria 1549
253 Ga0207668_10241608 3300025972 Bacteria 1461
254 Ga0207668_10245353 3300025972 Bacteria 1451
255 Ga0207668_10632743 3300025972 Bacteria 935
256 Ga0207668_11194760 3300025972 Bacteria 683
257 Ga0207668_11687935 3300025972 Bacteria 572
258 Ga0207640_10175528 3300025981 Bacteria 1601
259 Ga0207640_10420267 3300025981 Bacteria 1094
260 Ga0207658_10084693 3300025986 Bacteria 2440
261 Ga0207658_10345018 3300025986 Bacteria 1295
262 Ga0207677_10102129 3300026023 Bacteria 2113
263 Ga0207677_11171544 3300026023 Bacteria 703
264 Ga0207703_10035937 3300026035 Bacteria 3940
265 Ga0207703_10256676 3300026035 Bacteria 1578
266 Ga0207703_10413620 3300026035 Bacteria 1253
267 Ga0207639_10033069 3300026041 Bacteria 3812
268 Ga0207639_10080572 3300026041 Bacteria 2576
269 Ga0207639_10091060 3300026041 Bacteria 2441
270 Ga0207639_10173933 3300026041 Bacteria 1826
271 Ga0207678_10028150 3300026067 Bacteria 4908
272 Ga0207678_10040957 3300026067 Bacteria 4016
273 Ga0207678_10054613 3300026067 Bacteria 3440
274 Ga0207678_10091992 3300026067 Bacteria 2592
275 Ga0207702_10000003 3300026078 Bacteria 434196
276 Ga0207702_10051208 3300026078 Bacteria 3488
277 Ga0207641_10082654 3300026088 Bacteria 2791
278 Ga0207641_11511426 3300026088 Bacteria 673
279 Ga0207648_10064662 3300026089 Bacteria 3188
280 Ga0207676_10143282 3300026095 Bacteria 2048
281 Ga0207674_10042085 3300026116 Bacteria 4721
282 Ga0207674_10207845 3300026116 Bacteria 1907
283 Ga0207675_100099894 3300026118 Bacteria 2733
284 Ga0207675_100123214 3300026118 Bacteria 2454
285 Ga0207683_10021485 3300026121 Bacteria 5526
286 Ga0207683_10338347 3300026121 Bacteria 1380
287 Ga0207683_10449844 3300026121 Bacteria 1187
288 Ga0207698_10003760 3300026142 Bacteria 9172
289 Ga0207698_10020150 3300026142 Bacteria 4585
290 Ga0207698_10235550 3300026142 Bacteria 1665
291 Ga0207698_10429937 3300026142 Bacteria 1269
292 Ga0207698_10519180 3300026142 Bacteria 1162
293 Ga0209588_1005209 3300027671 Bacteria 3711
294 Ga0268266_10059443 3300028379 Bacteria 3293
295 Ga0268266_10194248 3300028379 Bacteria 1854
296 Ga0268265_10050565 3300028380 Bacteria 3132
297 Ga0268265_10219823 3300028380 Bacteria 1661
298 Ga0268264_10910392 3300028381 Bacteria 883
299 Ga0265334_10054880 3300028573 Bacteria 1518
300 Ga0265323_10000847 3300028653 Bacteria 16290
301 Ga0265336_10000460 3300028666 Bacteria 24606
302 Ga0307515_10076032 3300028794 Bacteria 4463
303 Ga0265338_10007843 3300028800 Bacteria 13114
304 Ga0307512_10395848 3300030522 Bacteria 583
305 Ga0265332_10059337 3300031238 Bacteria 1637
306 Ga0265340_10072641 3300031247 Bacteria 1629
307 Ga0265339_10005327 3300031249 Bacteria 8573
308 Ga0265339_10128751 3300031249 Bacteria 1296
309 Ga0265331_10244465 3300031250 Bacteria 805
310 Ga0265331_10246596 3300031250 Bacteria 801
311 Ga0265316_10318944 3300031344 Bacteria 1129
312 Ga0307513_10219859 3300031456 Bacteria 1722
313 Ga0307408_100581111 3300031548 Bacteria 993
314 Ga0307516_10014441 3300031730 Bacteria 8353
315 Ga0307516_10574527 3300031730 Bacteria 781
316 Ga0307405_10055884 3300031731 Bacteria 2473
317 Ga0307412_10119924 3300031911 Bacteria 1892
318 Ga0307412_10404727 3300031911 Bacteria 1112
319 Ga0373938_0006155 3300034957 Bacteria 2064
320 Ga0373940_0121661 3300035088 Bacteria 810
321 Ga0373940_0256389 3300035088 Bacteria 591
322 Ga0373923_0014550 3300035111 Bacteria 2957
323 Ga0373932_0210730 3300035112 Bacteria 694
324 Ga0373936_0013008 3300035113 Bacteria 3173
325 Ga0373945_0014721 3300035116 Bacteria 2625
326 Ga0373954_0055775 3300035118 Bacteria 1859
327 Ga0373957_0007752 3300035120 Bacteria 3448
328 Ga0373960_0124614 3300035121 Bacteria 858
329 Ga0373943_0040038 3300035170 Bacteria 2261
330 Ga0373943_0046688 3300035170 Bacteria 2114
331 Ga0373946_0042460 3300035171 Bacteria 1869
332 Ga0373955_0078419 3300035172 Bacteria 1861
333 Ga0373955_0309490 3300035172 Bacteria 953
334 Ga0373962_0194317 3300035242 Bacteria 684
335 Ga0373931_0002919 3300035691 Bacteria 7629
336 Ga0373935_0051350 3300035692 Bacteria 2618
337 Ga0373935_0278633 3300035692 Bacteria 1177
338 Ga0373927_0002293 3300035695 Bacteria 14012
339 Ga0373927_0046721 3300035695 Bacteria 2800
340 Ga0373927_0271406 3300035695 Bacteria 1115
341 Ga0373927_0679097 3300035695 Bacteria 680
342 Ga0373947_0006111 3300035725 Bacteria 7012
343 Ga0373947_0106522 3300035725 Bacteria 1767
344 Ga0373937_0105606 3300036401 Bacteria 2617
345 Ga0372808_001604 3300036459 Bacteria 2400
346 Ga0310109_027382 3300036534 Bacteria 761
347 Ga0373925_0020497 3300037068 Bacteria 4813
348 Ga0373925_0048125 3300037068 Bacteria 3176
349 Ga0373925_0272686 3300037068 Bacteria 1361
350 Ga0373925_0646131 3300037068 Bacteria 872
351 Ga0373925_1139995 3300037068 Bacteria 641
352 Ga0395905_0127901 3300037471 Bacteria 2389
353 Ga0436365_1452029 3300039437 Bacteria 656
354 Ga0436360_0554802 3300039438 Bacteria 1357
355 Ga0436363_0923830 3300039450 Bacteria 4649
356 Ga0436363_1496608 3300039450 Bacteria 2134
357 Ga0451847_0777966 3300041503 Bacteria 1300
358 Ga0451853_2446561 3300041512 Bacteria 817
359 Ga0466963_0113153 3300044694 Bacteria 1864
360 Ga0466967_0046134 3300045976 Bacteria 3792
361 Ga0466967_0556264 3300045976 Bacteria 1129
362 Ga0495592_0136373 3300046454 Bacteria 1711
363 Ga0495603_0003213 3300046455 Bacteria 9727
364 Ga0495603_0805827 3300046455 Bacteria 535
365 Ga0495590_0376425 3300046457 Bacteria 542
366 Ga0495629_0560374 3300046459 Bacteria 766
367 Ga0495638_0062940 3300046460 Bacteria 2288
368 Ga0495641_0222896 3300046461 Bacteria 846
369 Ga0495580_0026362 3300046472 Bacteria 4238
370 Ga0495580_0034224 3300046472 Bacteria 3658
371 Ga0495582_0036609 3300046473 Bacteria 2699
372 Ga0495605_0075166 3300046474 Bacteria 1589
373 Ga0495639_0066929 3300046475 Bacteria 1654
374 Ga0495662_0056597 3300046476 Bacteria 1894
375 Ga0495662_0288997 3300046476 Bacteria 807
376 Ga0495664_0029722 3300046477 Bacteria 3197
377 Ga0495664_0132249 3300046477 Bacteria 1511
378 Ga0495584_0119964 3300046491 Bacteria 1332
379 Ga0495594_0077975 3300046499 Bacteria 1849
380 Ga0495607_0054602 3300046501 Bacteria 2301
381 Ga0495583_0029797 3300046506 Bacteria 2666
382 Ga0495606_0035317 3300046507 Bacteria 3418
383 Ga0495608_0467821 3300046511 Bacteria 766
384 Ga0495610_0202277 3300046512 Bacteria 812
385 Ga0495618_0020926 3300046514 Bacteria 4028
386 Ga0495620_0018688 3300046515 Bacteria 3428
387 Ga0495628_0886223 3300046516 Bacteria 620
388 Ga0495630_0039230 3300046517 Bacteria 3542
389 Ga0495643_0056808 3300046522 Bacteria 2087
390 Ga0495644_0166884 3300046523 Bacteria 845
391 Ga0495648_0187908 3300046524 Bacteria 1044
