F466635
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 587 | 347 | 572 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100116477|Ga0070671_1001164772 |
| Length | 180 |
| Sequence | MAPRLIVYLHHSFRFGDFFMPRFLILASAVIAMLATSVAGTSAQSSMTRVQVGILECRGGASVGFIVGSVTNLGCVLRAEGMPEDRYIATIRKVGLDLGITAESALAWGVYAPVARLGPGDLAGDYAGAQGSATLGVGVGGNVLVGGSANSIALQPLSVQGQVGVSVAAGLESLELRPGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 3 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 4 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 5 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 6 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 7 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 8 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 9 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 10 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 11 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 12 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 13 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 14 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 15 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 172 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 176 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 178 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 181 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 182 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 183 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 184 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 187 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 191 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 194 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 199 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 205 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 206 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 210 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 211 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 212 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 213 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 282 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 283 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 284 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 285 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 286 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 287 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 288 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 289 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 290 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 291 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 292 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 293 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 294 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 295 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 300 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 301 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 303 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 304 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 305 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 313 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 314 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 315 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 316 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 317 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 318 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 319 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 320 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 321 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 322 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 323 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 324 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 325 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 326 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 327 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 328 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 329 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 330 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 331 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 332 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 333 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 334 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 335 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 336 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 337 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 338 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 339 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 340 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 341 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 342 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 343 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 344 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 345 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 347 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.76 |
| Metatranscriptomes | 0.68 |
| Isolates | 2.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.44 |
| Nodule | 1.7 |
| Rhizoplane | 7.84 |
| Rhizosphere | 69.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1008496 | 3300000549 | Bacteria | 1248 |
| 2 | JGI25404J52841_10018792 | 3300003659 | Bacteria | 1498 |
| 3 | Ga0065165_1023758 | 3300005262 | Bacteria | 2072 |
| 4 | Ga0065715_10833558 | 3300005293 | Bacteria | 598 |
| 5 | Ga0070683_101029509 | 3300005329 | Bacteria | 791 |
| 6 | Ga0070690_100362053 | 3300005330 | Bacteria | 1056 |
| 7 | Ga0070666_10113509 | 3300005335 | Bacteria | 1875 |
| 8 | Ga0070680_100013024 | 3300005336 | Bacteria | 6472 |
| 9 | Ga0070680_100101388 | 3300005336 | Bacteria | 2390 |
| 10 | Ga0070680_100151637 | 3300005336 | Bacteria | 1946 |
| 11 | Ga0070680_100253650 | 3300005336 | Bacteria | 1488 |
| 12 | Ga0070680_100610041 | 3300005336 | Bacteria | 937 |
| 13 | Ga0070680_101429010 | 3300005336 | Bacteria | 599 |
| 14 | Ga0070680_101699734 | 3300005336 | Bacteria | 547 |
| 15 | Ga0070682_100031969 | 3300005337 | Bacteria | 3187 |
| 16 | Ga0070682_100577607 | 3300005337 | Bacteria | 884 |
| 17 | Ga0068868_100101930 | 3300005338 | Bacteria | 2323 |
| 18 | Ga0070660_100006991 | 3300005339 | Bacteria | 7831 |
| 19 | Ga0070689_100825001 | 3300005340 | Bacteria | 817 |
| 20 | Ga0070691_10049020 | 3300005341 | Bacteria | 2011 |
| 21 | Ga0070691_10560839 | 3300005341 | Bacteria | 669 |
| 22 | Ga0070661_100039476 | 3300005344 | Bacteria | 3439 |
| 23 | Ga0070661_100107153 | 3300005344 | Bacteria | 2084 |
| 24 | Ga0070692_10829176 | 3300005345 | Bacteria | 634 |
| 25 | Ga0070668_100093836 | 3300005347 | Bacteria | 2369 |
| 26 | Ga0070668_100765446 | 3300005347 | Bacteria | 856 |
| 27 | Ga0070669_100077905 | 3300005353 | Bacteria | 2463 |
| 28 | Ga0070671_100116477 | 3300005355 | Bacteria | 2247 |
| 29 | Ga0070671_100281825 | 3300005355 | Bacteria | 1414 |
| 30 | Ga0070674_100297958 | 3300005356 | Bacteria | 1284 |
| 31 | Ga0070674_101133613 | 3300005356 | Bacteria | 692 |
| 32 | Ga0070673_100195432 | 3300005364 | Bacteria | 1740 |
| 33 | Ga0070673_101220536 | 3300005364 | Bacteria | 705 |
| 34 | Ga0070688_100379400 | 3300005365 | Bacteria | 1042 |
| 35 | Ga0070659_100129339 | 3300005366 | Bacteria | 2050 |
| 36 | Ga0070659_100216618 | 3300005366 | Bacteria | 1579 |
| 37 | Ga0070667_100083186 | 3300005367 | Bacteria | 2741 |
| 38 | Ga0070667_100237719 | 3300005367 | Bacteria | 1626 |
| 39 | Ga0070709_10002338 | 3300005434 | Bacteria | 10273 |
| 40 | Ga0070709_10629021 | 3300005434 | Bacteria | 829 |
| 41 | Ga0070709_11163347 | 3300005434 | Bacteria | 619 |
| 42 | Ga0070714_100066550 | 3300005435 | Bacteria | 3105 |
| 43 | Ga0070713_100397034 | 3300005436 | Bacteria | 1287 |
| 44 | Ga0070710_10005939 | 3300005437 | Bacteria | 5829 |
| 45 | Ga0070710_10109550 | 3300005437 | Bacteria | 1657 |
| 46 | Ga0070711_100002208 | 3300005439 | Bacteria | 11048 |
| 47 | Ga0070711_100051142 | 3300005439 | Bacteria | 2836 |
| 48 | Ga0070705_100525593 | 3300005440 | Bacteria | 903 |
| 49 | Ga0070694_100867171 | 3300005444 | Bacteria | 744 |
| 50 | Ga0070708_100514024 | 3300005445 | Bacteria | 1130 |
| 51 | Ga0070663_100251085 | 3300005455 | Bacteria | 1400 |
| 52 | Ga0070663_100303529 | 3300005455 | Bacteria | 1279 |
| 53 | Ga0070663_100779159 | 3300005455 | Bacteria | 819 |
| 54 | Ga0070678_100238015 | 3300005456 | Bacteria | 1521 |
| 55 | Ga0070678_100334684 | 3300005456 | Bacteria | 1297 |
| 56 | Ga0070678_100573215 | 3300005456 | Bacteria | 1005 |
| 57 | Ga0070681_10057197 | 3300005458 | Bacteria | 3880 |
| 58 | Ga0070685_10278521 | 3300005466 | Bacteria | 1119 |
| 59 | Ga0070698_100492898 | 3300005471 | Bacteria | 1163 |
| 60 | Ga0070699_101135331 | 3300005518 | Bacteria | 717 |
| 61 | Ga0070679_100083419 | 3300005530 | Bacteria | 3184 |
| 62 | Ga0070679_100099081 | 3300005530 | Bacteria | 2902 |
| 63 | Ga0070679_100148109 | 3300005530 | Bacteria | 2325 |
| 64 | Ga0070679_100184985 | 3300005530 | Bacteria | 2055 |
| 65 | Ga0070679_100210094 | 3300005530 | Bacteria | 1910 |
| 66 | Ga0068853_100002207 | 3300005539 | Bacteria | 14542 |
| 67 | Ga0068853_100006767 | 3300005539 | Bacteria | 9133 |
| 68 | Ga0068853_100091422 | 3300005539 | Bacteria | 2676 |
| 69 | Ga0068853_100272578 | 3300005539 | Bacteria | 1559 |
| 70 | Ga0068853_100978694 | 3300005539 | Bacteria | 814 |
| 71 | Ga0070686_100147014 | 3300005544 | Bacteria | 1646 |
| 72 | Ga0070695_100487240 | 3300005545 | Bacteria | 951 |
| 73 | Ga0070695_101488598 | 3300005545 | Bacteria | 563 |
| 74 | Ga0070696_101245527 | 3300005546 | Bacteria | 630 |