392 Ga0495666_0106963 3300046526 Bacteria 1315
393 Ga0495654_0023580 3300046530 Bacteria 3186
394 Ga0495665_0026730 3300046531 Bacteria 3099
395 Ga0495609_0026919 3300046538 Bacteria 2630
396 Ga0495609_0152324 3300046538 Bacteria 983
397 Ga0495597_0031306 3300046542 Bacteria 2422
398 Ga0495645_0046942 3300046543 Bacteria 3148
399 Ga0495645_0109425 3300046543 Bacteria 1956
400 Ga0495622_0128150 3300046557 Bacteria 1156
401 Ga0495622_0242485 3300046557 Bacteria 794
402 Ga0495667_0038450 3300046559 Bacteria 3186
403 Ga0495656_0099871 3300046615 Bacteria 1341
404 Ga0495656_0259273 3300046615 Bacteria 880
405 Ga0495668_0295274 3300046616 Bacteria 888
406 Ga0495634_0036766 3300046642 Bacteria 3347
407 Ga0495611_0211119 3300046648 Bacteria 904
408 Ga0495625_0111295 3300046660 Bacteria 1871
409 Ga0495588_0034937 3300046674 Bacteria 2545
410 Ga0495588_0145361 3300046674 Bacteria 1253
411 Ga0495599_0180496 3300046678 Bacteria 1301
412 Ga0495658_0021799 3300046683 Bacteria 3381
413 Ga0495658_0199371 3300046683 Bacteria 1247
414 Ga0495669_0005476 3300046684 Bacteria 5299
415 Ga0495669_0454636 3300046684 Bacteria 622
416 Ga0495613_0396526 3300046689 Bacteria 942
417 Ga0495613_0697923 3300046689 Bacteria 668
418 Ga0495624_0079643 3300046690 Bacteria 2031
419 Ga0495670_0031823 3300046691 Bacteria 2622
420 Ga0495670_0330455 3300046691 Bacteria 819
421 Ga0495671_0030072 3300046692 Bacteria 2784
422 Ga0495581_0047059 3300047315 Bacteria 2493
423 Ga0495604_0106527 3300047317 Bacteria 2050
424 Ga0495674_0014414 3300047319 Bacteria 7399
425 Ga0495677_0234835 3300047445 Bacteria 716
426 Ga0495684_0002699 3300047471 Bacteria 14047
427 Ga0495593_0011625 3300047673 Bacteria 5051
428 Ga0496100_0174641 3300048903 Bacteria 1550
429 Ga0496100_0844703 3300048903 Bacteria 718
430 Ga0496101_0090423 3300048904 Bacteria 2277
431 Ga0496101_0692758 3300048904 Bacteria 805
432 Ga0496102_0067840 3300048905 Bacteria 3272
433 Ga0496102_0183360 3300048905 Bacteria 1972
434 Ga0496102_1053369 3300048905 Bacteria 733
435 Ga0496103_0064217 3300048906 Bacteria 2288
436 Ga0496103_0748045 3300048906 Bacteria 618
437 Ga0496104_0020638 3300048907 Bacteria 6041
438 Ga0496104_0258816 3300048907 Bacteria 1653
439 Ga0496104_0650923 3300048907 Bacteria 963
440 Ga0496105_0027529 3300048908 Bacteria 4645
441 Ga0496106_0000274 3300048909 Bacteria 36362
442 Ga0496106_0046679 3300048909 Bacteria 3257
443 Ga0496106_0639790 3300048909 Bacteria 850
444 Ga0496106_1189453 3300048909 Bacteria 595
445 Ga0496107_0022390 3300048910 Bacteria 4465
446 Ga0496107_0029095 3300048910 Bacteria 3928
447 Ga0496107_0195274 3300048910 Bacteria 1504
448 Ga0496108_0082670 3300048911 Bacteria 2723
449 Ga0496108_0117890 3300048911 Bacteria 2275
450 Ga0496108_0136620 3300048911 Bacteria 2110
451 Ga0496109_0001723 3300048912 Bacteria 18237
452 Ga0496109_0275164 3300048912 Bacteria 1586
453 Ga0496109_0534623 3300048912 Bacteria 1106
454 Ga0496110_0432748 3300048913 Bacteria 1199
455 Ga0496110_0574511 3300048913 Bacteria 1024
456 Ga0496111_0078867 3300048914 Bacteria 2402
457 Ga0496111_0092497 3300048914 Bacteria 2217
458 Ga0496111_0799896 3300048914 Bacteria 682
459 Ga0496112_0001789 3300048915 Bacteria 16907
460 Ga0496112_0024667 3300048915 Bacteria 5764
461 Ga0496112_0028860 3300048915 Bacteria 5360
462 Ga0496112_0127489 3300048915 Bacteria 2515
463 Ga0496112_0353181 3300048915 Bacteria 1412
464 Ga0496113_0005868 3300048916 Bacteria 7708
465 Ga0496113_0251620 3300048916 Bacteria 1411
466 Ga0496113_0671692 3300048916 Bacteria 828
467 Ga0496113_0722137 3300048916 Bacteria 794
468 Ga0496114_0091581 3300048917 Bacteria 2582
469 Ga0496115_0123983 3300048918 Bacteria 2127
470 Ga0496115_0396721 3300048918 Bacteria 1120
471 Ga0496115_0428720 3300048918 Bacteria 1071
472 Ga0496115_0629897 3300048918 Bacteria 850
473 Ga0496116_0001009 3300048919 Bacteria 34303
474 Ga0496116_0127293 3300048919 Bacteria 1460
475 Ga0496117_0091841 3300048920 Bacteria 1951
476 Ga0496117_0110318 3300048920 Bacteria 1715
477 Ga0496117_0387053 3300048920 Bacteria 710
478 Ga0496118_0069653 3300048921 Bacteria 2546
479 Ga0496118_0090141 3300048921 Bacteria 2114
480 Ga0496119_0099687 3300048922 Bacteria 1633
481 Ga0496120_0046524 3300048923 Bacteria 2507
482 Ga0496121_0102338 3300048924 Bacteria 2207
483 Ga0496121_0194387 3300048924 Bacteria 1452
484 Ga0496121_0292661 3300048924 Bacteria 1108
485 Ga0496121_0539509 3300048924 Bacteria 732
486 Ga0496122_0048488 3300048925 Bacteria 3264
487 Ga0496122_0077299 3300048925 Bacteria 2338
488 Ga0496122_0098738 3300048925 Bacteria 1960
489 Ga0496122_0103679 3300048925 Bacteria 1892
490 Ga0496123_0141060 3300048926 Bacteria 1317
491 Ga0496124_0198097 3300048927 Bacteria 1530
492 Ga0496125_0000158 3300048928 Bacteria 151273
493 Ga0496125_0001221 3300048928 Bacteria 38541
494 Ga0496125_0010378 3300048928 Bacteria 9421
495 Ga0496125_0018363 3300048928 Bacteria 6645
496 Ga0496125_0175415 3300048928 Bacteria 1435
497 Ga0496126_0007041 3300048929 Bacteria 12402
498 Ga0496126_0008848 3300048929 Bacteria 10790
499 Ga0496126_0040463 3300048929 Bacteria 4320
500 Ga0496126_0233609 3300048929 Bacteria 1539
501 Ga0496126_0377784 3300048929 Bacteria 1154
502 Ga0496126_0473306 3300048929 Bacteria 1005
503 Ga0496126_0565909 3300048929 Bacteria 900
504 Ga0496126_0631730 3300048929 Bacteria 840
505 Ga0496126_0870643 3300048929 Bacteria 685
506 Ga0496126_1174004 3300048929 Bacteria 566
507 Ga0501042_0850839 3300049578 Bacteria 664
508 Ga0501076_0422936 3300049592 Bacteria 1096
509 Ga0501080_0483392 3300049742 Bacteria 1108
510 Ga0501045_0231447 3300049824 Bacteria 1376
511 nmdc:mga03n38_424572_c1 3300050490 Bacteria 736
512 nmdc:mga03n38_844047_c1 3300050490 Bacteria 535
513 nmdc:mga00v17_128642_c1 3300050491 Bacteria 1617
514 nmdc:mga00v17_164221_c1 3300050491 Bacteria 1431
515 nmdc:mga0yw44_235804_c1 3300050492 Bacteria 1215
516 nmdc:mga0yw44_654961_c1 3300050492 Bacteria 714
517 nmdc:mga0k408_160835_c1 3300050493 Bacteria 1338
518 nmdc:mga06z11_323140_c1 3300050494 Bacteria 921
519 nmdc:mga06z11_601556_c1 3300050494 Bacteria 669
520 nmdc:mga06z11_622363_c1 3300050494 Bacteria 657
521 nmdc:mga04h51_140893_c1 3300050495 Bacteria 914
522 nmdc:mga07m45_210725_c1 3300050496 Bacteria 1130
523 nmdc:mga07m45_319398_c1 3300050496 Bacteria 903
524 nmdc:mga0n895_837372_c1 3300050512 Bacteria 908
525 nmdc:mga0sz30_189158_c1 3300050516 Bacteria 914
526 nmdc:mga0sz30_3737_c1 3300050516 Bacteria 5486
527 Ga0495601_0047533 3300053077 Bacteria 2702
528 Ga0495601_0427557 3300053077 Bacteria 857
529 Ga0495612_0043952 3300053078 Bacteria 1827