| 75 | Ga0070696_101319510 | 3300005546 | Bacteria | 613 |
| 76 | Ga0070696_101408141 | 3300005546 | Bacteria | 595 |
| 77 | Ga0070693_100068028 | 3300005547 | Bacteria | 2090 |
| 78 | Ga0070665_100151870 | 3300005548 | Bacteria | 2319 |
| 79 | Ga0070665_100255745 | 3300005548 | Bacteria | 1752 |
| 80 | Ga0070665_100356008 | 3300005548 | Bacteria | 1469 |
| 81 | Ga0068855_100110807 | 3300005563 | Bacteria | 3150 |
| 82 | Ga0068855_100112947 | 3300005563 | Bacteria | 3117 |
| 83 | Ga0068855_100187469 | 3300005563 | Bacteria | 2336 |
| 84 | Ga0068855_100386088 | 3300005563 | Bacteria | 1537 |
| 85 | Ga0068855_101139469 | 3300005563 | Bacteria | 814 |
| 86 | Ga0070664_100098130 | 3300005564 | Bacteria | 2545 |
| 87 | Ga0068857_100044284 | 3300005577 | Bacteria | 3947 |
| 88 | Ga0068854_100008629 | 3300005578 | Bacteria | 6559 |
| 89 | Ga0068854_100451514 | 3300005578 | Bacteria | 1074 |
| 90 | Ga0068856_100054109 | 3300005614 | Bacteria | 3958 |
| 91 | Ga0068856_100116648 | 3300005614 | Bacteria | 2670 |
| 92 | Ga0068856_100182397 | 3300005614 | Bacteria | 2113 |
| 93 | Ga0070702_100060854 | 3300005615 | Bacteria | 2197 |
| 94 | Ga0070702_100983130 | 3300005615 | Bacteria | 667 |
| 95 | Ga0068852_100011735 | 3300005616 | Bacteria | 6614 |
| 96 | Ga0068852_100152915 | 3300005616 | Bacteria | 2147 |
| 97 | Ga0068852_100212069 | 3300005616 | Bacteria | 1838 |
| 98 | Ga0068852_100225372 | 3300005616 | Bacteria | 1784 |
| 99 | Ga0068852_100655435 | 3300005616 | Bacteria | 1058 |
| 100 | Ga0068859_100057352 | 3300005617 | Bacteria | 3923 |
| 101 | Ga0068866_10503710 | 3300005718 | Bacteria | 802 |
| 102 | Ga0068861_100020959 | 3300005719 | Bacteria | 4691 |
| 103 | Ga0068861_100051542 | 3300005719 | Bacteria | 3124 |
| 104 | Ga0068861_101110147 | 3300005719 | Bacteria | 760 |
| 105 | Ga0068851_10017739 | 3300005834 | Bacteria | 3423 |
| 106 | Ga0068863_100042307 | 3300005841 | Bacteria | 4329 |
| 107 | Ga0068858_100072672 | 3300005842 | Bacteria | 3191 |
| 108 | Ga0068860_100333005 | 3300005843 | Bacteria | 1491 |
| 109 | Ga0068860_100821145 | 3300005843 | Bacteria | 943 |
| 110 | Ga0081540_1053672 | 3300005983 | Bacteria | 1975 |
| 111 | Ga0070717_10022827 | 3300006028 | Bacteria | 4950 |
| 112 | Ga0070717_10223200 | 3300006028 | Bacteria | 1657 |
| 113 | Ga0075365_10020835 | 3300006038 | Bacteria | 4074 |
| 114 | Ga0075365_10327183 | 3300006038 | Bacteria | 1079 |
| 115 | Ga0075365_10795019 | 3300006038 | Bacteria | 668 |
| 116 | Ga0075368_10325398 | 3300006042 | Bacteria | 666 |
| 117 | Ga0075363_100162596 | 3300006048 | Bacteria | 1265 |
| 118 | Ga0075364_10069634 | 3300006051 | Bacteria | 2315 |
| 119 | Ga0075364_10075732 | 3300006051 | Bacteria | 2220 |
| 120 | Ga0075364_10860063 | 3300006051 | Bacteria | 617 |
| 121 | Ga0070715_10000762 | 3300006163 | Bacteria | 8717 |
| 122 | Ga0070716_100038130 | 3300006173 | Bacteria | 2659 |
| 123 | Ga0070716_100169405 | 3300006173 | Bacteria | 1424 |
| 124 | Ga0070716_100190831 | 3300006173 | Bacteria | 1354 |
| 125 | Ga0070716_100595356 | 3300006173 | Bacteria | 831 |
| 126 | Ga0070712_100033040 | 3300006175 | Bacteria | 3497 |
| 127 | Ga0070712_100306226 | 3300006175 | Bacteria | 1287 |
| 128 | Ga0070712_100681618 | 3300006175 | Bacteria | 875 |
| 129 | Ga0075367_10081962 | 3300006178 | Bacteria | 1953 |
| 130 | Ga0075367_10847157 | 3300006178 | Bacteria | 583 |
| 131 | Ga0075369_10006028 | 3300006186 | Bacteria | 4565 |
| 132 | Ga0075369_10097985 | 3300006186 | Bacteria | 1313 |
| 133 | Ga0075366_10038074 | 3300006195 | Bacteria | 2840 |
| 134 | Ga0097621_100130302 | 3300006237 | Bacteria | 2140 |
| 135 | Ga0075370_10196716 | 3300006353 | Bacteria | 1189 |
| 136 | Ga0075370_10264025 | 3300006353 | Bacteria | 1021 |
| 137 | Ga0068871_100261466 | 3300006358 | Bacteria | 1510 |
| 138 | Ga0075434_100845158 | 3300006871 | Bacteria | 931 |
| 139 | Ga0068865_101184368 | 3300006881 | Bacteria | 676 |
| 140 | Ga0097620_100057352 | 3300006931 | Bacteria | 3923 |
| 141 | Ga0099794_10039886 | 3300007265 | Bacteria | 2231 |
| 142 | Ga0105240_10012128 | 3300009093 | Bacteria | 11932 |
| 143 | Ga0105240_10044810 | 3300009093 | Bacteria | 5616 |
| 144 | Ga0105245_10058082 | 3300009098 | Bacteria | 3482 |
| 145 | Ga0105247_10006919 | 3300009101 | Bacteria | 6984 |
| 146 | Ga0105243_10074303 | 3300009148 | Bacteria | 2757 |
| 147 | Ga0105243_11067632 | 3300009148 | Bacteria | 814 |
| 148 | Ga0105241_10054562 | 3300009174 | Bacteria | 3059 |
| 149 | Ga0105241_10242460 | 3300009174 | Bacteria | 1524 |
| 150 | Ga0105242_10252974 | 3300009176 | Bacteria | 1588 |
| 151 | Ga0105237_10078243 | 3300009545 | Bacteria | 3296 |
| 152 | Ga0105237_10179551 | 3300009545 | Bacteria | 2117 |
| 153 | Ga0105237_10577958 | 3300009545 | Bacteria | 1130 |
| 154 | Ga0105238_10040525 | 3300009551 | Bacteria | 4719 |
| 155 | Ga0105238_11233256 | 3300009551 | Bacteria | 773 |
| 156 | Ga0105238_11659595 | 3300009551 | Bacteria | 670 |
| 157 | Ga0105249_10022931 | 3300009553 | Bacteria | 5596 |
| 158 | Ga0105249_10595320 | 3300009553 | Bacteria | 1160 |
| 159 | Ga0105239_10056734 | 3300010375 | Bacteria | 4296 |
| 160 | Ga0105239_10064895 | 3300010375 | Bacteria | 4008 |
| 161 | Ga0105246_10030323 | 3300011119 | Bacteria | 3570 |
| 162 | Ga0105246_11185711 | 3300011119 | Bacteria | 702 |
| 163 | Ga0157370_10109082 | 3300013104 | Bacteria | 2588 |
| 164 | Ga0157369_10006388 | 3300013105 | Bacteria | 13666 |
| 165 | Ga0157369_10044612 | 3300013105 | Bacteria | 4824 |
| 166 | Ga0157369_10158875 | 3300013105 | Bacteria | 2386 |
| 167 | Ga0157369_10802110 | 3300013105 | Bacteria | 967 |
| 168 | Ga0157378_10328789 | 3300013297 | Bacteria | 1487 |
| 169 | Ga0157372_10149159 | 3300013307 | Bacteria | 2698 |
| 170 | Ga0157375_10045330 | 3300013308 | Bacteria | 4279 |
| 171 | Ga0157380_10101682 | 3300014326 | Bacteria | 2395 |
| 172 | Ga0157380_11474009 | 3300014326 | Bacteria | 733 |
| 173 | Ga0157376_10858234 | 3300014969 | Bacteria | 924 |
| 174 | Ga0163161_10200638 | 3300017792 | Bacteria | 1537 |
| 175 | Ga0163161_10316643 | 3300017792 | Bacteria | 1232 |
| 176 | Ga0206354_11284064 | 3300020081 | Bacteria | 1027 |
| 177 | Ga0224712_10087246 | 3300022467 | Bacteria | 1300 |
| 178 | Ga0209233_1036920 | 3300025261 | Bacteria | 1091 |
| 179 | Ga0209564_1000397 | 3300025295 | Bacteria | 77778 |
| 180 | Ga0209564_1008259 | 3300025295 | Bacteria | 5177 |
| 181 | Ga0207656_10004387 | 3300025321 | Bacteria | 4924 |
| 182 | Ga0207692_10019957 | 3300025898 | Bacteria | 3039 |
| 183 | Ga0207692_10083953 | 3300025898 | Bacteria | 1710 |
| 184 | Ga0207642_10146538 | 3300025899 | Bacteria | 1251 |
| 185 | Ga0207642_10260852 | 3300025899 | Bacteria | 988 |
| 186 | Ga0207710_10070725 | 3300025900 | Bacteria | 1600 |
| 187 | Ga0207688_10560341 | 3300025901 | Bacteria | 718 |
| 188 | Ga0207680_10081903 | 3300025903 | Bacteria | 2030 |
| 189 | Ga0207647_10055549 | 3300025904 | Bacteria | 2433 |
| 190 | Ga0207699_10003036 | 3300025906 | Bacteria | 7971 |
| 191 | Ga0207699_10046371 | 3300025906 | Bacteria | 2542 |
| 192 | Ga0207699_10153939 | 3300025906 | Bacteria | 1524 |
| 193 | Ga0207699_10678623 | 3300025906 | Bacteria | 753 |
| 194 | Ga0207699_10800436 | 3300025906 | Bacteria | 693 |
| 195 | Ga0207645_10122652 | 3300025907 | Bacteria | 1688 |
| 196 | Ga0207654_10001136 | 3300025911 | Bacteria | 14369 |
| 197 | Ga0207654_10075482 | 3300025911 | Bacteria | 2015 |
| 198 | Ga0207654_10164125 | 3300025911 | Bacteria | 1437 |
| 199 | Ga0207707_10002224 | 3300025912 | Bacteria | 17529 |
| 200 | Ga0207707_10084314 | 3300025912 | Bacteria | 2775 |
| 201 | Ga0207695_10004577 | 3300025913 | Bacteria | 18798 |
| 202 | Ga0207695_10137453 | 3300025913 | Bacteria | 2396 |
| 203 | Ga0207695_10879181 | 3300025913 | Bacteria | 776 |
| 204 | Ga0207671_10250349 | 3300025914 | Bacteria | 1393 |
| 205 | Ga0207671_10586616 | 3300025914 | Bacteria | 888 |
| 206 | Ga0207693_10060842 | 3300025915 | Bacteria | 2958 |
| 207 | Ga0207693_10110049 | 3300025915 | Bacteria | 2160 |
| 208 | Ga0207693_10114738 | 3300025915 | Bacteria | 2114 |
| 209 | Ga0207693_10132194 | 3300025915 | Bacteria | 1962 |
| 210 | Ga0207663_10000239 | 3300025916 | Bacteria | 24165 |
| 211 | Ga0207663_10193366 | 3300025916 | Bacteria | 1462 |
| 212 | Ga0207660_10022785 | 3300025917 | Bacteria | 4222 |
| 213 | Ga0207660_10179444 | 3300025917 | Bacteria | 1644 |
| 214 | Ga0207660_10211996 | 3300025917 | Bacteria | 1517 |
| 215 | Ga0207660_10676250 | 3300025917 | Bacteria | 842 |
| 216 | Ga0207657_10005246 | 3300025919 | Bacteria | 13576 |
| 217 | Ga0207649_10196687 | 3300025920 | Bacteria | 1421 |
| 218 | Ga0207652_10004348 | 3300025921 | Bacteria | 11546 |
| 219 | Ga0207652_10052869 | 3300025921 | Bacteria | 3488 |
| 220 | Ga0207652_10120190 | 3300025921 | Bacteria | 2337 |
| 221 | Ga0207652_10129972 | 3300025921 | Bacteria | 2246 |
| 222 | Ga0207652_10758183 | 3300025921 | Bacteria | 863 |
| 223 | Ga0207681_10195828 | 3300025923 | Bacteria | 1549 |
| 224 | Ga0207694_10000263 | 3300025924 | Bacteria | 50099 |
| 225 | Ga0207694_11232027 | 3300025924 | Bacteria | 633 |
| 226 | Ga0207687_10042859 | 3300025927 | Bacteria | 3116 |
| 227 | Ga0207700_10005825 | 3300025928 | Bacteria | 7404 |
| 228 | Ga0207700_10231565 | 3300025928 | Bacteria | 1571 |
| 229 | Ga0207664_10010462 | 3300025929 | Bacteria | 6554 |
| 230 | Ga0207664_10560936 | 3300025929 | Bacteria | 1025 |
| 231 | Ga0207644_10073099 | 3300025931 | Bacteria | 2513 |
| 232 | Ga0207644_10532583 | 3300025931 | Bacteria | 971 |
| 233 | Ga0207644_10642325 | 3300025931 | Bacteria | 883 |
| 234 | Ga0207690_10076892 | 3300025932 | Bacteria | 2319 |
| 235 | Ga0207706_10154767 | 3300025933 | Bacteria | 2016 |
| 236 | Ga0207706_10581869 | 3300025933 | Bacteria | 962 |
| 237 | Ga0207709_10537243 | 3300025935 | Bacteria | 918 |
| 238 | Ga0207709_10710385 | 3300025935 | Bacteria | 805 |