530 Ga0495612_0167296 3300053078 Bacteria 962
531 Ga0495655_0247704 3300053083 Bacteria 598
532 Ga0495595_0077423 3300053084 Bacteria 1580
533 Ga0500578_0047504 3300053086 Bacteria 2754
534 Ga0500644_0106713 3300053088 Bacteria 1072
535 Ga0500581_019636 3300053089 Bacteria 3411
536 Ga0500646_0092618 3300053090 Bacteria 938
537 Ga0500651_0037934 3300053093 Bacteria 3036
538 Ga0500566_0002015 3300053094 Bacteria 11989
539 Ga0500566_0023225 3300053094 Bacteria 3640
540 Ga0500566_0184062 3300053094 Bacteria 1069
541 Ga0500641_0023710 3300053096 Bacteria 2362
542 Ga0500650_0059980 3300053098 Bacteria 1775
543 Ga0500554_078792 3300053102 Bacteria 1082
544 Ga0500555_025706 3300053103 Bacteria 1685
545 Ga0500556_0000029 3300053104 Bacteria 165326
546 Ga0500592_001711 3300053116 Bacteria 3556
547 Ga0500594_0004224 3300053118 Bacteria 3168
548 Ga0500595_000842 3300053119 Bacteria 17493
549 Ga0500608_017399 3300053122 Bacteria 3264
550 Ga0500614_125702 3300053123 Bacteria 758
551 Ga0500618_004224 3300053125 Bacteria 4663
552 Ga0500618_007533 3300053125 Bacteria 3098
553 Ga0500642_0000020 3300053130 Bacteria 159498
554 Ga0500652_003899 3300053131 Bacteria 4559
555 Ga0500559_0000288 3300053136 Bacteria 38883
556 Ga0500577_0029354 3300053142 Bacteria 1903
557 Ga0500577_0107404 3300053142 Bacteria 1148
558 Ga0500586_013405 3300053145 Bacteria 2412
559 Ga0500588_0055539 3300053146 Bacteria 1251
560 Ga0500590_021761 3300053148 Bacteria 3327
561 Ga0500616_0000112 3300053153 Bacteria 151210
562 Ga0500627_0055489 3300053158 Bacteria 1734
563 Ga0500633_0014300 3300053160 Bacteria 2249
564 Ga0500638_010417 3300053162 Bacteria 4071
565 Ga0500636_0010810 3300053177 Bacteria 5334
566 Ga0500636_0113825 3300053177 Bacteria 1525
567 Ga0500637_0000251 3300053178 Bacteria 19903
568 Ga0500637_0174779 3300053178 Bacteria 1233
569 Ga0500567_076978 3300053723 Bacteria 1450
570 Ga0500645_069909 3300053730 Bacteria 1008
571 Ga0500661_004969 3300055283 Bacteria 2492
572 Ga0501082_0353746 3300060353 Bacteria 1281

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10044810 Ga0105240_100448103 134
2 3300009174 Ga0105241_10242460 Ga0105241_102424602 134
3 3300009545 Ga0105237_10577958 Ga0105237_105779581 134
4 3300005546 Ga0070696_101245527 Ga0070696_1012455271 146
5 3300041503 Ga0451847_0777966 Ga0451847_0777966_548_1072 146
6 3300046455 Ga0495603_0805827 Ga0495603_0805827_72_512 146
7 3300050490 nmdc:mga03n38_844047_c1 nmdc:mga03n38_844047_c1_41_511 146
8 3300005262 Ga0065165_1023758 Ga0065165_10237582 147
9 3300005336 Ga0070680_100101388 Ga0070680_1001013882 147
10 3300005336 Ga0070680_100253650 Ga0070680_1002536501 147
11 3300005337 Ga0070682_100031969 Ga0070682_1000319693 147
12 3300005341 Ga0070691_10560839 Ga0070691_105608391 147
13 3300005434 Ga0070709_11163347 Ga0070709_111633471 147
14 3300005458 Ga0070681_10057197 Ga0070681_100571973 147
15 3300005530 Ga0070679_100083419 Ga0070679_1000834193 147
16 3300005539 Ga0068853_100978694 Ga0068853_1009786942 147
17 3300005545 Ga0070695_100487240 Ga0070695_1004872401 147
18 3300005547 Ga0070693_100068028 Ga0070693_1000680282 147
19 3300005548 Ga0070665_100356008 Ga0070665_1003560083 147
20 3300005563 Ga0068855_101139469 Ga0068855_1011394691 147
21 3300006038 Ga0075365_10020835 Ga0075365_100208352 147
22 3300006042 Ga0075368_10325398 Ga0075368_103253981 147
23 3300006051 Ga0075364_10075732 Ga0075364_100757322 147
24 3300006173 Ga0070716_100169405 Ga0070716_1001694053 147
25 3300006186 Ga0075369_10006028 Ga0075369_100060282 147
26 3300006353 Ga0075370_10196716 Ga0075370_101967161 147
27 3300009551 Ga0105238_11233256 Ga0105238_112332561 147
28 3300025295 Ga0209564_1008259 Ga0209564_10082593 147
29 3300025906 Ga0207699_10153939 Ga0207699_101539391 147
30 3300025911 Ga0207654_10164125 Ga0207654_101641252 147
31 3300025912 Ga0207707_10084314 Ga0207707_100843143 147
32 3300025913 Ga0207695_10137453 Ga0207695_101374532 147
33 3300025917 Ga0207660_10179444 Ga0207660_101794442 147
34 3300025920 Ga0207649_10196687 Ga0207649_101966872 147
35 3300025921 Ga0207652_10052869 Ga0207652_100528693 147
36 3300025981 Ga0207640_10420267 Ga0207640_104202672 147
37 3300026067 Ga0207678_10040957 Ga0207678_100409573 147
38 3300028794 Ga0307515_10076032 Ga0307515_100760324 147
39 3300031456 Ga0307513_10219859 Ga0307513_102198592 147
40 3300031911 Ga0307412_10404727 Ga0307412_104047272 147
41 3300037068 Ga0373925_0272686 Ga0373925_0272686_29_508 147
42 3300039438 Ga0436360_0554802 Ga0436360_0554802_14_457 147
43 3300046457 Ga0495590_0376425 Ga0495590_0376425_26_502 147
44 3300046460 Ga0495638_0062940 Ga0495638_0062940_114_590 147
45 3300046474 Ga0495605_0075166 Ga0495605_0075166_31_507 147
46 3300046501 Ga0495607_0054602 Ga0495607_0054602_109_585 147
47 3300046506 Ga0495583_0029797 Ga0495583_0029797_1085_1561 147
48 3300046507 Ga0495606_0035317 Ga0495606_0035317_2163_2639 147
49 3300046512 Ga0495610_0202277 Ga0495610_0202277_45_521 147
50 3300046515 Ga0495620_0018688 Ga0495620_0018688_2658_3134 147
51 3300046522 Ga0495643_0056808 Ga0495643_0056808_412_888 147
52 3300046524 Ga0495648_0187908 Ga0495648_0187908_386_862 147
53 3300046530 Ga0495654_0023580 Ga0495654_0023580_1201_1677 147
54 3300046538 Ga0495609_0026919 Ga0495609_0026919_377_853 147
55 3300046542 Ga0495597_0031306 Ga0495597_0031306_995_1471 147
56 3300046660 Ga0495625_0111295 Ga0495625_0111295_1361_1837 147
57 3300046691 Ga0495670_0031823 Ga0495670_0031823_108_584 147
58 3300046692 Ga0495671_0030072 Ga0495671_0030072_950_1426 147
59 3300048909 Ga0496106_0639790 Ga0496106_0639790_218_745 147
60 3300048916 Ga0496113_0671692 Ga0496113_0671692_280_756 147
61 3300048919 Ga0496116_0001009 Ga0496116_0001009_23791_24318 147
62 3300048919 Ga0496116_0127293 Ga0496116_0127293_452_928 147
63 3300048920 Ga0496117_0091841 Ga0496117_0091841_622_1149 147
64 3300048920 Ga0496117_0110318 Ga0496117_0110318_888_1364 147
65 3300048921 Ga0496118_0069653 Ga0496118_0069653_633_1160 147
66 3300048923 Ga0496120_0046524 Ga0496120_0046524_947_1423 147
67 3300048924 Ga0496121_0194387 Ga0496121_0194387_299_778 147
68 3300048924 Ga0496121_0292661 Ga0496121_0292661_15_491 147
69 3300048925 Ga0496122_0048488 Ga0496122_0048488_1272_1748 147
70 3300048925 Ga0496122_0077299 Ga0496122_0077299_1561_2088 147
71 3300048926 Ga0496123_0141060 Ga0496123_0141060_737_1213 147
72 3300048927 Ga0496124_0198097 Ga0496124_0198097_258_785 147
73 3300048928 Ga0496125_0010378 Ga0496125_0010378_4385_4861 147
74 3300048928 Ga0496125_0018363 Ga0496125_0018363_1773_2300 147
75 3300048929 Ga0496126_0233609 Ga0496126_0233609_38_514 147