| 239 | Ga0207669_10221830 | 3300025937 | Bacteria | 1388 |
| 240 | Ga0207704_10605344 | 3300025938 | Bacteria | 898 |
| 241 | Ga0207665_10016227 | 3300025939 | Bacteria | 4890 |
| 242 | Ga0207665_10191928 | 3300025939 | Bacteria | 1484 |
| 243 | Ga0207665_10648429 | 3300025939 | Bacteria | 827 |
| 244 | Ga0207665_10808577 | 3300025939 | Bacteria | 741 |
| 245 | Ga0207691_10041060 | 3300025940 | Bacteria | 4274 |
| 246 | Ga0207689_10046118 | 3300025942 | Bacteria | 3603 |
| 247 | Ga0207661_10054826 | 3300025944 | Bacteria | 3195 |
| 248 | Ga0207679_10168553 | 3300025945 | Bacteria | 1800 |
| 249 | Ga0207667_10042856 | 3300025949 | Bacteria | 4807 |
| 250 | Ga0207667_10173858 | 3300025949 | Bacteria | 2213 |
| 251 | Ga0207667_10203698 | 3300025949 | Bacteria | 2029 |
| 252 | Ga0207712_10210246 | 3300025961 | Bacteria | 1549 |
| 253 | Ga0207668_10241608 | 3300025972 | Bacteria | 1461 |
| 254 | Ga0207668_10245353 | 3300025972 | Bacteria | 1451 |
| 255 | Ga0207668_10632743 | 3300025972 | Bacteria | 935 |
| 256 | Ga0207668_11194760 | 3300025972 | Bacteria | 683 |
| 257 | Ga0207668_11687935 | 3300025972 | Bacteria | 572 |
| 258 | Ga0207640_10175528 | 3300025981 | Bacteria | 1601 |
| 259 | Ga0207640_10420267 | 3300025981 | Bacteria | 1094 |
| 260 | Ga0207658_10084693 | 3300025986 | Bacteria | 2440 |
| 261 | Ga0207658_10345018 | 3300025986 | Bacteria | 1295 |
| 262 | Ga0207677_10102129 | 3300026023 | Bacteria | 2113 |
| 263 | Ga0207677_11171544 | 3300026023 | Bacteria | 703 |
| 264 | Ga0207703_10035937 | 3300026035 | Bacteria | 3940 |
| 265 | Ga0207703_10256676 | 3300026035 | Bacteria | 1578 |
| 266 | Ga0207703_10413620 | 3300026035 | Bacteria | 1253 |
| 267 | Ga0207639_10033069 | 3300026041 | Bacteria | 3812 |
| 268 | Ga0207639_10080572 | 3300026041 | Bacteria | 2576 |
| 269 | Ga0207639_10091060 | 3300026041 | Bacteria | 2441 |
| 270 | Ga0207639_10173933 | 3300026041 | Bacteria | 1826 |
| 271 | Ga0207678_10028150 | 3300026067 | Bacteria | 4908 |
| 272 | Ga0207678_10040957 | 3300026067 | Bacteria | 4016 |
| 273 | Ga0207678_10054613 | 3300026067 | Bacteria | 3440 |
| 274 | Ga0207678_10091992 | 3300026067 | Bacteria | 2592 |
| 275 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 276 | Ga0207702_10051208 | 3300026078 | Bacteria | 3488 |
| 277 | Ga0207641_10082654 | 3300026088 | Bacteria | 2791 |
| 278 | Ga0207641_11511426 | 3300026088 | Bacteria | 673 |
| 279 | Ga0207648_10064662 | 3300026089 | Bacteria | 3188 |
| 280 | Ga0207676_10143282 | 3300026095 | Bacteria | 2048 |
| 281 | Ga0207674_10042085 | 3300026116 | Bacteria | 4721 |
| 282 | Ga0207674_10207845 | 3300026116 | Bacteria | 1907 |
| 283 | Ga0207675_100099894 | 3300026118 | Bacteria | 2733 |
| 284 | Ga0207675_100123214 | 3300026118 | Bacteria | 2454 |
| 285 | Ga0207683_10021485 | 3300026121 | Bacteria | 5526 |
| 286 | Ga0207683_10338347 | 3300026121 | Bacteria | 1380 |
| 287 | Ga0207683_10449844 | 3300026121 | Bacteria | 1187 |
| 288 | Ga0207698_10003760 | 3300026142 | Bacteria | 9172 |
| 289 | Ga0207698_10020150 | 3300026142 | Bacteria | 4585 |
| 290 | Ga0207698_10235550 | 3300026142 | Bacteria | 1665 |
| 291 | Ga0207698_10429937 | 3300026142 | Bacteria | 1269 |
| 292 | Ga0207698_10519180 | 3300026142 | Bacteria | 1162 |
| 293 | Ga0209588_1005209 | 3300027671 | Bacteria | 3711 |
| 294 | Ga0268266_10059443 | 3300028379 | Bacteria | 3293 |
| 295 | Ga0268266_10194248 | 3300028379 | Bacteria | 1854 |
| 296 | Ga0268265_10050565 | 3300028380 | Bacteria | 3132 |
| 297 | Ga0268265_10219823 | 3300028380 | Bacteria | 1661 |
| 298 | Ga0268264_10910392 | 3300028381 | Bacteria | 883 |
| 299 | Ga0265334_10054880 | 3300028573 | Bacteria | 1518 |
| 300 | Ga0265323_10000847 | 3300028653 | Bacteria | 16290 |
| 301 | Ga0265336_10000460 | 3300028666 | Bacteria | 24606 |
| 302 | Ga0307515_10076032 | 3300028794 | Bacteria | 4463 |
| 303 | Ga0265338_10007843 | 3300028800 | Bacteria | 13114 |
| 304 | Ga0307512_10395848 | 3300030522 | Bacteria | 583 |
| 305 | Ga0265332_10059337 | 3300031238 | Bacteria | 1637 |
| 306 | Ga0265340_10072641 | 3300031247 | Bacteria | 1629 |
| 307 | Ga0265339_10005327 | 3300031249 | Bacteria | 8573 |
| 308 | Ga0265339_10128751 | 3300031249 | Bacteria | 1296 |
| 309 | Ga0265331_10244465 | 3300031250 | Bacteria | 805 |
| 310 | Ga0265331_10246596 | 3300031250 | Bacteria | 801 |
| 311 | Ga0265316_10318944 | 3300031344 | Bacteria | 1129 |
| 312 | Ga0307513_10219859 | 3300031456 | Bacteria | 1722 |
| 313 | Ga0307408_100581111 | 3300031548 | Bacteria | 993 |
| 314 | Ga0307516_10014441 | 3300031730 | Bacteria | 8353 |
| 315 | Ga0307516_10574527 | 3300031730 | Bacteria | 781 |
| 316 | Ga0307405_10055884 | 3300031731 | Bacteria | 2473 |
| 317 | Ga0307412_10119924 | 3300031911 | Bacteria | 1892 |
| 318 | Ga0307412_10404727 | 3300031911 | Bacteria | 1112 |
| 319 | Ga0373938_0006155 | 3300034957 | Bacteria | 2064 |
| 320 | Ga0373940_0121661 | 3300035088 | Bacteria | 810 |
| 321 | Ga0373940_0256389 | 3300035088 | Bacteria | 591 |
| 322 | Ga0373923_0014550 | 3300035111 | Bacteria | 2957 |
| 323 | Ga0373932_0210730 | 3300035112 | Bacteria | 694 |
| 324 | Ga0373936_0013008 | 3300035113 | Bacteria | 3173 |
| 325 | Ga0373945_0014721 | 3300035116 | Bacteria | 2625 |
| 326 | Ga0373954_0055775 | 3300035118 | Bacteria | 1859 |
| 327 | Ga0373957_0007752 | 3300035120 | Bacteria | 3448 |
| 328 | Ga0373960_0124614 | 3300035121 | Bacteria | 858 |
| 329 | Ga0373943_0040038 | 3300035170 | Bacteria | 2261 |
| 330 | Ga0373943_0046688 | 3300035170 | Bacteria | 2114 |
| 331 | Ga0373946_0042460 | 3300035171 | Bacteria | 1869 |
| 332 | Ga0373955_0078419 | 3300035172 | Bacteria | 1861 |
| 333 | Ga0373955_0309490 | 3300035172 | Bacteria | 953 |
| 334 | Ga0373962_0194317 | 3300035242 | Bacteria | 684 |
| 335 | Ga0373931_0002919 | 3300035691 | Bacteria | 7629 |
| 336 | Ga0373935_0051350 | 3300035692 | Bacteria | 2618 |
| 337 | Ga0373935_0278633 | 3300035692 | Bacteria | 1177 |
| 338 | Ga0373927_0002293 | 3300035695 | Bacteria | 14012 |
| 339 | Ga0373927_0046721 | 3300035695 | Bacteria | 2800 |
| 340 | Ga0373927_0271406 | 3300035695 | Bacteria | 1115 |
| 341 | Ga0373927_0679097 | 3300035695 | Bacteria | 680 |
| 342 | Ga0373947_0006111 | 3300035725 | Bacteria | 7012 |
| 343 | Ga0373947_0106522 | 3300035725 | Bacteria | 1767 |
| 344 | Ga0373937_0105606 | 3300036401 | Bacteria | 2617 |
| 345 | Ga0372808_001604 | 3300036459 | Bacteria | 2400 |
| 346 | Ga0310109_027382 | 3300036534 | Bacteria | 761 |
| 347 | Ga0373925_0020497 | 3300037068 | Bacteria | 4813 |
| 348 | Ga0373925_0048125 | 3300037068 | Bacteria | 3176 |
| 349 | Ga0373925_0272686 | 3300037068 | Bacteria | 1361 |
| 350 | Ga0373925_0646131 | 3300037068 | Bacteria | 872 |
| 351 | Ga0373925_1139995 | 3300037068 | Bacteria | 641 |
| 352 | Ga0395905_0127901 | 3300037471 | Bacteria | 2389 |
| 353 | Ga0436365_1452029 | 3300039437 | Bacteria | 656 |
| 354 | Ga0436360_0554802 | 3300039438 | Bacteria | 1357 |
| 355 | Ga0436363_0923830 | 3300039450 | Bacteria | 4649 |
| 356 | Ga0436363_1496608 | 3300039450 | Bacteria | 2134 |
| 357 | Ga0451847_0777966 | 3300041503 | Bacteria | 1300 |
| 358 | Ga0451853_2446561 | 3300041512 | Bacteria | 817 |
| 359 | Ga0466963_0113153 | 3300044694 | Bacteria | 1864 |
| 360 | Ga0466967_0046134 | 3300045976 | Bacteria | 3792 |
| 361 | Ga0466967_0556264 | 3300045976 | Bacteria | 1129 |
| 362 | Ga0495592_0136373 | 3300046454 | Bacteria | 1711 |
| 363 | Ga0495603_0003213 | 3300046455 | Bacteria | 9727 |
| 364 | Ga0495603_0805827 | 3300046455 | Bacteria | 535 |
| 365 | Ga0495590_0376425 | 3300046457 | Bacteria | 542 |
| 366 | Ga0495629_0560374 | 3300046459 | Bacteria | 766 |
| 367 | Ga0495638_0062940 | 3300046460 | Bacteria | 2288 |
| 368 | Ga0495641_0222896 | 3300046461 | Bacteria | 846 |
| 369 | Ga0495580_0026362 | 3300046472 | Bacteria | 4238 |
| 370 | Ga0495580_0034224 | 3300046472 | Bacteria | 3658 |
| 371 | Ga0495582_0036609 | 3300046473 | Bacteria | 2699 |
| 372 | Ga0495605_0075166 | 3300046474 | Bacteria | 1589 |
| 373 | Ga0495639_0066929 | 3300046475 | Bacteria | 1654 |
| 374 | Ga0495662_0056597 | 3300046476 | Bacteria | 1894 |
| 375 | Ga0495662_0288997 | 3300046476 | Bacteria | 807 |
| 376 | Ga0495664_0029722 | 3300046477 | Bacteria | 3197 |
| 377 | Ga0495664_0132249 | 3300046477 | Bacteria | 1511 |
| 378 | Ga0495584_0119964 | 3300046491 | Bacteria | 1332 |
| 379 | Ga0495594_0077975 | 3300046499 | Bacteria | 1849 |
| 380 | Ga0495607_0054602 | 3300046501 | Bacteria | 2301 |
| 381 | Ga0495583_0029797 | 3300046506 | Bacteria | 2666 |
| 382 | Ga0495606_0035317 | 3300046507 | Bacteria | 3418 |
| 383 | Ga0495608_0467821 | 3300046511 | Bacteria | 766 |
| 384 | Ga0495610_0202277 | 3300046512 | Bacteria | 812 |
| 385 | Ga0495618_0020926 | 3300046514 | Bacteria | 4028 |
| 386 | Ga0495620_0018688 | 3300046515 | Bacteria | 3428 |
| 387 | Ga0495628_0886223 | 3300046516 | Bacteria | 620 |
| 388 | Ga0495630_0039230 | 3300046517 | Bacteria | 3542 |
| 389 | Ga0495643_0056808 | 3300046522 | Bacteria | 2087 |
| 390 | Ga0495644_0166884 | 3300046523 | Bacteria | 845 |
| 391 | Ga0495648_0187908 | 3300046524 | Bacteria | 1044 |
| 392 | Ga0495666_0106963 | 3300046526 | Bacteria | 1315 |
| 393 | Ga0495654_0023580 | 3300046530 | Bacteria | 3186 |
| 394 | Ga0495665_0026730 | 3300046531 | Bacteria | 3099 |
| 395 | Ga0495609_0026919 | 3300046538 | Bacteria | 2630 |
| 396 | Ga0495609_0152324 | 3300046538 | Bacteria | 983 |
| 397 | Ga0495597_0031306 | 3300046542 | Bacteria | 2422 |
| 398 | Ga0495645_0046942 | 3300046543 | Bacteria | 3148 |
| 399 | Ga0495645_0109425 | 3300046543 | Bacteria | 1956 |
| 400 | Ga0495622_0128150 | 3300046557 | Bacteria | 1156 |
| 401 | Ga0495622_0242485 | 3300046557 | Bacteria | 794 |
| 402 | Ga0495667_0038450 | 3300046559 | Bacteria | 3186 |
| 403 | Ga0495656_0099871 | 3300046615 | Bacteria | 1341 |
| 404 | Ga0495656_0259273 | 3300046615 | Bacteria | 880 |