76 3300048929 Ga0496126_0377784 Ga0496126_0377784_381_908 147
77 3300050491 nmdc:mga00v17_128642_c1 nmdc:mga00v17_128642_c1_699_1226 147
78 3300050494 nmdc:mga06z11_622363_c1 nmdc:mga06z11_622363_c1_18_545 147
79 3300050495 nmdc:mga04h51_140893_c1 nmdc:mga04h51_140893_c1_190_717 147
80 3300050496 nmdc:mga07m45_210725_c1 nmdc:mga07m45_210725_c1_121_648 147
81 3300050516 nmdc:mga0sz30_3737_c1 nmdc:mga0sz30_3737_c1_3239_3766 147
82 3300053083 Ga0495655_0247704 Ga0495655_0247704_12_488 147
83 3300053086 Ga0500578_0047504 Ga0500578_0047504_1137_1613 147
84 3300053088 Ga0500644_0106713 Ga0500644_0106713_490_966 147
85 3300053089 Ga0500581_019636 Ga0500581_019636_2501_2977 147
86 3300053090 Ga0500646_0092618 Ga0500646_0092618_418_894 147
87 3300053094 Ga0500566_0184062 Ga0500566_0184062_418_894 147
88 3300053096 Ga0500641_0023710 Ga0500641_0023710_1583_2059 147
89 3300053103 Ga0500555_025706 Ga0500555_025706_896_1372 147
90 3300053104 Ga0500556_0000029 Ga0500556_0000029_70799_71275 147
91 3300053116 Ga0500592_001711 Ga0500592_001711_1772_2248 147
92 3300053118 Ga0500594_0004224 Ga0500594_0004224_1980_2456 147
93 3300053130 Ga0500642_0000020 Ga0500642_0000020_72537_73013 147
94 3300053131 Ga0500652_003899 Ga0500652_003899_2968_3444 147
95 3300053142 Ga0500577_0107404 Ga0500577_0107404_419_895 147
96 3300053145 Ga0500586_013405 Ga0500586_013405_1667_2143 147
97 3300053146 Ga0500588_0055539 Ga0500588_0055539_701_1177 147
98 3300053153 Ga0500616_0000112 Ga0500616_0000112_72809_73285 147
99 3300053158 Ga0500627_0055489 Ga0500627_0055489_1026_1502 147
100 3300053160 Ga0500633_0014300 Ga0500633_0014300_396_872 147
101 3300053723 Ga0500567_076978 Ga0500567_076978_689_1165 147
102 3300053730 Ga0500645_069909 Ga0500645_069909_470_946 147
103 3300011119 Ga0105246_11185711 Ga0105246_111857111 148
104 3300039437 Ga0436365_1452029 Ga0436365_1452029_113_595 148
105 3300047315 Ga0495581_0047059 Ga0495581_0047059_32_478 148
106 3300036459 Ga0372808_001604 Ga0372808_001604_1624_2109 149
107 3300036534 Ga0310109_027382 Ga0310109_027382_54_539 149
108 3300039450 Ga0436363_0923830 Ga0436363_0923830_3815_4264 149
109 3300053098 Ga0500650_0059980 Ga0500650_0059980_1237_1713 150
110 3300006178 Ga0075367_10081962 Ga0075367_100819622 151
111 3300006195 Ga0075366_10038074 Ga0075366_100380743 151
112 3300050493 nmdc:mga0k408_160835_c1 nmdc:mga0k408_160835_c1_329_811 151
113 3300050494 nmdc:mga06z11_323140_c1 nmdc:mga06z11_323140_c1_358_840 151
114 3300048903 Ga0496100_0174641 Ga0496100_0174641_460_936 152
115 3300048905 Ga0496102_1053369 Ga0496102_1053369_111_587 152
116 3300048909 Ga0496106_0000274 Ga0496106_0000274_26378_26854 152
117 3300048910 Ga0496107_0029095 Ga0496107_0029095_1870_2346 152
118 3300048911 Ga0496108_0082670 Ga0496108_0082670_2003_2479 152
119 3300048912 Ga0496109_0001723 Ga0496109_0001723_4259_4735 152
120 3300048914 Ga0496111_0092497 Ga0496111_0092497_71_547 152
121 3300048915 Ga0496112_0001789 Ga0496112_0001789_3143_3619 152
122 3300048916 Ga0496113_0005868 Ga0496113_0005868_4983_5459 152
123 iso_pu_bacteria 2602042107 2603857304 153
124 iso_pu_bacteria 2857524615 2857526680 153
125 iso_pu_bacteria 2919073203 2919077812 153
126 iso_pu_bacteria 2508501128 2509146620 154
127 iso_pu_bacteria 2721755755 2723842806 154
128 iso_pu_bacteria 2893066018 2893069845 154
129 3300006175 Ga0070712_100681618 Ga0070712_1006816182 155
130 3300039450 Ga0436363_1496608 Ga0436363_1496608_1180_1647 155
131 3300048920 Ga0496117_0387053 Ga0496117_0387053_131_601 155
132 3300048921 Ga0496118_0090141 Ga0496118_0090141_1112_1582 155
133 3300048922 Ga0496119_0099687 Ga0496119_0099687_636_1106 155
134 iso_pu_bacteria 2874604998 2874606524 155
135 iso_pu_bacteria 2922361189 2922367291 155
136 iso_pu_bacteria 8006994254 8006998101 155
137 iso_pu_bacteria 8056673599 8056675124 155
138 3300005455 Ga0070663_100779159 Ga0070663_1007791591 156
139 3300005617 Ga0068859_100057352 Ga0068859_1000573522 156
140 3300006931 Ga0097620_100057352 Ga0097620_1000573522 156
141 3300009101 Ga0105247_10006919 Ga0105247_100069199 156
142 3300025295 Ga0209564_1000397 Ga0209564_100039718 156
143 3300025900 Ga0207710_10070725 Ga0207710_100707252 156
144 3300025914 Ga0207671_10586616 Ga0207671_105866161 156
145 3300026035 Ga0207703_10035937 Ga0207703_100359373 156
146 3300028653 Ga0265323_10000847 Ga0265323_100008474 156
147 3300028666 Ga0265336_10000460 Ga0265336_1000046010 156
148 3300028800 Ga0265338_10007843 Ga0265338_1000784310 156
149 3300041512 Ga0451853_2446561 Ga0451853_2446561_116_586 156
150 3300045976 Ga0466967_0556264 Ga0466967_0556264_412_882 156
151 3300048924 Ga0496121_0539509 Ga0496121_0539509_114_584 156
152 3300048928 Ga0496125_0175415 Ga0496125_0175415_413_883 156
153 3300053125 Ga0500618_007533 Ga0500618_007533_2432_2908 156
154 iso_pu_bacteria 2513237101 2513697947 156
155 iso_pu_bacteria 2513237141 2513887734 156
156 iso_pu_bacteria 2524023210 2524467522 156
157 iso_pu_bacteria 2889033259 2889033868 156
158 3300003659 JGI25404J52841_10018792 JGI25404J52841_100187921 157
159 3300005335 Ga0070666_10113509 Ga0070666_101135092 157
160 3300005336 Ga0070680_100151637 Ga0070680_1001516371 157
161 3300005336 Ga0070680_101699734 Ga0070680_1016997341 157
162 3300005338 Ga0068868_100101930 Ga0068868_1001019302 157
163 3300005340 Ga0070689_100825001 Ga0070689_1008250011 157
164 3300005344 Ga0070661_100107153 Ga0070661_1001071532 157
165 3300005347 Ga0070668_100093836 Ga0070668_1000938362 157
166 3300005355 Ga0070671_100281825 Ga0070671_1002818252 157
167 3300005366 Ga0070659_100129339 Ga0070659_1001293392 157
168 3300005366 Ga0070659_100216618 Ga0070659_1002166182 157
169 3300005367 Ga0070667_100083186 Ga0070667_1000831863 157
170 3300005440 Ga0070705_100525593 Ga0070705_1005255931 157
171 3300005444 Ga0070694_100867171 Ga0070694_1008671711 157
172 3300005456 Ga0070678_100334684 Ga0070678_1003346842 157
173 3300005530 Ga0070679_100099081 Ga0070679_1000990813 157
174 3300005530 Ga0070679_100184985 Ga0070679_1001849852 157
175 3300005539 Ga0068853_100091422 Ga0068853_1000914221 157
176 3300005548 Ga0070665_100255745 Ga0070665_1002557452 157
177 3300005563 Ga0068855_100110807 Ga0068855_1001108073 157
178 3300005563 Ga0068855_100187469 Ga0068855_1001874692 157
179 3300005564 Ga0070664_100098130 Ga0070664_1000981303 157
180 3300005614 Ga0068856_100182397 Ga0068856_1001823973 157
181 3300005615 Ga0070702_100060854 Ga0070702_1000608542 157
182 3300005616 Ga0068852_100655435 Ga0068852_1006554351 157
183 3300005718 Ga0068866_10503710 Ga0068866_105037102 157
184 3300005719 Ga0068861_100020959 Ga0068861_1000209595 157