| 405 | Ga0495668_0295274 | 3300046616 | Bacteria | 888 |
| 406 | Ga0495634_0036766 | 3300046642 | Bacteria | 3347 |
| 407 | Ga0495611_0211119 | 3300046648 | Bacteria | 904 |
| 408 | Ga0495625_0111295 | 3300046660 | Bacteria | 1871 |
| 409 | Ga0495588_0034937 | 3300046674 | Bacteria | 2545 |
| 410 | Ga0495588_0145361 | 3300046674 | Bacteria | 1253 |
| 411 | Ga0495599_0180496 | 3300046678 | Bacteria | 1301 |
| 412 | Ga0495658_0021799 | 3300046683 | Bacteria | 3381 |
| 413 | Ga0495658_0199371 | 3300046683 | Bacteria | 1247 |
| 414 | Ga0495669_0005476 | 3300046684 | Bacteria | 5299 |
| 415 | Ga0495669_0454636 | 3300046684 | Bacteria | 622 |
| 416 | Ga0495613_0396526 | 3300046689 | Bacteria | 942 |
| 417 | Ga0495613_0697923 | 3300046689 | Bacteria | 668 |
| 418 | Ga0495624_0079643 | 3300046690 | Bacteria | 2031 |
| 419 | Ga0495670_0031823 | 3300046691 | Bacteria | 2622 |
| 420 | Ga0495670_0330455 | 3300046691 | Bacteria | 819 |
| 421 | Ga0495671_0030072 | 3300046692 | Bacteria | 2784 |
| 422 | Ga0495581_0047059 | 3300047315 | Bacteria | 2493 |
| 423 | Ga0495604_0106527 | 3300047317 | Bacteria | 2050 |
| 424 | Ga0495674_0014414 | 3300047319 | Bacteria | 7399 |
| 425 | Ga0495677_0234835 | 3300047445 | Bacteria | 716 |
| 426 | Ga0495684_0002699 | 3300047471 | Bacteria | 14047 |
| 427 | Ga0495593_0011625 | 3300047673 | Bacteria | 5051 |
| 428 | Ga0496100_0174641 | 3300048903 | Bacteria | 1550 |
| 429 | Ga0496100_0844703 | 3300048903 | Bacteria | 718 |
| 430 | Ga0496101_0090423 | 3300048904 | Bacteria | 2277 |
| 431 | Ga0496101_0692758 | 3300048904 | Bacteria | 805 |
| 432 | Ga0496102_0067840 | 3300048905 | Bacteria | 3272 |
| 433 | Ga0496102_0183360 | 3300048905 | Bacteria | 1972 |
| 434 | Ga0496102_1053369 | 3300048905 | Bacteria | 733 |
| 435 | Ga0496103_0064217 | 3300048906 | Bacteria | 2288 |
| 436 | Ga0496103_0748045 | 3300048906 | Bacteria | 618 |
| 437 | Ga0496104_0020638 | 3300048907 | Bacteria | 6041 |
| 438 | Ga0496104_0258816 | 3300048907 | Bacteria | 1653 |
| 439 | Ga0496104_0650923 | 3300048907 | Bacteria | 963 |
| 440 | Ga0496105_0027529 | 3300048908 | Bacteria | 4645 |
| 441 | Ga0496106_0000274 | 3300048909 | Bacteria | 36362 |
| 442 | Ga0496106_0046679 | 3300048909 | Bacteria | 3257 |
| 443 | Ga0496106_0639790 | 3300048909 | Bacteria | 850 |
| 444 | Ga0496106_1189453 | 3300048909 | Bacteria | 595 |
| 445 | Ga0496107_0022390 | 3300048910 | Bacteria | 4465 |
| 446 | Ga0496107_0029095 | 3300048910 | Bacteria | 3928 |
| 447 | Ga0496107_0195274 | 3300048910 | Bacteria | 1504 |
| 448 | Ga0496108_0082670 | 3300048911 | Bacteria | 2723 |
| 449 | Ga0496108_0117890 | 3300048911 | Bacteria | 2275 |
| 450 | Ga0496108_0136620 | 3300048911 | Bacteria | 2110 |
| 451 | Ga0496109_0001723 | 3300048912 | Bacteria | 18237 |
| 452 | Ga0496109_0275164 | 3300048912 | Bacteria | 1586 |
| 453 | Ga0496109_0534623 | 3300048912 | Bacteria | 1106 |
| 454 | Ga0496110_0432748 | 3300048913 | Bacteria | 1199 |
| 455 | Ga0496110_0574511 | 3300048913 | Bacteria | 1024 |
| 456 | Ga0496111_0078867 | 3300048914 | Bacteria | 2402 |
| 457 | Ga0496111_0092497 | 3300048914 | Bacteria | 2217 |
| 458 | Ga0496111_0799896 | 3300048914 | Bacteria | 682 |
| 459 | Ga0496112_0001789 | 3300048915 | Bacteria | 16907 |
| 460 | Ga0496112_0024667 | 3300048915 | Bacteria | 5764 |
| 461 | Ga0496112_0028860 | 3300048915 | Bacteria | 5360 |
| 462 | Ga0496112_0127489 | 3300048915 | Bacteria | 2515 |
| 463 | Ga0496112_0353181 | 3300048915 | Bacteria | 1412 |
| 464 | Ga0496113_0005868 | 3300048916 | Bacteria | 7708 |
| 465 | Ga0496113_0251620 | 3300048916 | Bacteria | 1411 |
| 466 | Ga0496113_0671692 | 3300048916 | Bacteria | 828 |
| 467 | Ga0496113_0722137 | 3300048916 | Bacteria | 794 |
| 468 | Ga0496114_0091581 | 3300048917 | Bacteria | 2582 |
| 469 | Ga0496115_0123983 | 3300048918 | Bacteria | 2127 |
| 470 | Ga0496115_0396721 | 3300048918 | Bacteria | 1120 |
| 471 | Ga0496115_0428720 | 3300048918 | Bacteria | 1071 |
| 472 | Ga0496115_0629897 | 3300048918 | Bacteria | 850 |
| 473 | Ga0496116_0001009 | 3300048919 | Bacteria | 34303 |
| 474 | Ga0496116_0127293 | 3300048919 | Bacteria | 1460 |
| 475 | Ga0496117_0091841 | 3300048920 | Bacteria | 1951 |
| 476 | Ga0496117_0110318 | 3300048920 | Bacteria | 1715 |
| 477 | Ga0496117_0387053 | 3300048920 | Bacteria | 710 |
| 478 | Ga0496118_0069653 | 3300048921 | Bacteria | 2546 |
| 479 | Ga0496118_0090141 | 3300048921 | Bacteria | 2114 |
| 480 | Ga0496119_0099687 | 3300048922 | Bacteria | 1633 |
| 481 | Ga0496120_0046524 | 3300048923 | Bacteria | 2507 |
| 482 | Ga0496121_0102338 | 3300048924 | Bacteria | 2207 |
| 483 | Ga0496121_0194387 | 3300048924 | Bacteria | 1452 |
| 484 | Ga0496121_0292661 | 3300048924 | Bacteria | 1108 |
| 485 | Ga0496121_0539509 | 3300048924 | Bacteria | 732 |
| 486 | Ga0496122_0048488 | 3300048925 | Bacteria | 3264 |
| 487 | Ga0496122_0077299 | 3300048925 | Bacteria | 2338 |
| 488 | Ga0496122_0098738 | 3300048925 | Bacteria | 1960 |
| 489 | Ga0496122_0103679 | 3300048925 | Bacteria | 1892 |
| 490 | Ga0496123_0141060 | 3300048926 | Bacteria | 1317 |
| 491 | Ga0496124_0198097 | 3300048927 | Bacteria | 1530 |
| 492 | Ga0496125_0000158 | 3300048928 | Bacteria | 151273 |
| 493 | Ga0496125_0001221 | 3300048928 | Bacteria | 38541 |
| 494 | Ga0496125_0010378 | 3300048928 | Bacteria | 9421 |
| 495 | Ga0496125_0018363 | 3300048928 | Bacteria | 6645 |
| 496 | Ga0496125_0175415 | 3300048928 | Bacteria | 1435 |
| 497 | Ga0496126_0007041 | 3300048929 | Bacteria | 12402 |
| 498 | Ga0496126_0008848 | 3300048929 | Bacteria | 10790 |
| 499 | Ga0496126_0040463 | 3300048929 | Bacteria | 4320 |
| 500 | Ga0496126_0233609 | 3300048929 | Bacteria | 1539 |
| 501 | Ga0496126_0377784 | 3300048929 | Bacteria | 1154 |
| 502 | Ga0496126_0473306 | 3300048929 | Bacteria | 1005 |
| 503 | Ga0496126_0565909 | 3300048929 | Bacteria | 900 |
| 504 | Ga0496126_0631730 | 3300048929 | Bacteria | 840 |
| 505 | Ga0496126_0870643 | 3300048929 | Bacteria | 685 |
| 506 | Ga0496126_1174004 | 3300048929 | Bacteria | 566 |
| 507 | Ga0501042_0850839 | 3300049578 | Bacteria | 664 |
| 508 | Ga0501076_0422936 | 3300049592 | Bacteria | 1096 |
| 509 | Ga0501080_0483392 | 3300049742 | Bacteria | 1108 |
| 510 | Ga0501045_0231447 | 3300049824 | Bacteria | 1376 |
| 511 | nmdc:mga03n38_424572_c1 | 3300050490 | Bacteria | 736 |
| 512 | nmdc:mga03n38_844047_c1 | 3300050490 | Bacteria | 535 |
| 513 | nmdc:mga00v17_128642_c1 | 3300050491 | Bacteria | 1617 |
| 514 | nmdc:mga00v17_164221_c1 | 3300050491 | Bacteria | 1431 |
| 515 | nmdc:mga0yw44_235804_c1 | 3300050492 | Bacteria | 1215 |
| 516 | nmdc:mga0yw44_654961_c1 | 3300050492 | Bacteria | 714 |
| 517 | nmdc:mga0k408_160835_c1 | 3300050493 | Bacteria | 1338 |
| 518 | nmdc:mga06z11_323140_c1 | 3300050494 | Bacteria | 921 |
| 519 | nmdc:mga06z11_601556_c1 | 3300050494 | Bacteria | 669 |
| 520 | nmdc:mga06z11_622363_c1 | 3300050494 | Bacteria | 657 |
| 521 | nmdc:mga04h51_140893_c1 | 3300050495 | Bacteria | 914 |
| 522 | nmdc:mga07m45_210725_c1 | 3300050496 | Bacteria | 1130 |
| 523 | nmdc:mga07m45_319398_c1 | 3300050496 | Bacteria | 903 |
| 524 | nmdc:mga0n895_837372_c1 | 3300050512 | Bacteria | 908 |
| 525 | nmdc:mga0sz30_189158_c1 | 3300050516 | Bacteria | 914 |
| 526 | nmdc:mga0sz30_3737_c1 | 3300050516 | Bacteria | 5486 |
| 527 | Ga0495601_0047533 | 3300053077 | Bacteria | 2702 |
| 528 | Ga0495601_0427557 | 3300053077 | Bacteria | 857 |
| 529 | Ga0495612_0043952 | 3300053078 | Bacteria | 1827 |
| 530 | Ga0495612_0167296 | 3300053078 | Bacteria | 962 |
| 531 | Ga0495655_0247704 | 3300053083 | Bacteria | 598 |
| 532 | Ga0495595_0077423 | 3300053084 | Bacteria | 1580 |
| 533 | Ga0500578_0047504 | 3300053086 | Bacteria | 2754 |
| 534 | Ga0500644_0106713 | 3300053088 | Bacteria | 1072 |
| 535 | Ga0500581_019636 | 3300053089 | Bacteria | 3411 |
| 536 | Ga0500646_0092618 | 3300053090 | Bacteria | 938 |
| 537 | Ga0500651_0037934 | 3300053093 | Bacteria | 3036 |
| 538 | Ga0500566_0002015 | 3300053094 | Bacteria | 11989 |
| 539 | Ga0500566_0023225 | 3300053094 | Bacteria | 3640 |
| 540 | Ga0500566_0184062 | 3300053094 | Bacteria | 1069 |
| 541 | Ga0500641_0023710 | 3300053096 | Bacteria | 2362 |
| 542 | Ga0500650_0059980 | 3300053098 | Bacteria | 1775 |
| 543 | Ga0500554_078792 | 3300053102 | Bacteria | 1082 |
| 544 | Ga0500555_025706 | 3300053103 | Bacteria | 1685 |
| 545 | Ga0500556_0000029 | 3300053104 | Bacteria | 165326 |
| 546 | Ga0500592_001711 | 3300053116 | Bacteria | 3556 |
| 547 | Ga0500594_0004224 | 3300053118 | Bacteria | 3168 |
| 548 | Ga0500595_000842 | 3300053119 | Bacteria | 17493 |
| 549 | Ga0500608_017399 | 3300053122 | Bacteria | 3264 |
| 550 | Ga0500614_125702 | 3300053123 | Bacteria | 758 |
| 551 | Ga0500618_004224 | 3300053125 | Bacteria | 4663 |
| 552 | Ga0500618_007533 | 3300053125 | Bacteria | 3098 |
| 553 | Ga0500642_0000020 | 3300053130 | Bacteria | 159498 |
| 554 | Ga0500652_003899 | 3300053131 | Bacteria | 4559 |
| 555 | Ga0500559_0000288 | 3300053136 | Bacteria | 38883 |
| 556 | Ga0500577_0029354 | 3300053142 | Bacteria | 1903 |
| 557 | Ga0500577_0107404 | 3300053142 | Bacteria | 1148 |
| 558 | Ga0500586_013405 | 3300053145 | Bacteria | 2412 |
| 559 | Ga0500588_0055539 | 3300053146 | Bacteria | 1251 |
| 560 | Ga0500590_021761 | 3300053148 | Bacteria | 3327 |
| 561 | Ga0500616_0000112 | 3300053153 | Bacteria | 151210 |
| 562 | Ga0500627_0055489 | 3300053158 | Bacteria | 1734 |
| 563 | Ga0500633_0014300 | 3300053160 | Bacteria | 2249 |
| 564 | Ga0500638_010417 | 3300053162 | Bacteria | 4071 |
| 565 | Ga0500636_0010810 | 3300053177 | Bacteria | 5334 |
| 566 | Ga0500636_0113825 | 3300053177 | Bacteria | 1525 |
| 567 | Ga0500637_0000251 | 3300053178 | Bacteria | 19903 |
| 568 | Ga0500637_0174779 | 3300053178 | Bacteria | 1233 |
| 569 | Ga0500567_076978 | 3300053723 | Bacteria | 1450 |
| 570 | Ga0500645_069909 | 3300053730 | Bacteria | 1008 |
| 571 | Ga0500661_004969 | 3300055283 | Bacteria | 2492 |
| 572 | Ga0501082_0353746 | 3300060353 | Bacteria | 1281 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10044810 | Ga0105240_100448103 | 134 |
| 2 | 3300009174 | Ga0105241_10242460 | Ga0105241_102424602 | 134 |
| 3 | 3300009545 | Ga0105237_10577958 | Ga0105237_105779581 | 134 |
| 4 | 3300005546 | Ga0070696_101245527 | Ga0070696_1012455271 | 146 |
| 5 | 3300041503 | Ga0451847_0777966 | Ga0451847_0777966_548_1072 | 146 |
| 6 | 3300046455 | Ga0495603_0805827 | Ga0495603_0805827_72_512 | 146 |
| 7 | 3300050490 | nmdc:mga03n38_844047_c1 | nmdc:mga03n38_844047_c1_41_511 | 146 |
| 8 | 3300005262 | Ga0065165_1023758 | Ga0065165_10237582 | 147 |
| 9 | 3300005336 | Ga0070680_100101388 | Ga0070680_1001013882 | 147 |
| 10 | 3300005336 | Ga0070680_100253650 | Ga0070680_1002536501 | 147 |
| 11 | 3300005337 | Ga0070682_100031969 | Ga0070682_1000319693 | 147 |
| 12 | 3300005341 | Ga0070691_10560839 | Ga0070691_105608391 | 147 |
| 13 | 3300005434 | Ga0070709_11163347 | Ga0070709_111633471 | 147 |
| 14 | 3300005458 | Ga0070681_10057197 | Ga0070681_100571973 | 147 |
| 15 | 3300005530 | Ga0070679_100083419 | Ga0070679_1000834193 | 147 |
| 16 | 3300005539 | Ga0068853_100978694 | Ga0068853_1009786942 | 147 |
| 17 | 3300005545 | Ga0070695_100487240 | Ga0070695_1004872401 | 147 |
| 18 | 3300005547 | Ga0070693_100068028 | Ga0070693_1000680282 | 147 |
| 19 | 3300005548 | Ga0070665_100356008 | Ga0070665_1003560083 | 147 |
| 20 | 3300005563 | Ga0068855_101139469 | Ga0068855_1011394691 | 147 |
| 21 | 3300006038 | Ga0075365_10020835 | Ga0075365_100208352 | 147 |
| 22 | 3300006042 | Ga0075368_10325398 | Ga0075368_103253981 | 147 |
| 23 | 3300006051 | Ga0075364_10075732 | Ga0075364_100757322 | 147 |
| 24 | 3300006173 | Ga0070716_100169405 | Ga0070716_1001694053 | 147 |
| 25 | 3300006186 | Ga0075369_10006028 | Ga0075369_100060282 | 147 |
| 26 | 3300006353 | Ga0075370_10196716 | Ga0075370_101967161 | 147 |
| 27 | 3300009551 | Ga0105238_11233256 | Ga0105238_112332561 | 147 |
| 28 | 3300025295 | Ga0209564_1008259 | Ga0209564_10082593 | 147 |
| 29 | 3300025906 | Ga0207699_10153939 | Ga0207699_101539391 | 147 |
| 30 | 3300025911 | Ga0207654_10164125 | Ga0207654_101641252 | 147 |
| 31 | 3300025912 | Ga0207707_10084314 | Ga0207707_100843143 | 147 |
| 32 | 3300025913 | Ga0207695_10137453 | Ga0207695_101374532 | 147 |
| 33 | 3300025917 | Ga0207660_10179444 | Ga0207660_101794442 | 147 |
| 34 | 3300025920 | Ga0207649_10196687 | Ga0207649_101966872 | 147 |
| 35 | 3300025921 | Ga0207652_10052869 | Ga0207652_100528693 | 147 |
| 36 | 3300025981 | Ga0207640_10420267 | Ga0207640_104202672 | 147 |
| 37 | 3300026067 | Ga0207678_10040957 | Ga0207678_100409573 | 147 |
| 38 | 3300028794 | Ga0307515_10076032 | Ga0307515_100760324 | 147 |
| 39 | 3300031456 | Ga0307513_10219859 | Ga0307513_102198592 | 147 |
| 40 | 3300031911 | Ga0307412_10404727 | Ga0307412_104047272 | 147 |
| 41 | 3300037068 | Ga0373925_0272686 | Ga0373925_0272686_29_508 | 147 |
| 42 | 3300039438 | Ga0436360_0554802 | Ga0436360_0554802_14_457 | 147 |
| 43 | 3300046457 | Ga0495590_0376425 | Ga0495590_0376425_26_502 | 147 |
| 44 | 3300046460 | Ga0495638_0062940 | Ga0495638_0062940_114_590 | 147 |
| 45 | 3300046474 | Ga0495605_0075166 | Ga0495605_0075166_31_507 | 147 |
| 46 | 3300046501 | Ga0495607_0054602 | Ga0495607_0054602_109_585 | 147 |
| 47 | 3300046506 | Ga0495583_0029797 | Ga0495583_0029797_1085_1561 | 147 |
| 48 | 3300046507 | Ga0495606_0035317 | Ga0495606_0035317_2163_2639 | 147 |
| 49 | 3300046512 | Ga0495610_0202277 | Ga0495610_0202277_45_521 | 147 |
| 50 | 3300046515 | Ga0495620_0018688 | Ga0495620_0018688_2658_3134 | 147 |
| 51 | 3300046522 | Ga0495643_0056808 | Ga0495643_0056808_412_888 | 147 |
| 52 | 3300046524 | Ga0495648_0187908 | Ga0495648_0187908_386_862 | 147 |
| 53 | 3300046530 | Ga0495654_0023580 | Ga0495654_0023580_1201_1677 | 147 |
| 54 | 3300046538 | Ga0495609_0026919 | Ga0495609_0026919_377_853 | 147 |
| 55 | 3300046542 | Ga0495597_0031306 | Ga0495597_0031306_995_1471 | 147 |
| 56 | 3300046660 | Ga0495625_0111295 | Ga0495625_0111295_1361_1837 | 147 |
| 57 | 3300046691 | Ga0495670_0031823 | Ga0495670_0031823_108_584 | 147 |
| 58 | 3300046692 | Ga0495671_0030072 | Ga0495671_0030072_950_1426 | 147 |
| 59 | 3300048909 | Ga0496106_0639790 | Ga0496106_0639790_218_745 | 147 |
| 60 | 3300048916 | Ga0496113_0671692 | Ga0496113_0671692_280_756 | 147 |
| 61 | 3300048919 | Ga0496116_0001009 | Ga0496116_0001009_23791_24318 | 147 |
| 62 | 3300048919 | Ga0496116_0127293 | Ga0496116_0127293_452_928 | 147 |
| 63 | 3300048920 | Ga0496117_0091841 | Ga0496117_0091841_622_1149 | 147 |
| 64 | 3300048920 | Ga0496117_0110318 | Ga0496117_0110318_888_1364 | 147 |
| 65 | 3300048921 | Ga0496118_0069653 | Ga0496118_0069653_633_1160 | 147 |
| 66 | 3300048923 | Ga0496120_0046524 | Ga0496120_0046524_947_1423 | 147 |
| 67 | 3300048924 | Ga0496121_0194387 | Ga0496121_0194387_299_778 | 147 |
| 68 | 3300048924 | Ga0496121_0292661 | Ga0496121_0292661_15_491 | 147 |
| 69 | 3300048925 | Ga0496122_0048488 | Ga0496122_0048488_1272_1748 | 147 |
| 70 | 3300048925 | Ga0496122_0077299 | Ga0496122_0077299_1561_2088 | 147 |
| 71 | 3300048926 | Ga0496123_0141060 | Ga0496123_0141060_737_1213 | 147 |
| 72 | 3300048927 | Ga0496124_0198097 | Ga0496124_0198097_258_785 | 147 |
| 73 | 3300048928 | Ga0496125_0010378 | Ga0496125_0010378_4385_4861 | 147 |
| 74 | 3300048928 | Ga0496125_0018363 | Ga0496125_0018363_1773_2300 | 147 |
| 75 | 3300048929 | Ga0496126_0233609 | Ga0496126_0233609_38_514 | 147 |
| 76 | 3300048929 | Ga0496126_0377784 | Ga0496126_0377784_381_908 | 147 |
| 77 | 3300050491 | nmdc:mga00v17_128642_c1 | nmdc:mga00v17_128642_c1_699_1226 | 147 |
| 78 | 3300050494 | nmdc:mga06z11_622363_c1 | nmdc:mga06z11_622363_c1_18_545 | 147 |
| 79 | 3300050495 | nmdc:mga04h51_140893_c1 | nmdc:mga04h51_140893_c1_190_717 | 147 |
| 80 | 3300050496 | nmdc:mga07m45_210725_c1 | nmdc:mga07m45_210725_c1_121_648 | 147 |
| 81 | 3300050516 | nmdc:mga0sz30_3737_c1 | nmdc:mga0sz30_3737_c1_3239_3766 | 147 |
| 82 | 3300053083 | Ga0495655_0247704 | Ga0495655_0247704_12_488 | 147 |
| 83 | 3300053086 | Ga0500578_0047504 | Ga0500578_0047504_1137_1613 | 147 |
| 84 | 3300053088 | Ga0500644_0106713 | Ga0500644_0106713_490_966 | 147 |
| 85 | 3300053089 | Ga0500581_019636 | Ga0500581_019636_2501_2977 | 147 |
| 86 | 3300053090 | Ga0500646_0092618 | Ga0500646_0092618_418_894 | 147 |
| 87 | 3300053094 | Ga0500566_0184062 | Ga0500566_0184062_418_894 | 147 |
| 88 | 3300053096 | Ga0500641_0023710 | Ga0500641_0023710_1583_2059 | 147 |
| 89 | 3300053103 | Ga0500555_025706 | Ga0500555_025706_896_1372 | 147 |
| 90 | 3300053104 | Ga0500556_0000029 | Ga0500556_0000029_70799_71275 | 147 |
| 91 | 3300053116 | Ga0500592_001711 | Ga0500592_001711_1772_2248 | 147 |
| 92 | 3300053118 | Ga0500594_0004224 | Ga0500594_0004224_1980_2456 | 147 |
| 93 | 3300053130 | Ga0500642_0000020 | Ga0500642_0000020_72537_73013 | 147 |
| 94 | 3300053131 | Ga0500652_003899 | Ga0500652_003899_2968_3444 | 147 |
| 95 | 3300053142 | Ga0500577_0107404 | Ga0500577_0107404_419_895 | 147 |
| 96 | 3300053145 | Ga0500586_013405 | Ga0500586_013405_1667_2143 | 147 |
| 97 | 3300053146 | Ga0500588_0055539 | Ga0500588_0055539_701_1177 | 147 |
| 98 | 3300053153 | Ga0500616_0000112 | Ga0500616_0000112_72809_73285 | 147 |
| 99 | 3300053158 | Ga0500627_0055489 | Ga0500627_0055489_1026_1502 | 147 |
| 100 | 3300053160 | Ga0500633_0014300 | Ga0500633_0014300_396_872 | 147 |
| 101 | 3300053723 | Ga0500567_076978 | Ga0500567_076978_689_1165 | 147 |
| 102 | 3300053730 | Ga0500645_069909 | Ga0500645_069909_470_946 | 147 |
| 103 | 3300011119 | Ga0105246_11185711 | Ga0105246_111857111 | 148 |
| 104 | 3300039437 | Ga0436365_1452029 | Ga0436365_1452029_113_595 | 148 |
| 105 | 3300047315 | Ga0495581_0047059 | Ga0495581_0047059_32_478 | 148 |
| 106 | 3300036459 | Ga0372808_001604 | Ga0372808_001604_1624_2109 | 149 |
| 107 | 3300036534 | Ga0310109_027382 | Ga0310109_027382_54_539 | 149 |
| 108 | 3300039450 | Ga0436363_0923830 | Ga0436363_0923830_3815_4264 | 149 |
| 109 | 3300053098 | Ga0500650_0059980 | Ga0500650_0059980_1237_1713 | 150 |
| 110 | 3300006178 | Ga0075367_10081962 | Ga0075367_100819622 | 151 |
| 111 | 3300006195 | Ga0075366_10038074 | Ga0075366_100380743 | 151 |
| 112 | 3300050493 | nmdc:mga0k408_160835_c1 | nmdc:mga0k408_160835_c1_329_811 | 151 |
| 113 | 3300050494 | nmdc:mga06z11_323140_c1 | nmdc:mga06z11_323140_c1_358_840 | 151 |
| 114 | 3300048903 | Ga0496100_0174641 | Ga0496100_0174641_460_936 | 152 |
| 115 | 3300048905 | Ga0496102_1053369 | Ga0496102_1053369_111_587 | 152 |
| 116 | 3300048909 | Ga0496106_0000274 | Ga0496106_0000274_26378_26854 | 152 |
| 117 | 3300048910 | Ga0496107_0029095 | Ga0496107_0029095_1870_2346 | 152 |
| 118 | 3300048911 | Ga0496108_0082670 | Ga0496108_0082670_2003_2479 | 152 |
| 119 | 3300048912 | Ga0496109_0001723 | Ga0496109_0001723_4259_4735 | 152 |
| 120 | 3300048914 | Ga0496111_0092497 | Ga0496111_0092497_71_547 | 152 |
| 121 | 3300048915 | Ga0496112_0001789 | Ga0496112_0001789_3143_3619 | 152 |
| 122 | 3300048916 | Ga0496113_0005868 | Ga0496113_0005868_4983_5459 | 152 |
| 123 | iso_pu_bacteria | 2602042107 | 2603857304 | 153 |
| 124 | iso_pu_bacteria | 2857524615 | 2857526680 | 153 |
| 125 | iso_pu_bacteria | 2919073203 | 2919077812 | 153 |
| 126 | iso_pu_bacteria | 2508501128 | 2509146620 | 154 |
| 127 | iso_pu_bacteria | 2721755755 | 2723842806 | 154 |
| 128 | iso_pu_bacteria | 2893066018 | 2893069845 | 154 |
| 129 | 3300006175 | Ga0070712_100681618 | Ga0070712_1006816182 | 155 |
| 130 | 3300039450 | Ga0436363_1496608 | Ga0436363_1496608_1180_1647 | 155 |
| 131 | 3300048920 | Ga0496117_0387053 | Ga0496117_0387053_131_601 | 155 |
| 132 | 3300048921 | Ga0496118_0090141 | Ga0496118_0090141_1112_1582 | 155 |
| 133 | 3300048922 | Ga0496119_0099687 | Ga0496119_0099687_636_1106 | 155 |