185 3300005841 Ga0068863_100042307 Ga0068863_1000423073 157
186 3300005842 Ga0068858_100072672 Ga0068858_1000726722 157
187 3300005983 Ga0081540_1053672 Ga0081540_10536722 157
188 3300006051 Ga0075364_10860063 Ga0075364_108600631 157
189 3300006353 Ga0075370_10264025 Ga0075370_102640252 157
190 3300009098 Ga0105245_10058082 Ga0105245_100580822 157
191 3300009174 Ga0105241_10054562 Ga0105241_100545623 157
192 3300009553 Ga0105249_10595320 Ga0105249_105953202 157
193 3300010375 Ga0105239_10056734 Ga0105239_100567344 157
194 3300011119 Ga0105246_10030323 Ga0105246_100303232 157
195 3300013105 Ga0157369_10158875 Ga0157369_101588753 157
196 3300013105 Ga0157369_10802110 Ga0157369_108021102 157
197 3300025907 Ga0207645_10122652 Ga0207645_101226522 157
198 3300025911 Ga0207654_10075482 Ga0207654_100754821 157
199 3300025917 Ga0207660_10211996 Ga0207660_102119961 157
200 3300025921 Ga0207652_10120190 Ga0207652_101201903 157
201 3300025921 Ga0207652_10758183 Ga0207652_107581832 157
202 3300025923 Ga0207681_10195828 Ga0207681_101958282 157
203 3300025927 Ga0207687_10042859 Ga0207687_100428592 157
204 3300025931 Ga0207644_10073099 Ga0207644_100730993 157
205 3300025932 Ga0207690_10076892 Ga0207690_100768923 157
206 3300025933 Ga0207706_10581869 Ga0207706_105818691 157
207 3300025942 Ga0207689_10046118 Ga0207689_100461183 157
208 3300025945 Ga0207679_10168553 Ga0207679_101685531 157
209 3300025949 Ga0207667_10173858 Ga0207667_101738583 157
210 3300025949 Ga0207667_10203698 Ga0207667_102036981 157
211 3300025972 Ga0207668_10245353 Ga0207668_102453532 157
212 3300025986 Ga0207658_10084693 Ga0207658_100846932 157
213 3300026023 Ga0207677_10102129 Ga0207677_101021292 157
214 3300026035 Ga0207703_10413620 Ga0207703_104136202 157
215 3300026041 Ga0207639_10080572 Ga0207639_100805723 157
216 3300026078 Ga0207702_10051208 Ga0207702_100512082 157
217 3300026088 Ga0207641_10082654 Ga0207641_100826542 157
218 3300026089 Ga0207648_10064662 Ga0207648_100646622 157
219 3300026095 Ga0207676_10143282 Ga0207676_101432823 157
220 3300026116 Ga0207674_10207845 Ga0207674_102078453 157
221 3300026118 Ga0207675_100099894 Ga0207675_1000998942 157
222 3300026121 Ga0207683_10449844 Ga0207683_104498442 157
223 3300026142 Ga0207698_10429937 Ga0207698_104299372 157
224 3300026142 Ga0207698_10519180 Ga0207698_105191801 157
225 3300028379 Ga0268266_10059443 Ga0268266_100594433 157
226 3300031911 Ga0307412_10119924 Ga0307412_101199243 157
227 3300046557 Ga0495622_0128150 Ga0495622_0128150_77_553 157
228 3300046689 Ga0495613_0697923 Ga0495613_0697923_67_543 157
229 3300047317 Ga0495604_0106527 Ga0495604_0106527_783_1259 157
230 3300048907 Ga0496104_0258816 Ga0496104_0258816_927_1400 157
231 3300048912 Ga0496109_0534623 Ga0496109_0534623_368_841 157
232 3300048915 Ga0496112_0024667 Ga0496112_0024667_271_744 157
233 3300048915 Ga0496112_0353181 Ga0496112_0353181_870_1343 157
234 3300048916 Ga0496113_0251620 Ga0496113_0251620_58_531 157
235 3300048925 Ga0496122_0098738 Ga0496122_0098738_1222_1698 157
236 3300048928 Ga0496125_0000158 Ga0496125_0000158_100547_101023 157
237 3300048928 Ga0496125_0001221 Ga0496125_0001221_8550_9026 157
238 3300048929 Ga0496126_0008848 Ga0496126_0008848_4464_4940 157
239 3300048929 Ga0496126_0040463 Ga0496126_0040463_1808_2284 157
240 3300050491 nmdc:mga00v17_164221_c1 nmdc:mga00v17_164221_c1_127_600 157
241 3300050496 nmdc:mga07m45_319398_c1 nmdc:mga07m45_319398_c1_167_640 157
242 3300053093 Ga0500651_0037934 Ga0500651_0037934_1955_2431 157
243 3300053094 Ga0500566_0002015 Ga0500566_0002015_4663_5139 157
244 3300053102 Ga0500554_078792 Ga0500554_078792_206_682 157
245 3300053122 Ga0500608_017399 Ga0500608_017399_52_528 157
246 3300053125 Ga0500618_004224 Ga0500618_004224_1361_1837 157
247 3300053136 Ga0500559_0000288 Ga0500559_0000288_5883_6359 157
248 3300053142 Ga0500577_0029354 Ga0500577_0029354_57_533 157
249 3300053148 Ga0500590_021761 Ga0500590_021761_2549_3025 157
250 3300053177 Ga0500636_0010810 Ga0500636_0010810_365_841 157
251 3300053178 Ga0500637_0174779 Ga0500637_0174779_224_700 157
252 iso_pu_bacteria 2728368998 2728752430 157
253 3300005518 Ga0070699_101135331 Ga0070699_1011353311 158
254 3300005546 Ga0070696_101408141 Ga0070696_1014081411 158
255 3300005614 Ga0068856_100116648 Ga0068856_1001166482 158
256 3300005719 Ga0068861_101110147 Ga0068861_1011101471 158
257 3300005843 Ga0068860_100333005 Ga0068860_1003330052 158
258 3300006051 Ga0075364_10069634 Ga0075364_100696343 158
259 3300006178 Ga0075367_10847157 Ga0075367_108471571 158
260 3300006186 Ga0075369_10097985 Ga0075369_100979851 158
261 3300006358 Ga0068871_100261466 Ga0068871_1002614662 158
262 3300025906 Ga0207699_10678623 Ga0207699_106786231 158
263 3300028380 Ga0268265_10050565 Ga0268265_100505651 158
264 3300046491 Ga0495584_0119964 Ga0495584_0119964_735_1211 158
265 3300048905 Ga0496102_0183360 Ga0496102_0183360_1271_1747 158
266 3300048909 Ga0496106_1189453 Ga0496106_1189453_73_549 158
267 3300048924 Ga0496121_0102338 Ga0496121_0102338_1649_2125 158
268 3300048929 Ga0496126_1174004 Ga0496126_1174004_73_549 158
269 3300050516 nmdc:mga0sz30_189158_c1 nmdc:mga0sz30_189158_c1_374_850 158
270 3300005434 Ga0070709_10629021 Ga0070709_106290211 159
271 3300005455 Ga0070663_100251085 Ga0070663_1002510851 159
272 3300005539 Ga0068853_100006767 Ga0068853_10000676711 159
273 3300005563 Ga0068855_100112947 Ga0068855_1001129474 159
274 3300005577 Ga0068857_100044284 Ga0068857_1000442843 159
275 3300005578 Ga0068854_100008629 Ga0068854_1000086292 159
276 3300005578 Ga0068854_100451514 Ga0068854_1004515141 159
277 3300005614 Ga0068856_100054109 Ga0068856_1000541093 159
278 3300005616 Ga0068852_100011735 Ga0068852_1000117351 159
279 3300005834 Ga0068851_10017739 Ga0068851_100177392 159
280 3300006038 Ga0075365_10327183 Ga0075365_103271832 159
281 3300006038 Ga0075365_10795019 Ga0075365_107950192 159
282 3300006048 Ga0075363_100162596 Ga0075363_1001625962 159
283 3300006871 Ga0075434_100845158 Ga0075434_1008451581 159
284 3300025321 Ga0207656_10004387 Ga0207656_100043875 159
285 3300025906 Ga0207699_10800436 Ga0207699_108004361 159
286 3300025911 Ga0207654_10001136 Ga0207654_1000113611 159
287 3300025913 Ga0207695_10004577 Ga0207695_100045775 159
288 3300025924 Ga0207694_10000263 Ga0207694_1000026310 159
289 3300025949 Ga0207667_10042856 Ga0207667_100428563 159
290 3300025972 Ga0207668_11687935 Ga0207668_116879351 159
291 3300025981 Ga0207640_10175528 Ga0207640_101755282 159
292 3300026041 Ga0207639_10033069 Ga0207639_100330692 159
293 3300026067 Ga0207678_10091992 Ga0207678_100919921 159
294 3300026078 Ga0207702_10000003 Ga0207702_10000003213 159
295 3300026116 Ga0207674_10042085 Ga0207674_100420853 159
296 3300026142 Ga0207698_10003760 Ga0207698_100037606 159
297 3300031247 Ga0265340_10072641 Ga0265340_100726412 159
298 3300031250 Ga0265331_10244465 Ga0265331_102444651 159
299 3300031548 Ga0307408_100581111 Ga0307408_1005811112 159
300 3300031731 Ga0307405_10055884 Ga0307405_100558842 159
301 3300035111 Ga0373923_0014550 Ga0373923_0014550_1844_2323 159
302 3300035113 Ga0373936_0013008 Ga0373936_0013008_1767_2246 159
303 3300035116 Ga0373945_0014721 Ga0373945_0014721_46_525 159
304 3300035118 Ga0373954_0055775 Ga0373954_0055775_1138_1617 159
305 3300035120 Ga0373957_0007752 Ga0373957_0007752_547_1026 159
306 3300035170 Ga0373943_0046688 Ga0373943_0046688_1171_1650 159
307 3300035172 Ga0373955_0078419 Ga0373955_0078419_1357_1836 159
308 3300035172 Ga0373955_0309490 Ga0373955_0309490_256_735 159
309 3300035692 Ga0373935_0051350 Ga0373935_0051350_2067_2546 159
310 3300035692 Ga0373935_0278633 Ga0373935_0278633_571_1050 159
311 3300035695 Ga0373927_0046721 Ga0373927_0046721_1803_2282 159
312 3300035695 Ga0373927_0679097 Ga0373927_0679097_121_651 159
313 3300035725 Ga0373947_0006111 Ga0373947_0006111_2685_3164 159
314 3300036401 Ga0373937_0105606 Ga0373937_0105606_225_704 159
315 3300037068 Ga0373925_0020497 Ga0373925_0020497_726_1205 159
316 3300046454 Ga0495592_0136373 Ga0495592_0136373_530_1009 159
317 3300046459 Ga0495629_0560374 Ga0495629_0560374_128_607 159
318 3300046461 Ga0495641_0222896 Ga0495641_0222896_59_538 159
319 3300046472 Ga0495580_0034224 Ga0495580_0034224_2551_3030 159
320 3300046473 Ga0495582_0036609 Ga0495582_0036609_13_492 159
321 3300046475 Ga0495639_0066929 Ga0495639_0066929_1062_1541 159
322 3300046476 Ga0495662_0056597 Ga0495662_0056597_772_1251 159
323 3300046477 Ga0495664_0029722 Ga0495664_0029722_2533_3012 159
324 3300046511 Ga0495608_0467821 Ga0495608_0467821_125_655 159
325 3300046514 Ga0495618_0020926 Ga0495618_0020926_2279_2758 159
326 3300046516 Ga0495628_0886223 Ga0495628_0886223_52_531 159
327 3300046517 Ga0495630_0039230 Ga0495630_0039230_958_1437 159
328 3300046526 Ga0495666_0106963 Ga0495666_0106963_76_606 159
329 3300046531 Ga0495665_0026730 Ga0495665_0026730_808_1287 159
330 3300046543 Ga0495645_0046942 Ga0495645_0046942_124_654 159
331 3300046559 Ga0495667_0038450 Ga0495667_0038450_137_616 159
332 3300046642 Ga0495634_0036766 Ga0495634_0036766_2017_2496 159
333 3300046683 Ga0495658_0021799 Ga0495658_0021799_480_959 159
334 3300046690 Ga0495624_0079643 Ga0495624_0079643_814_1293 159
335 3300047319 Ga0495674_0014414 Ga0495674_0014414_6837_7316 159
336 3300047445 Ga0495677_0234835 Ga0495677_0234835_40_519 159
337 3300047471 Ga0495684_0002699 Ga0495684_0002699_11776_12255 159
338 3300047673 Ga0495593_0011625 Ga0495593_0011625_3854_4333 159
339 3300048904 Ga0496101_0090423 Ga0496101_0090423_148_660 159
340 3300048907 Ga0496104_0650923 Ga0496104_0650923_58_570 159
341 3300048913 Ga0496110_0432748 Ga0496110_0432748_114_608 159
342 3300048915 Ga0496112_0028860 Ga0496112_0028860_2583_3095 159
343 3300048916 Ga0496113_0722137 Ga0496113_0722137_85_597 159
344 3300048918 Ga0496115_0428720 Ga0496115_0428720_389_871 159
345 3300048929 Ga0496126_0870643 Ga0496126_0870643_172_651 159
346 3300050490 nmdc:mga03n38_424572_c1 nmdc:mga03n38_424572_c1_187_666 159
347 3300050492 nmdc:mga0yw44_235804_c1 nmdc:mga0yw44_235804_c1_403_882 159
348 3300050492 nmdc:mga0yw44_654961_c1 nmdc:mga0yw44_654961_c1_111_590 159
349 3300050494 nmdc:mga06z11_601556_c1 nmdc:mga06z11_601556_c1_68_547 159
350 3300050512 nmdc:mga0n895_837372_c1 nmdc:mga0n895_837372_c1_301_813 159
351 3300053077 Ga0495601_0047533 Ga0495601_0047533_403_882 159
352 3300053078 Ga0495612_0043952 Ga0495612_0043952_176_655 159
353 3300053094 Ga0500566_0023225 Ga0500566_0023225_2165_2644 159
354 3300053119 Ga0500595_000842 Ga0500595_000842_7014_7493 159
355 3300053123 Ga0500614_125702 Ga0500614_125702_20_499 159
356 3300053162 Ga0500638_010417 Ga0500638_010417_1880_2359 159
357 3300053178 Ga0500637_0000251 Ga0500637_0000251_7038_7517 159
358 3300055283 Ga0500661_004969 Ga0500661_004969_182_661 159
359 3300005330 Ga0070690_100362053 Ga0070690_1003620532 160
360 3300005336 Ga0070680_101429010 Ga0070680_1014290101 160
361 3300005347 Ga0070668_100765446 Ga0070668_1007654461 160
362 3300005353 Ga0070669_100077905 Ga0070669_1000779052 160
363 3300005356 Ga0070674_100297958 Ga0070674_1002979582 160
364 3300005364 Ga0070673_100195432 Ga0070673_1001954322 160
365 3300005364 Ga0070673_101220536 Ga0070673_1012205361 160
366 3300005365 Ga0070688_100379400 Ga0070688_1003794002 160
367 3300005367 Ga0070667_100237719 Ga0070667_1002377191 160
368 3300005434 Ga0070709_10002338 Ga0070709_100023385 160
369 3300005435 Ga0070714_100066550 Ga0070714_1000665501 160
370 3300005436 Ga0070713_100397034 Ga0070713_1003970343 160
371 3300005437 Ga0070710_10005939 Ga0070710_100059394 160
372 3300005439 Ga0070711_100051142 Ga0070711_1000511422 160
373 3300005455 Ga0070663_100303529 Ga0070663_1003035292 160
374 3300005456 Ga0070678_100238015 Ga0070678_1002380151 160
375 3300005466 Ga0070685_10278521 Ga0070685_102785212 160
376 3300005539 Ga0068853_100272578 Ga0068853_1002725781 160
377 3300005544 Ga0070686_100147014 Ga0070686_1001470142 160
378 3300005548 Ga0070665_100151870 Ga0070665_1001518702 160
379 3300005615 Ga0070702_100983130 Ga0070702_1009831301 160
380 3300005616 Ga0068852_100152915 Ga0068852_1001529152 160
381 3300005719 Ga0068861_100051542 Ga0068861_1000515422 160
382 3300005843 Ga0068860_100821145 Ga0068860_1008211452 160
383 3300006028 Ga0070717_10022827 Ga0070717_100228271 160
384 3300006163 Ga0070715_10000762 Ga0070715_100007626 160
385 3300006173 Ga0070716_100038130 Ga0070716_1000381302 160
386 3300006175 Ga0070712_100306226 Ga0070712_1003062261 160
387 3300009148 Ga0105243_10074303 Ga0105243_100743032 160
388 3300009553 Ga0105249_10022931 Ga0105249_100229313 160
389 3300013105 Ga0157369_10044612 Ga0157369_100446125 160
390 3300014326 Ga0157380_11474009 Ga0157380_114740091 160
391 3300017792 Ga0163161_10200638 Ga0163161_102006382 160
392 3300020081 Ga0206354_11284064 Ga0206354_112840641 160
393 3300022467 Ga0224712_10087246 Ga0224712_100872461 160
394 3300025898 Ga0207692_10019957 Ga0207692_100199572 160
395 3300025899 Ga0207642_10146538 Ga0207642_101465382 160
396 3300025901 Ga0207688_10560341 Ga0207688_105603411 160
397 3300025903 Ga0207680_10081903 Ga0207680_100819032 160
398 3300025904 Ga0207647_10055549 Ga0207647_100555493 160
399 3300025906 Ga0207699_10003036 Ga0207699_100030364 160