| 134 | iso_pu_bacteria | 2874604998 | 2874606524 | 155 |
| 135 | iso_pu_bacteria | 2922361189 | 2922367291 | 155 |
| 136 | iso_pu_bacteria | 8006994254 | 8006998101 | 155 |
| 137 | iso_pu_bacteria | 8056673599 | 8056675124 | 155 |
| 138 | 3300005455 | Ga0070663_100779159 | Ga0070663_1007791591 | 156 |
| 139 | 3300005617 | Ga0068859_100057352 | Ga0068859_1000573522 | 156 |
| 140 | 3300006931 | Ga0097620_100057352 | Ga0097620_1000573522 | 156 |
| 141 | 3300009101 | Ga0105247_10006919 | Ga0105247_100069199 | 156 |
| 142 | 3300025295 | Ga0209564_1000397 | Ga0209564_100039718 | 156 |
| 143 | 3300025900 | Ga0207710_10070725 | Ga0207710_100707252 | 156 |
| 144 | 3300025914 | Ga0207671_10586616 | Ga0207671_105866161 | 156 |
| 145 | 3300026035 | Ga0207703_10035937 | Ga0207703_100359373 | 156 |
| 146 | 3300028653 | Ga0265323_10000847 | Ga0265323_100008474 | 156 |
| 147 | 3300028666 | Ga0265336_10000460 | Ga0265336_1000046010 | 156 |
| 148 | 3300028800 | Ga0265338_10007843 | Ga0265338_1000784310 | 156 |
| 149 | 3300041512 | Ga0451853_2446561 | Ga0451853_2446561_116_586 | 156 |
| 150 | 3300045976 | Ga0466967_0556264 | Ga0466967_0556264_412_882 | 156 |
| 151 | 3300048924 | Ga0496121_0539509 | Ga0496121_0539509_114_584 | 156 |
| 152 | 3300048928 | Ga0496125_0175415 | Ga0496125_0175415_413_883 | 156 |
| 153 | 3300053125 | Ga0500618_007533 | Ga0500618_007533_2432_2908 | 156 |
| 154 | iso_pu_bacteria | 2513237101 | 2513697947 | 156 |
| 155 | iso_pu_bacteria | 2513237141 | 2513887734 | 156 |
| 156 | iso_pu_bacteria | 2524023210 | 2524467522 | 156 |
| 157 | iso_pu_bacteria | 2889033259 | 2889033868 | 156 |
| 158 | 3300003659 | JGI25404J52841_10018792 | JGI25404J52841_100187921 | 157 |
| 159 | 3300005335 | Ga0070666_10113509 | Ga0070666_101135092 | 157 |
| 160 | 3300005336 | Ga0070680_100151637 | Ga0070680_1001516371 | 157 |
| 161 | 3300005336 | Ga0070680_101699734 | Ga0070680_1016997341 | 157 |
| 162 | 3300005338 | Ga0068868_100101930 | Ga0068868_1001019302 | 157 |
| 163 | 3300005340 | Ga0070689_100825001 | Ga0070689_1008250011 | 157 |
| 164 | 3300005344 | Ga0070661_100107153 | Ga0070661_1001071532 | 157 |
| 165 | 3300005347 | Ga0070668_100093836 | Ga0070668_1000938362 | 157 |
| 166 | 3300005355 | Ga0070671_100281825 | Ga0070671_1002818252 | 157 |
| 167 | 3300005366 | Ga0070659_100129339 | Ga0070659_1001293392 | 157 |
| 168 | 3300005366 | Ga0070659_100216618 | Ga0070659_1002166182 | 157 |
| 169 | 3300005367 | Ga0070667_100083186 | Ga0070667_1000831863 | 157 |
| 170 | 3300005440 | Ga0070705_100525593 | Ga0070705_1005255931 | 157 |
| 171 | 3300005444 | Ga0070694_100867171 | Ga0070694_1008671711 | 157 |
| 172 | 3300005456 | Ga0070678_100334684 | Ga0070678_1003346842 | 157 |
| 173 | 3300005530 | Ga0070679_100099081 | Ga0070679_1000990813 | 157 |
| 174 | 3300005530 | Ga0070679_100184985 | Ga0070679_1001849852 | 157 |
| 175 | 3300005539 | Ga0068853_100091422 | Ga0068853_1000914221 | 157 |
| 176 | 3300005548 | Ga0070665_100255745 | Ga0070665_1002557452 | 157 |
| 177 | 3300005563 | Ga0068855_100110807 | Ga0068855_1001108073 | 157 |
| 178 | 3300005563 | Ga0068855_100187469 | Ga0068855_1001874692 | 157 |
| 179 | 3300005564 | Ga0070664_100098130 | Ga0070664_1000981303 | 157 |
| 180 | 3300005614 | Ga0068856_100182397 | Ga0068856_1001823973 | 157 |
| 181 | 3300005615 | Ga0070702_100060854 | Ga0070702_1000608542 | 157 |
| 182 | 3300005616 | Ga0068852_100655435 | Ga0068852_1006554351 | 157 |
| 183 | 3300005718 | Ga0068866_10503710 | Ga0068866_105037102 | 157 |
| 184 | 3300005719 | Ga0068861_100020959 | Ga0068861_1000209595 | 157 |
| 185 | 3300005841 | Ga0068863_100042307 | Ga0068863_1000423073 | 157 |
| 186 | 3300005842 | Ga0068858_100072672 | Ga0068858_1000726722 | 157 |
| 187 | 3300005983 | Ga0081540_1053672 | Ga0081540_10536722 | 157 |
| 188 | 3300006051 | Ga0075364_10860063 | Ga0075364_108600631 | 157 |
| 189 | 3300006353 | Ga0075370_10264025 | Ga0075370_102640252 | 157 |
| 190 | 3300009098 | Ga0105245_10058082 | Ga0105245_100580822 | 157 |
| 191 | 3300009174 | Ga0105241_10054562 | Ga0105241_100545623 | 157 |
| 192 | 3300009553 | Ga0105249_10595320 | Ga0105249_105953202 | 157 |
| 193 | 3300010375 | Ga0105239_10056734 | Ga0105239_100567344 | 157 |
| 194 | 3300011119 | Ga0105246_10030323 | Ga0105246_100303232 | 157 |
| 195 | 3300013105 | Ga0157369_10158875 | Ga0157369_101588753 | 157 |
| 196 | 3300013105 | Ga0157369_10802110 | Ga0157369_108021102 | 157 |
| 197 | 3300025907 | Ga0207645_10122652 | Ga0207645_101226522 | 157 |
| 198 | 3300025911 | Ga0207654_10075482 | Ga0207654_100754821 | 157 |
| 199 | 3300025917 | Ga0207660_10211996 | Ga0207660_102119961 | 157 |
| 200 | 3300025921 | Ga0207652_10120190 | Ga0207652_101201903 | 157 |
| 201 | 3300025921 | Ga0207652_10758183 | Ga0207652_107581832 | 157 |
| 202 | 3300025923 | Ga0207681_10195828 | Ga0207681_101958282 | 157 |
| 203 | 3300025927 | Ga0207687_10042859 | Ga0207687_100428592 | 157 |
| 204 | 3300025931 | Ga0207644_10073099 | Ga0207644_100730993 | 157 |
| 205 | 3300025932 | Ga0207690_10076892 | Ga0207690_100768923 | 157 |
| 206 | 3300025933 | Ga0207706_10581869 | Ga0207706_105818691 | 157 |
| 207 | 3300025942 | Ga0207689_10046118 | Ga0207689_100461183 | 157 |
| 208 | 3300025945 | Ga0207679_10168553 | Ga0207679_101685531 | 157 |
| 209 | 3300025949 | Ga0207667_10173858 | Ga0207667_101738583 | 157 |
| 210 | 3300025949 | Ga0207667_10203698 | Ga0207667_102036981 | 157 |
| 211 | 3300025972 | Ga0207668_10245353 | Ga0207668_102453532 | 157 |
| 212 | 3300025986 | Ga0207658_10084693 | Ga0207658_100846932 | 157 |
| 213 | 3300026023 | Ga0207677_10102129 | Ga0207677_101021292 | 157 |
| 214 | 3300026035 | Ga0207703_10413620 | Ga0207703_104136202 | 157 |
| 215 | 3300026041 | Ga0207639_10080572 | Ga0207639_100805723 | 157 |
| 216 | 3300026078 | Ga0207702_10051208 | Ga0207702_100512082 | 157 |
| 217 | 3300026088 | Ga0207641_10082654 | Ga0207641_100826542 | 157 |
| 218 | 3300026089 | Ga0207648_10064662 | Ga0207648_100646622 | 157 |
| 219 | 3300026095 | Ga0207676_10143282 | Ga0207676_101432823 | 157 |
| 220 | 3300026116 | Ga0207674_10207845 | Ga0207674_102078453 | 157 |
| 221 | 3300026118 | Ga0207675_100099894 | Ga0207675_1000998942 | 157 |
| 222 | 3300026121 | Ga0207683_10449844 | Ga0207683_104498442 | 157 |
| 223 | 3300026142 | Ga0207698_10429937 | Ga0207698_104299372 | 157 |
| 224 | 3300026142 | Ga0207698_10519180 | Ga0207698_105191801 | 157 |
| 225 | 3300028379 | Ga0268266_10059443 | Ga0268266_100594433 | 157 |
| 226 | 3300031911 | Ga0307412_10119924 | Ga0307412_101199243 | 157 |
| 227 | 3300046557 | Ga0495622_0128150 | Ga0495622_0128150_77_553 | 157 |
| 228 | 3300046689 | Ga0495613_0697923 | Ga0495613_0697923_67_543 | 157 |
| 229 | 3300047317 | Ga0495604_0106527 | Ga0495604_0106527_783_1259 | 157 |
| 230 | 3300048907 | Ga0496104_0258816 | Ga0496104_0258816_927_1400 | 157 |
| 231 | 3300048912 | Ga0496109_0534623 | Ga0496109_0534623_368_841 | 157 |
| 232 | 3300048915 | Ga0496112_0024667 | Ga0496112_0024667_271_744 | 157 |
| 233 | 3300048915 | Ga0496112_0353181 | Ga0496112_0353181_870_1343 | 157 |
| 234 | 3300048916 | Ga0496113_0251620 | Ga0496113_0251620_58_531 | 157 |
| 235 | 3300048925 | Ga0496122_0098738 | Ga0496122_0098738_1222_1698 | 157 |
| 236 | 3300048928 | Ga0496125_0000158 | Ga0496125_0000158_100547_101023 | 157 |
| 237 | 3300048928 | Ga0496125_0001221 | Ga0496125_0001221_8550_9026 | 157 |
| 238 | 3300048929 | Ga0496126_0008848 | Ga0496126_0008848_4464_4940 | 157 |
| 239 | 3300048929 | Ga0496126_0040463 | Ga0496126_0040463_1808_2284 | 157 |
| 240 | 3300050491 | nmdc:mga00v17_164221_c1 | nmdc:mga00v17_164221_c1_127_600 | 157 |
| 241 | 3300050496 | nmdc:mga07m45_319398_c1 | nmdc:mga07m45_319398_c1_167_640 | 157 |
| 242 | 3300053093 | Ga0500651_0037934 | Ga0500651_0037934_1955_2431 | 157 |
| 243 | 3300053094 | Ga0500566_0002015 | Ga0500566_0002015_4663_5139 | 157 |
| 244 | 3300053102 | Ga0500554_078792 | Ga0500554_078792_206_682 | 157 |
| 245 | 3300053122 | Ga0500608_017399 | Ga0500608_017399_52_528 | 157 |
| 246 | 3300053125 | Ga0500618_004224 | Ga0500618_004224_1361_1837 | 157 |
| 247 | 3300053136 | Ga0500559_0000288 | Ga0500559_0000288_5883_6359 | 157 |
| 248 | 3300053142 | Ga0500577_0029354 | Ga0500577_0029354_57_533 | 157 |
| 249 | 3300053148 | Ga0500590_021761 | Ga0500590_021761_2549_3025 | 157 |
| 250 | 3300053177 | Ga0500636_0010810 | Ga0500636_0010810_365_841 | 157 |
| 251 | 3300053178 | Ga0500637_0174779 | Ga0500637_0174779_224_700 | 157 |
| 252 | iso_pu_bacteria | 2728368998 | 2728752430 | 157 |
| 253 | 3300005518 | Ga0070699_101135331 | Ga0070699_1011353311 | 158 |
| 254 | 3300005546 | Ga0070696_101408141 | Ga0070696_1014081411 | 158 |
| 255 | 3300005614 | Ga0068856_100116648 | Ga0068856_1001166482 | 158 |
| 256 | 3300005719 | Ga0068861_101110147 | Ga0068861_1011101471 | 158 |
| 257 | 3300005843 | Ga0068860_100333005 | Ga0068860_1003330052 | 158 |
| 258 | 3300006051 | Ga0075364_10069634 | Ga0075364_100696343 | 158 |
| 259 | 3300006178 | Ga0075367_10847157 | Ga0075367_108471571 | 158 |
| 260 | 3300006186 | Ga0075369_10097985 | Ga0075369_100979851 | 158 |
| 261 | 3300006358 | Ga0068871_100261466 | Ga0068871_1002614662 | 158 |
| 262 | 3300025906 | Ga0207699_10678623 | Ga0207699_106786231 | 158 |
| 263 | 3300028380 | Ga0268265_10050565 | Ga0268265_100505651 | 158 |
| 264 | 3300046491 | Ga0495584_0119964 | Ga0495584_0119964_735_1211 | 158 |
| 265 | 3300048905 | Ga0496102_0183360 | Ga0496102_0183360_1271_1747 | 158 |
| 266 | 3300048909 | Ga0496106_1189453 | Ga0496106_1189453_73_549 | 158 |
| 267 | 3300048924 | Ga0496121_0102338 | Ga0496121_0102338_1649_2125 | 158 |
| 268 | 3300048929 | Ga0496126_1174004 | Ga0496126_1174004_73_549 | 158 |
| 269 | 3300050516 | nmdc:mga0sz30_189158_c1 | nmdc:mga0sz30_189158_c1_374_850 | 158 |
| 270 | 3300005434 | Ga0070709_10629021 | Ga0070709_106290211 | 159 |