400 3300025915 Ga0207693_10060842 Ga0207693_100608422 160
401 3300025916 Ga0207663_10000239 Ga0207663_1000023920 160
402 3300025917 Ga0207660_10676250 Ga0207660_106762501 160
403 3300025928 Ga0207700_10005825 Ga0207700_100058252 160
404 3300025929 Ga0207664_10010462 Ga0207664_100104622 160
405 3300025933 Ga0207706_10154767 Ga0207706_101547672 160
406 3300025935 Ga0207709_10537243 Ga0207709_105372432 160
407 3300025939 Ga0207665_10016227 Ga0207665_100162275 160
408 3300025940 Ga0207691_10041060 Ga0207691_100410604 160
409 3300025961 Ga0207712_10210246 Ga0207712_102102461 160
410 3300025972 Ga0207668_10241608 Ga0207668_102416082 160
411 3300025972 Ga0207668_11194760 Ga0207668_111947601 160
412 3300025986 Ga0207658_10345018 Ga0207658_103450181 160
413 3300026041 Ga0207639_10091060 Ga0207639_100910603 160
414 3300026067 Ga0207678_10028150 Ga0207678_100281502 160
415 3300026118 Ga0207675_100123214 Ga0207675_1001232142 160
416 3300026121 Ga0207683_10021485 Ga0207683_100214855 160
417 3300028379 Ga0268266_10194248 Ga0268266_101942483 160
418 3300028380 Ga0268265_10219823 Ga0268265_102198233 160
419 3300028381 Ga0268264_10910392 Ga0268264_109103921 160
420 3300030522 Ga0307512_10395848 Ga0307512_103958481 160
421 3300031730 Ga0307516_10574527 Ga0307516_105745271 160
422 3300035088 Ga0373940_0256389 Ga0373940_0256389_73_555 160
423 3300044694 Ga0466963_0113153 Ga0466963_0113153_976_1458 160
424 3300046523 Ga0495644_0166884 Ga0495644_0166884_315_797 160
425 3300046538 Ga0495609_0152324 Ga0495609_0152324_207_734 160
426 3300046557 Ga0495622_0242485 Ga0495622_0242485_248_775 160
427 3300046615 Ga0495656_0259273 Ga0495656_0259273_184_666 160
428 3300046616 Ga0495668_0295274 Ga0495668_0295274_358_840 160
429 3300046648 Ga0495611_0211119 Ga0495611_0211119_249_731 160
430 3300046674 Ga0495588_0034937 Ga0495588_0034937_1521_2048 160
431 3300046684 Ga0495669_0005476 Ga0495669_0005476_3973_4455 160
432 3300046691 Ga0495670_0330455 Ga0495670_0330455_44_571 160
433 3300048904 Ga0496101_0692758 Ga0496101_0692758_116_598 160
434 3300048906 Ga0496103_0748045 Ga0496103_0748045_77_559 160
435 3300048910 Ga0496107_0195274 Ga0496107_0195274_254_736 160
436 3300048913 Ga0496110_0574511 Ga0496110_0574511_370_852 160
437 3300048918 Ga0496115_0629897 Ga0496115_0629897_214_696 160
438 3300048929 Ga0496126_0473306 Ga0496126_0473306_399_881 160
439 3300049578 Ga0501042_0850839 Ga0501042_0850839_121_603 160
440 3300049592 Ga0501076_0422936 Ga0501076_0422936_466_948 160
441 3300049742 Ga0501080_0483392 Ga0501080_0483392_273_755 160
442 3300049824 Ga0501045_0231447 Ga0501045_0231447_270_752 160
443 3300053177 Ga0500636_0113825 Ga0500636_0113825_942_1424 160
444 3300060353 Ga0501082_0353746 Ga0501082_0353746_715_1197 160
445 3300000549 LJQas_1008496 LJQas_10084961 161
446 3300005293 Ga0065715_10833558 Ga0065715_108335581 161
447 3300005329 Ga0070683_101029509 Ga0070683_1010295091 161
448 3300005336 Ga0070680_100013024 Ga0070680_1000130245 161
449 3300005336 Ga0070680_100610041 Ga0070680_1006100411 161
450 3300005337 Ga0070682_100577607 Ga0070682_1005776072 161
451 3300005339 Ga0070660_100006991 Ga0070660_1000069913 161
452 3300005341 Ga0070691_10049020 Ga0070691_100490201 161
453 3300005344 Ga0070661_100039476 Ga0070661_1000394763 161
454 3300005345 Ga0070692_10829176 Ga0070692_108291761 161
455 3300005355 Ga0070671_100116477 Ga0070671_1001164772 161
456 3300005356 Ga0070674_101133613 Ga0070674_1011336131 161
457 3300005437 Ga0070710_10109550 Ga0070710_101095503 161
458 3300005439 Ga0070711_100002208 Ga0070711_1000022089 161
459 3300005445 Ga0070708_100514024 Ga0070708_1005140242 161
460 3300005456 Ga0070678_100573215 Ga0070678_1005732151 161
461 3300005471 Ga0070698_100492898 Ga0070698_1004928982 161
462 3300005530 Ga0070679_100148109 Ga0070679_1001481093 161
463 3300005530 Ga0070679_100210094 Ga0070679_1002100943 161
464 3300005539 Ga0068853_100002207 Ga0068853_10000220712 161
465 3300005545 Ga0070695_101488598 Ga0070695_1014885981 161
466 3300005546 Ga0070696_101319510 Ga0070696_1013195101 161
467 3300005563 Ga0068855_100386088 Ga0068855_1003860882 161
468 3300005616 Ga0068852_100212069 Ga0068852_1002120692 161
469 3300005616 Ga0068852_100225372 Ga0068852_1002253722 161
470 3300006028 Ga0070717_10223200 Ga0070717_102232002 161
471 3300006173 Ga0070716_100190831 Ga0070716_1001908312 161
472 3300006173 Ga0070716_100595356 Ga0070716_1005953561 161
473 3300006175 Ga0070712_100033040 Ga0070712_1000330402 161
474 3300006237 Ga0097621_100130302 Ga0097621_1001303022 161
475 3300006881 Ga0068865_101184368 Ga0068865_1011843681 161
476 3300007265 Ga0099794_10039886 Ga0099794_100398862 161
477 3300009093 Ga0105240_10012128 Ga0105240_100121289 161
478 3300009148 Ga0105243_11067632 Ga0105243_110676321 161
479 3300009176 Ga0105242_10252974 Ga0105242_102529742 161
480 3300009545 Ga0105237_10078243 Ga0105237_100782432 161
481 3300009545 Ga0105237_10179551 Ga0105237_101795512 161
482 3300009551 Ga0105238_10040525 Ga0105238_100405252 161
483 3300009551 Ga0105238_11659595 Ga0105238_116595951 161
484 3300010375 Ga0105239_10064895 Ga0105239_100648953 161
485 3300013104 Ga0157370_10109082 Ga0157370_101090822 161
486 3300013105 Ga0157369_10006388 Ga0157369_1000638812 161
487 3300013297 Ga0157378_10328789 Ga0157378_103287892 161
488 3300013307 Ga0157372_10149159 Ga0157372_101491592 161
489 3300013308 Ga0157375_10045330 Ga0157375_100453303 161
490 3300014326 Ga0157380_10101682 Ga0157380_101016822 161
491 3300014969 Ga0157376_10858234 Ga0157376_108582341 161
492 3300017792 Ga0163161_10316643 Ga0163161_103166431 161
493 3300025261 Ga0209233_1036920 Ga0209233_10369201 161
494 3300025898 Ga0207692_10083953 Ga0207692_100839532 161
495 3300025899 Ga0207642_10260852 Ga0207642_102608522 161
496 3300025906 Ga0207699_10046371 Ga0207699_100463712 161
497 3300025912 Ga0207707_10002224 Ga0207707_1000222412 161
498 3300025913 Ga0207695_10879181 Ga0207695_108791811 161
499 3300025914 Ga0207671_10250349 Ga0207671_102503492 161
500 3300025915 Ga0207693_10110049 Ga0207693_101100491 161
501 3300025915 Ga0207693_10114738 Ga0207693_101147383 161
502 3300025915 Ga0207693_10132194 Ga0207693_101321942 161
503 3300025916 Ga0207663_10193366 Ga0207663_101933661 161
504 3300025917 Ga0207660_10022785 Ga0207660_100227852 161
505 3300025919 Ga0207657_10005246 Ga0207657_100052463 161
506 3300025921 Ga0207652_10004348 Ga0207652_100043483 161
507 3300025921 Ga0207652_10129972 Ga0207652_101299723 161
508 3300025924 Ga0207694_11232027 Ga0207694_112320271 161
509 3300025928 Ga0207700_10231565 Ga0207700_102315652 161