| 271 | 3300005455 | Ga0070663_100251085 | Ga0070663_1002510851 | 159 |
| 272 | 3300005539 | Ga0068853_100006767 | Ga0068853_10000676711 | 159 |
| 273 | 3300005563 | Ga0068855_100112947 | Ga0068855_1001129474 | 159 |
| 274 | 3300005577 | Ga0068857_100044284 | Ga0068857_1000442843 | 159 |
| 275 | 3300005578 | Ga0068854_100008629 | Ga0068854_1000086292 | 159 |
| 276 | 3300005578 | Ga0068854_100451514 | Ga0068854_1004515141 | 159 |
| 277 | 3300005614 | Ga0068856_100054109 | Ga0068856_1000541093 | 159 |
| 278 | 3300005616 | Ga0068852_100011735 | Ga0068852_1000117351 | 159 |
| 279 | 3300005834 | Ga0068851_10017739 | Ga0068851_100177392 | 159 |
| 280 | 3300006038 | Ga0075365_10327183 | Ga0075365_103271832 | 159 |
| 281 | 3300006038 | Ga0075365_10795019 | Ga0075365_107950192 | 159 |
| 282 | 3300006048 | Ga0075363_100162596 | Ga0075363_1001625962 | 159 |
| 283 | 3300006871 | Ga0075434_100845158 | Ga0075434_1008451581 | 159 |
| 284 | 3300025321 | Ga0207656_10004387 | Ga0207656_100043875 | 159 |
| 285 | 3300025906 | Ga0207699_10800436 | Ga0207699_108004361 | 159 |
| 286 | 3300025911 | Ga0207654_10001136 | Ga0207654_1000113611 | 159 |
| 287 | 3300025913 | Ga0207695_10004577 | Ga0207695_100045775 | 159 |
| 288 | 3300025924 | Ga0207694_10000263 | Ga0207694_1000026310 | 159 |
| 289 | 3300025949 | Ga0207667_10042856 | Ga0207667_100428563 | 159 |
| 290 | 3300025972 | Ga0207668_11687935 | Ga0207668_116879351 | 159 |
| 291 | 3300025981 | Ga0207640_10175528 | Ga0207640_101755282 | 159 |
| 292 | 3300026041 | Ga0207639_10033069 | Ga0207639_100330692 | 159 |
| 293 | 3300026067 | Ga0207678_10091992 | Ga0207678_100919921 | 159 |
| 294 | 3300026078 | Ga0207702_10000003 | Ga0207702_10000003213 | 159 |
| 295 | 3300026116 | Ga0207674_10042085 | Ga0207674_100420853 | 159 |
| 296 | 3300026142 | Ga0207698_10003760 | Ga0207698_100037606 | 159 |
| 297 | 3300031247 | Ga0265340_10072641 | Ga0265340_100726412 | 159 |
| 298 | 3300031250 | Ga0265331_10244465 | Ga0265331_102444651 | 159 |
| 299 | 3300031548 | Ga0307408_100581111 | Ga0307408_1005811112 | 159 |
| 300 | 3300031731 | Ga0307405_10055884 | Ga0307405_100558842 | 159 |
| 301 | 3300035111 | Ga0373923_0014550 | Ga0373923_0014550_1844_2323 | 159 |
| 302 | 3300035113 | Ga0373936_0013008 | Ga0373936_0013008_1767_2246 | 159 |
| 303 | 3300035116 | Ga0373945_0014721 | Ga0373945_0014721_46_525 | 159 |
| 304 | 3300035118 | Ga0373954_0055775 | Ga0373954_0055775_1138_1617 | 159 |
| 305 | 3300035120 | Ga0373957_0007752 | Ga0373957_0007752_547_1026 | 159 |
| 306 | 3300035170 | Ga0373943_0046688 | Ga0373943_0046688_1171_1650 | 159 |
| 307 | 3300035172 | Ga0373955_0078419 | Ga0373955_0078419_1357_1836 | 159 |
| 308 | 3300035172 | Ga0373955_0309490 | Ga0373955_0309490_256_735 | 159 |
| 309 | 3300035692 | Ga0373935_0051350 | Ga0373935_0051350_2067_2546 | 159 |
| 310 | 3300035692 | Ga0373935_0278633 | Ga0373935_0278633_571_1050 | 159 |
| 311 | 3300035695 | Ga0373927_0046721 | Ga0373927_0046721_1803_2282 | 159 |
| 312 | 3300035695 | Ga0373927_0679097 | Ga0373927_0679097_121_651 | 159 |
| 313 | 3300035725 | Ga0373947_0006111 | Ga0373947_0006111_2685_3164 | 159 |
| 314 | 3300036401 | Ga0373937_0105606 | Ga0373937_0105606_225_704 | 159 |
| 315 | 3300037068 | Ga0373925_0020497 | Ga0373925_0020497_726_1205 | 159 |
| 316 | 3300046454 | Ga0495592_0136373 | Ga0495592_0136373_530_1009 | 159 |
| 317 | 3300046459 | Ga0495629_0560374 | Ga0495629_0560374_128_607 | 159 |
| 318 | 3300046461 | Ga0495641_0222896 | Ga0495641_0222896_59_538 | 159 |
| 319 | 3300046472 | Ga0495580_0034224 | Ga0495580_0034224_2551_3030 | 159 |
| 320 | 3300046473 | Ga0495582_0036609 | Ga0495582_0036609_13_492 | 159 |
| 321 | 3300046475 | Ga0495639_0066929 | Ga0495639_0066929_1062_1541 | 159 |
| 322 | 3300046476 | Ga0495662_0056597 | Ga0495662_0056597_772_1251 | 159 |
| 323 | 3300046477 | Ga0495664_0029722 | Ga0495664_0029722_2533_3012 | 159 |
| 324 | 3300046511 | Ga0495608_0467821 | Ga0495608_0467821_125_655 | 159 |
| 325 | 3300046514 | Ga0495618_0020926 | Ga0495618_0020926_2279_2758 | 159 |
| 326 | 3300046516 | Ga0495628_0886223 | Ga0495628_0886223_52_531 | 159 |
| 327 | 3300046517 | Ga0495630_0039230 | Ga0495630_0039230_958_1437 | 159 |
| 328 | 3300046526 | Ga0495666_0106963 | Ga0495666_0106963_76_606 | 159 |
| 329 | 3300046531 | Ga0495665_0026730 | Ga0495665_0026730_808_1287 | 159 |
| 330 | 3300046543 | Ga0495645_0046942 | Ga0495645_0046942_124_654 | 159 |
| 331 | 3300046559 | Ga0495667_0038450 | Ga0495667_0038450_137_616 | 159 |
| 332 | 3300046642 | Ga0495634_0036766 | Ga0495634_0036766_2017_2496 | 159 |
| 333 | 3300046683 | Ga0495658_0021799 | Ga0495658_0021799_480_959 | 159 |
| 334 | 3300046690 | Ga0495624_0079643 | Ga0495624_0079643_814_1293 | 159 |
| 335 | 3300047319 | Ga0495674_0014414 | Ga0495674_0014414_6837_7316 | 159 |
| 336 | 3300047445 | Ga0495677_0234835 | Ga0495677_0234835_40_519 | 159 |
| 337 | 3300047471 | Ga0495684_0002699 | Ga0495684_0002699_11776_12255 | 159 |
| 338 | 3300047673 | Ga0495593_0011625 | Ga0495593_0011625_3854_4333 | 159 |
| 339 | 3300048904 | Ga0496101_0090423 | Ga0496101_0090423_148_660 | 159 |
| 340 | 3300048907 | Ga0496104_0650923 | Ga0496104_0650923_58_570 | 159 |
| 341 | 3300048913 | Ga0496110_0432748 | Ga0496110_0432748_114_608 | 159 |
| 342 | 3300048915 | Ga0496112_0028860 | Ga0496112_0028860_2583_3095 | 159 |
| 343 | 3300048916 | Ga0496113_0722137 | Ga0496113_0722137_85_597 | 159 |
| 344 | 3300048918 | Ga0496115_0428720 | Ga0496115_0428720_389_871 | 159 |
| 345 | 3300048929 | Ga0496126_0870643 | Ga0496126_0870643_172_651 | 159 |
| 346 | 3300050490 | nmdc:mga03n38_424572_c1 | nmdc:mga03n38_424572_c1_187_666 | 159 |
| 347 | 3300050492 | nmdc:mga0yw44_235804_c1 | nmdc:mga0yw44_235804_c1_403_882 | 159 |
| 348 | 3300050492 | nmdc:mga0yw44_654961_c1 | nmdc:mga0yw44_654961_c1_111_590 | 159 |
| 349 | 3300050494 | nmdc:mga06z11_601556_c1 | nmdc:mga06z11_601556_c1_68_547 | 159 |
| 350 | 3300050512 | nmdc:mga0n895_837372_c1 | nmdc:mga0n895_837372_c1_301_813 | 159 |
| 351 | 3300053077 | Ga0495601_0047533 | Ga0495601_0047533_403_882 | 159 |
| 352 | 3300053078 | Ga0495612_0043952 | Ga0495612_0043952_176_655 | 159 |
| 353 | 3300053094 | Ga0500566_0023225 | Ga0500566_0023225_2165_2644 | 159 |
| 354 | 3300053119 | Ga0500595_000842 | Ga0500595_000842_7014_7493 | 159 |
| 355 | 3300053123 | Ga0500614_125702 | Ga0500614_125702_20_499 | 159 |
| 356 | 3300053162 | Ga0500638_010417 | Ga0500638_010417_1880_2359 | 159 |
| 357 | 3300053178 | Ga0500637_0000251 | Ga0500637_0000251_7038_7517 | 159 |
| 358 | 3300055283 | Ga0500661_004969 | Ga0500661_004969_182_661 | 159 |
| 359 | 3300005330 | Ga0070690_100362053 | Ga0070690_1003620532 | 160 |
| 360 | 3300005336 | Ga0070680_101429010 | Ga0070680_1014290101 | 160 |
| 361 | 3300005347 | Ga0070668_100765446 | Ga0070668_1007654461 | 160 |
| 362 | 3300005353 | Ga0070669_100077905 | Ga0070669_1000779052 | 160 |
| 363 | 3300005356 | Ga0070674_100297958 | Ga0070674_1002979582 | 160 |
| 364 | 3300005364 | Ga0070673_100195432 | Ga0070673_1001954322 | 160 |
| 365 | 3300005364 | Ga0070673_101220536 | Ga0070673_1012205361 | 160 |
| 366 | 3300005365 | Ga0070688_100379400 | Ga0070688_1003794002 | 160 |
| 367 | 3300005367 | Ga0070667_100237719 | Ga0070667_1002377191 | 160 |
| 368 | 3300005434 | Ga0070709_10002338 | Ga0070709_100023385 | 160 |
| 369 | 3300005435 | Ga0070714_100066550 | Ga0070714_1000665501 | 160 |
| 370 | 3300005436 | Ga0070713_100397034 | Ga0070713_1003970343 | 160 |
| 371 | 3300005437 | Ga0070710_10005939 | Ga0070710_100059394 | 160 |
| 372 | 3300005439 | Ga0070711_100051142 | Ga0070711_1000511422 | 160 |
| 373 | 3300005455 | Ga0070663_100303529 | Ga0070663_1003035292 | 160 |
| 374 | 3300005456 | Ga0070678_100238015 | Ga0070678_1002380151 | 160 |
| 375 | 3300005466 | Ga0070685_10278521 | Ga0070685_102785212 | 160 |
| 376 | 3300005539 | Ga0068853_100272578 | Ga0068853_1002725781 | 160 |
| 377 | 3300005544 | Ga0070686_100147014 | Ga0070686_1001470142 | 160 |
| 378 | 3300005548 | Ga0070665_100151870 | Ga0070665_1001518702 | 160 |
| 379 | 3300005615 | Ga0070702_100983130 | Ga0070702_1009831301 | 160 |
| 380 | 3300005616 | Ga0068852_100152915 | Ga0068852_1001529152 | 160 |
| 381 | 3300005719 | Ga0068861_100051542 | Ga0068861_1000515422 | 160 |
| 382 | 3300005843 | Ga0068860_100821145 | Ga0068860_1008211452 | 160 |
| 383 | 3300006028 | Ga0070717_10022827 | Ga0070717_100228271 | 160 |
| 384 | 3300006163 | Ga0070715_10000762 | Ga0070715_100007626 | 160 |
| 385 | 3300006173 | Ga0070716_100038130 | Ga0070716_1000381302 | 160 |
| 386 | 3300006175 | Ga0070712_100306226 | Ga0070712_1003062261 | 160 |
| 387 | 3300009148 | Ga0105243_10074303 | Ga0105243_100743032 | 160 |
| 388 | 3300009553 | Ga0105249_10022931 | Ga0105249_100229313 | 160 |
| 389 | 3300013105 | Ga0157369_10044612 | Ga0157369_100446125 | 160 |
| 390 | 3300014326 | Ga0157380_11474009 | Ga0157380_114740091 | 160 |
| 391 | 3300017792 | Ga0163161_10200638 | Ga0163161_102006382 | 160 |
| 392 | 3300020081 | Ga0206354_11284064 | Ga0206354_112840641 | 160 |
| 393 | 3300022467 | Ga0224712_10087246 | Ga0224712_100872461 | 160 |
| 394 | 3300025898 | Ga0207692_10019957 | Ga0207692_100199572 | 160 |
| 395 | 3300025899 | Ga0207642_10146538 | Ga0207642_101465382 | 160 |
| 396 | 3300025901 | Ga0207688_10560341 | Ga0207688_105603411 | 160 |
| 397 | 3300025903 | Ga0207680_10081903 | Ga0207680_100819032 | 160 |
| 398 | 3300025904 | Ga0207647_10055549 | Ga0207647_100555493 | 160 |
| 399 | 3300025906 | Ga0207699_10003036 | Ga0207699_100030364 | 160 |
| 400 | 3300025915 | Ga0207693_10060842 | Ga0207693_100608422 | 160 |
| 401 | 3300025916 | Ga0207663_10000239 | Ga0207663_1000023920 | 160 |
| 402 | 3300025917 | Ga0207660_10676250 | Ga0207660_106762501 | 160 |
| 403 | 3300025928 | Ga0207700_10005825 | Ga0207700_100058252 | 160 |
| 404 | 3300025929 | Ga0207664_10010462 | Ga0207664_100104622 | 160 |