510 3300025929 Ga0207664_10560936 Ga0207664_105609362 161
511 3300025931 Ga0207644_10532583 Ga0207644_105325831 161
512 3300025931 Ga0207644_10642325 Ga0207644_106423251 161
513 3300025935 Ga0207709_10710385 Ga0207709_107103851 161
514 3300025937 Ga0207669_10221830 Ga0207669_102218302 161
515 3300025938 Ga0207704_10605344 Ga0207704_106053441 161
516 3300025939 Ga0207665_10191928 Ga0207665_101919283 161
517 3300025939 Ga0207665_10648429 Ga0207665_106484291 161
518 3300025939 Ga0207665_10808577 Ga0207665_108085771 161
519 3300025944 Ga0207661_10054826 Ga0207661_100548263 161
520 3300025972 Ga0207668_10632743 Ga0207668_106327431 161
521 3300026023 Ga0207677_11171544 Ga0207677_111715441 161
522 3300026035 Ga0207703_10256676 Ga0207703_102566762 161
523 3300026041 Ga0207639_10173933 Ga0207639_101739331 161
524 3300026067 Ga0207678_10054613 Ga0207678_100546132 161
525 3300026088 Ga0207641_11511426 Ga0207641_115114261 161
526 3300026121 Ga0207683_10338347 Ga0207683_103383472 161
527 3300026142 Ga0207698_10020150 Ga0207698_100201503 161
528 3300026142 Ga0207698_10235550 Ga0207698_102355502 161
529 3300027671 Ga0209588_1005209 Ga0209588_10052093 161
530 3300028573 Ga0265334_10054880 Ga0265334_100548802 161
531 3300031238 Ga0265332_10059337 Ga0265332_100593372 161
532 3300031249 Ga0265339_10005327 Ga0265339_100053275 161
533 3300031249 Ga0265339_10128751 Ga0265339_101287512 161
534 3300031250 Ga0265331_10246596 Ga0265331_102465961 161
535 3300031344 Ga0265316_10318944 Ga0265316_103189441 161
536 3300031730 Ga0307516_10014441 Ga0307516_1001444111 161
537 3300034957 Ga0373938_0006155 Ga0373938_0006155_480_1022 161
538 3300035088 Ga0373940_0121661 Ga0373940_0121661_214_756 161
539 3300035112 Ga0373932_0210730 Ga0373932_0210730_112_654 161
540 3300035121 Ga0373960_0124614 Ga0373960_0124614_153_695 161
541 3300035170 Ga0373943_0040038 Ga0373943_0040038_1729_2214 161
542 3300035171 Ga0373946_0042460 Ga0373946_0042460_1072_1557 161
543 3300035242 Ga0373962_0194317 Ga0373962_0194317_87_629 161
544 3300035691 Ga0373931_0002919 Ga0373931_0002919_232_774 161
545 3300035695 Ga0373927_0002293 Ga0373927_0002293_5576_6061 161
546 3300035695 Ga0373927_0271406 Ga0373927_0271406_476_1018 161
547 3300035725 Ga0373947_0106522 Ga0373947_0106522_152_637 161
548 3300037068 Ga0373925_0048125 Ga0373925_0048125_953_1438 161
549 3300037068 Ga0373925_0646131 Ga0373925_0646131_95_580 161
550 3300037068 Ga0373925_1139995 Ga0373925_1139995_17_502 161
551 3300037471 Ga0395905_0127901 Ga0395905_0127901_1434_1919 161
552 3300045976 Ga0466967_0046134 Ga0466967_0046134_3229_3714 161
553 3300046455 Ga0495603_0003213 Ga0495603_0003213_4713_5198 161
554 3300046472 Ga0495580_0026362 Ga0495580_0026362_1639_2124 161
555 3300046476 Ga0495662_0288997 Ga0495662_0288997_57_587 161
556 3300046477 Ga0495664_0132249 Ga0495664_0132249_1003_1488 161
557 3300046499 Ga0495594_0077975 Ga0495594_0077975_1331_1816 161
558 3300046543 Ga0495645_0109425 Ga0495645_0109425_149_634 161
559 3300046615 Ga0495656_0099871 Ga0495656_0099871_174_659 161
560 3300046674 Ga0495588_0145361 Ga0495588_0145361_594_1079 161
561 3300046678 Ga0495599_0180496 Ga0495599_0180496_544_1029 161
562 3300046683 Ga0495658_0199371 Ga0495658_0199371_636_1121 161
563 3300046684 Ga0495669_0454636 Ga0495669_0454636_82_567 161
564 3300046689 Ga0495613_0396526 Ga0495613_0396526_430_915 161
565 3300048903 Ga0496100_0844703 Ga0496100_0844703_102_644 161
566 3300048905 Ga0496102_0067840 Ga0496102_0067840_585_1127 161
567 3300048906 Ga0496103_0064217 Ga0496103_0064217_400_942 161
568 3300048907 Ga0496104_0020638 Ga0496104_0020638_3431_3973 161
569 3300048908 Ga0496105_0027529 Ga0496105_0027529_3489_4031 161
570 3300048909 Ga0496106_0046679 Ga0496106_0046679_1082_1624 161
571 3300048910 Ga0496107_0022390 Ga0496107_0022390_1615_2157 161
572 3300048911 Ga0496108_0117890 Ga0496108_0117890_1314_1856 161
573 3300048911 Ga0496108_0136620 Ga0496108_0136620_423_908 161
574 3300048912 Ga0496109_0275164 Ga0496109_0275164_973_1515 161
575 3300048914 Ga0496111_0078867 Ga0496111_0078867_78_620 161
576 3300048914 Ga0496111_0799896 Ga0496111_0799896_114_599 161
577 3300048915 Ga0496112_0127489 Ga0496112_0127489_1938_2480 161
578 3300048917 Ga0496114_0091581 Ga0496114_0091581_1875_2417 161
579 3300048918 Ga0496115_0123983 Ga0496115_0123983_1323_1865 161
580 3300048918 Ga0496115_0396721 Ga0496115_0396721_173_658 161
581 3300048925 Ga0496122_0103679 Ga0496122_0103679_264_749 161
582 3300048929 Ga0496126_0007041 Ga0496126_0007041_10441_10926 161
583 3300048929 Ga0496126_0565909 Ga0496126_0565909_380_865 161
584 3300048929 Ga0496126_0631730 Ga0496126_0631730_269_754 161
585 3300053077 Ga0495601_0427557 Ga0495601_0427557_291_776 161
586 3300053078 Ga0495612_0167296 Ga0495612_0167296_253_738 161
587 3300053084 Ga0495595_0077423 Ga0495595_0077423_446_931 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06186

DUF992

Protein of unknown function (DUF992)

35

177

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ta7-assembly1.cif.gz_E-2 crystal structure of human g3bp1-ntf2 in complex with human caprin1-derived solomon motif 0.7414 36 77
4fcm-assembly1.cif.gz_B crystal structure of the ntf2-like domain of human g3bp1 in complex with a peptide 0.741 36 75
8th1-assembly1.cif.gz_A crystal structure of the g3bp1 ntf2-like domain bound to the idr1 of sars-cov-2 nucleocapsid protein d3l mutant 0.737 36 75
6ta7-assembly3.cif.gz_C crystal structure of human g3bp1-ntf2 in complex with human caprin1-derived solomon motif 0.7368 36 75
6ta7-assembly3.cif.gz_D crystal structure of human g3bp1-ntf2 in complex with human caprin1-derived solomon motif 0.7355 36 77
ID Description Score Start End Superfamily
5ig0A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8074 35 75 3.10.450.50
af_Q9VRD6_2_130_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.754 35 77 3.10.450.50
5fw5A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7497 38 75 3.10.450.50
1of5B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7349 35 75 3.10.450.50
af_A0A5S9MQL1_1_179_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7271 36 78 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A6F8ND94-F1-model_v4 deleted 0.9056 31 161
AF-A0A6F8ND94-F1-model_v4 deleted 0.8991 31 161
AF-A0A0S6UFL0-F1-model_v4 DUF992 domain-containing protein 0.8647 22 161
AF-A0A0D7F5S6-F1-model_v4 DUF992 domain-containing protein 0.8644 22 161
AF-A0A1V4I1A6-F1-model_v4 DUF992 domain-containing protein 0.8481 20 161

Feature Viewer

pLDDT pTM Quality
69.03 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map