| 405 | 3300025933 | Ga0207706_10154767 | Ga0207706_101547672 | 160 |
| 406 | 3300025935 | Ga0207709_10537243 | Ga0207709_105372432 | 160 |
| 407 | 3300025939 | Ga0207665_10016227 | Ga0207665_100162275 | 160 |
| 408 | 3300025940 | Ga0207691_10041060 | Ga0207691_100410604 | 160 |
| 409 | 3300025961 | Ga0207712_10210246 | Ga0207712_102102461 | 160 |
| 410 | 3300025972 | Ga0207668_10241608 | Ga0207668_102416082 | 160 |
| 411 | 3300025972 | Ga0207668_11194760 | Ga0207668_111947601 | 160 |
| 412 | 3300025986 | Ga0207658_10345018 | Ga0207658_103450181 | 160 |
| 413 | 3300026041 | Ga0207639_10091060 | Ga0207639_100910603 | 160 |
| 414 | 3300026067 | Ga0207678_10028150 | Ga0207678_100281502 | 160 |
| 415 | 3300026118 | Ga0207675_100123214 | Ga0207675_1001232142 | 160 |
| 416 | 3300026121 | Ga0207683_10021485 | Ga0207683_100214855 | 160 |
| 417 | 3300028379 | Ga0268266_10194248 | Ga0268266_101942483 | 160 |
| 418 | 3300028380 | Ga0268265_10219823 | Ga0268265_102198233 | 160 |
| 419 | 3300028381 | Ga0268264_10910392 | Ga0268264_109103921 | 160 |
| 420 | 3300030522 | Ga0307512_10395848 | Ga0307512_103958481 | 160 |
| 421 | 3300031730 | Ga0307516_10574527 | Ga0307516_105745271 | 160 |
| 422 | 3300035088 | Ga0373940_0256389 | Ga0373940_0256389_73_555 | 160 |
| 423 | 3300044694 | Ga0466963_0113153 | Ga0466963_0113153_976_1458 | 160 |
| 424 | 3300046523 | Ga0495644_0166884 | Ga0495644_0166884_315_797 | 160 |
| 425 | 3300046538 | Ga0495609_0152324 | Ga0495609_0152324_207_734 | 160 |
| 426 | 3300046557 | Ga0495622_0242485 | Ga0495622_0242485_248_775 | 160 |
| 427 | 3300046615 | Ga0495656_0259273 | Ga0495656_0259273_184_666 | 160 |
| 428 | 3300046616 | Ga0495668_0295274 | Ga0495668_0295274_358_840 | 160 |
| 429 | 3300046648 | Ga0495611_0211119 | Ga0495611_0211119_249_731 | 160 |
| 430 | 3300046674 | Ga0495588_0034937 | Ga0495588_0034937_1521_2048 | 160 |
| 431 | 3300046684 | Ga0495669_0005476 | Ga0495669_0005476_3973_4455 | 160 |
| 432 | 3300046691 | Ga0495670_0330455 | Ga0495670_0330455_44_571 | 160 |
| 433 | 3300048904 | Ga0496101_0692758 | Ga0496101_0692758_116_598 | 160 |
| 434 | 3300048906 | Ga0496103_0748045 | Ga0496103_0748045_77_559 | 160 |
| 435 | 3300048910 | Ga0496107_0195274 | Ga0496107_0195274_254_736 | 160 |
| 436 | 3300048913 | Ga0496110_0574511 | Ga0496110_0574511_370_852 | 160 |
| 437 | 3300048918 | Ga0496115_0629897 | Ga0496115_0629897_214_696 | 160 |
| 438 | 3300048929 | Ga0496126_0473306 | Ga0496126_0473306_399_881 | 160 |
| 439 | 3300049578 | Ga0501042_0850839 | Ga0501042_0850839_121_603 | 160 |
| 440 | 3300049592 | Ga0501076_0422936 | Ga0501076_0422936_466_948 | 160 |
| 441 | 3300049742 | Ga0501080_0483392 | Ga0501080_0483392_273_755 | 160 |
| 442 | 3300049824 | Ga0501045_0231447 | Ga0501045_0231447_270_752 | 160 |
| 443 | 3300053177 | Ga0500636_0113825 | Ga0500636_0113825_942_1424 | 160 |
| 444 | 3300060353 | Ga0501082_0353746 | Ga0501082_0353746_715_1197 | 160 |
| 445 | 3300000549 | LJQas_1008496 | LJQas_10084961 | 161 |
| 446 | 3300005293 | Ga0065715_10833558 | Ga0065715_108335581 | 161 |
| 447 | 3300005329 | Ga0070683_101029509 | Ga0070683_1010295091 | 161 |
| 448 | 3300005336 | Ga0070680_100013024 | Ga0070680_1000130245 | 161 |
| 449 | 3300005336 | Ga0070680_100610041 | Ga0070680_1006100411 | 161 |
| 450 | 3300005337 | Ga0070682_100577607 | Ga0070682_1005776072 | 161 |
| 451 | 3300005339 | Ga0070660_100006991 | Ga0070660_1000069913 | 161 |
| 452 | 3300005341 | Ga0070691_10049020 | Ga0070691_100490201 | 161 |
| 453 | 3300005344 | Ga0070661_100039476 | Ga0070661_1000394763 | 161 |
| 454 | 3300005345 | Ga0070692_10829176 | Ga0070692_108291761 | 161 |
| 455 | 3300005355 | Ga0070671_100116477 | Ga0070671_1001164772 | 161 |
| 456 | 3300005356 | Ga0070674_101133613 | Ga0070674_1011336131 | 161 |
| 457 | 3300005437 | Ga0070710_10109550 | Ga0070710_101095503 | 161 |
| 458 | 3300005439 | Ga0070711_100002208 | Ga0070711_1000022089 | 161 |
| 459 | 3300005445 | Ga0070708_100514024 | Ga0070708_1005140242 | 161 |
| 460 | 3300005456 | Ga0070678_100573215 | Ga0070678_1005732151 | 161 |
| 461 | 3300005471 | Ga0070698_100492898 | Ga0070698_1004928982 | 161 |
| 462 | 3300005530 | Ga0070679_100148109 | Ga0070679_1001481093 | 161 |
| 463 | 3300005530 | Ga0070679_100210094 | Ga0070679_1002100943 | 161 |
| 464 | 3300005539 | Ga0068853_100002207 | Ga0068853_10000220712 | 161 |
| 465 | 3300005545 | Ga0070695_101488598 | Ga0070695_1014885981 | 161 |
| 466 | 3300005546 | Ga0070696_101319510 | Ga0070696_1013195101 | 161 |
| 467 | 3300005563 | Ga0068855_100386088 | Ga0068855_1003860882 | 161 |
| 468 | 3300005616 | Ga0068852_100212069 | Ga0068852_1002120692 | 161 |
| 469 | 3300005616 | Ga0068852_100225372 | Ga0068852_1002253722 | 161 |
| 470 | 3300006028 | Ga0070717_10223200 | Ga0070717_102232002 | 161 |
| 471 | 3300006173 | Ga0070716_100190831 | Ga0070716_1001908312 | 161 |
| 472 | 3300006173 | Ga0070716_100595356 | Ga0070716_1005953561 | 161 |
| 473 | 3300006175 | Ga0070712_100033040 | Ga0070712_1000330402 | 161 |
| 474 | 3300006237 | Ga0097621_100130302 | Ga0097621_1001303022 | 161 |
| 475 | 3300006881 | Ga0068865_101184368 | Ga0068865_1011843681 | 161 |
| 476 | 3300007265 | Ga0099794_10039886 | Ga0099794_100398862 | 161 |
| 477 | 3300009093 | Ga0105240_10012128 | Ga0105240_100121289 | 161 |
| 478 | 3300009148 | Ga0105243_11067632 | Ga0105243_110676321 | 161 |
| 479 | 3300009176 | Ga0105242_10252974 | Ga0105242_102529742 | 161 |
| 480 | 3300009545 | Ga0105237_10078243 | Ga0105237_100782432 | 161 |
| 481 | 3300009545 | Ga0105237_10179551 | Ga0105237_101795512 | 161 |
| 482 | 3300009551 | Ga0105238_10040525 | Ga0105238_100405252 | 161 |
| 483 | 3300009551 | Ga0105238_11659595 | Ga0105238_116595951 | 161 |
| 484 | 3300010375 | Ga0105239_10064895 | Ga0105239_100648953 | 161 |
| 485 | 3300013104 | Ga0157370_10109082 | Ga0157370_101090822 | 161 |
| 486 | 3300013105 | Ga0157369_10006388 | Ga0157369_1000638812 | 161 |
| 487 | 3300013297 | Ga0157378_10328789 | Ga0157378_103287892 | 161 |
| 488 | 3300013307 | Ga0157372_10149159 | Ga0157372_101491592 | 161 |
| 489 | 3300013308 | Ga0157375_10045330 | Ga0157375_100453303 | 161 |
| 490 | 3300014326 | Ga0157380_10101682 | Ga0157380_101016822 | 161 |
| 491 | 3300014969 | Ga0157376_10858234 | Ga0157376_108582341 | 161 |
| 492 | 3300017792 | Ga0163161_10316643 | Ga0163161_103166431 | 161 |
| 493 | 3300025261 | Ga0209233_1036920 | Ga0209233_10369201 | 161 |
| 494 | 3300025898 | Ga0207692_10083953 | Ga0207692_100839532 | 161 |
| 495 | 3300025899 | Ga0207642_10260852 | Ga0207642_102608522 | 161 |
| 496 | 3300025906 | Ga0207699_10046371 | Ga0207699_100463712 | 161 |
| 497 | 3300025912 | Ga0207707_10002224 | Ga0207707_1000222412 | 161 |
| 498 | 3300025913 | Ga0207695_10879181 | Ga0207695_108791811 | 161 |
| 499 | 3300025914 | Ga0207671_10250349 | Ga0207671_102503492 | 161 |
| 500 | 3300025915 | Ga0207693_10110049 | Ga0207693_101100491 | 161 |
| 501 | 3300025915 | Ga0207693_10114738 | Ga0207693_101147383 | 161 |
| 502 | 3300025915 | Ga0207693_10132194 | Ga0207693_101321942 | 161 |
| 503 | 3300025916 | Ga0207663_10193366 | Ga0207663_101933661 | 161 |
| 504 | 3300025917 | Ga0207660_10022785 | Ga0207660_100227852 | 161 |
| 505 | 3300025919 | Ga0207657_10005246 | Ga0207657_100052463 | 161 |
| 506 | 3300025921 | Ga0207652_10004348 | Ga0207652_100043483 | 161 |
| 507 | 3300025921 | Ga0207652_10129972 | Ga0207652_101299723 | 161 |
| 508 | 3300025924 | Ga0207694_11232027 | Ga0207694_112320271 | 161 |
| 509 | 3300025928 | Ga0207700_10231565 | Ga0207700_102315652 | 161 |
| 510 | 3300025929 | Ga0207664_10560936 | Ga0207664_105609362 | 161 |
| 511 | 3300025931 | Ga0207644_10532583 | Ga0207644_105325831 | 161 |
| 512 | 3300025931 | Ga0207644_10642325 | Ga0207644_106423251 | 161 |
| 513 | 3300025935 | Ga0207709_10710385 | Ga0207709_107103851 | 161 |
| 514 | 3300025937 | Ga0207669_10221830 | Ga0207669_102218302 | 161 |
| 515 | 3300025938 | Ga0207704_10605344 | Ga0207704_106053441 | 161 |
| 516 | 3300025939 | Ga0207665_10191928 | Ga0207665_101919283 | 161 |
| 517 | 3300025939 | Ga0207665_10648429 | Ga0207665_106484291 | 161 |
| 518 | 3300025939 | Ga0207665_10808577 | Ga0207665_108085771 | 161 |
| 519 | 3300025944 | Ga0207661_10054826 | Ga0207661_100548263 | 161 |
| 520 | 3300025972 | Ga0207668_10632743 | Ga0207668_106327431 | 161 |
| 521 | 3300026023 | Ga0207677_11171544 | Ga0207677_111715441 | 161 |
| 522 | 3300026035 | Ga0207703_10256676 | Ga0207703_102566762 | 161 |
| 523 | 3300026041 | Ga0207639_10173933 | Ga0207639_101739331 | 161 |
| 524 | 3300026067 | Ga0207678_10054613 | Ga0207678_100546132 | 161 |
| 525 | 3300026088 | Ga0207641_11511426 | Ga0207641_115114261 | 161 |
| 526 | 3300026121 | Ga0207683_10338347 | Ga0207683_103383472 | 161 |
| 527 | 3300026142 | Ga0207698_10020150 | Ga0207698_100201503 | 161 |
| 528 | 3300026142 | Ga0207698_10235550 | Ga0207698_102355502 | 161 |
| 529 | 3300027671 | Ga0209588_1005209 | Ga0209588_10052093 | 161 |
| 530 | 3300028573 | Ga0265334_10054880 | Ga0265334_100548802 | 161 |
| 531 | 3300031238 | Ga0265332_10059337 | Ga0265332_100593372 | 161 |
| 532 | 3300031249 | Ga0265339_10005327 | Ga0265339_100053275 | 161 |
| 533 | 3300031249 | Ga0265339_10128751 | Ga0265339_101287512 | 161 |
| 534 | 3300031250 | Ga0265331_10246596 | Ga0265331_102465961 | 161 |
| 535 | 3300031344 | Ga0265316_10318944 | Ga0265316_103189441 | 161 |
| 536 | 3300031730 | Ga0307516_10014441 | Ga0307516_1001444111 | 161 |
| 537 | 3300034957 | Ga0373938_0006155 | Ga0373938_0006155_480_1022 | 161 |
| 538 | 3300035088 | Ga0373940_0121661 | Ga0373940_0121661_214_756 | 161 |
| 539 | 3300035112 | Ga0373932_0210730 | Ga0373932_0210730_112_654 | 161 |
| 540 | 3300035121 | Ga0373960_0124614 | Ga0373960_0124614_153_695 | 161 |
| 541 | 3300035170 | Ga0373943_0040038 | Ga0373943_0040038_1729_2214 | 161 |
| 542 | 3300035171 | Ga0373946_0042460 | Ga0373946_0042460_1072_1557 | 161 |
| 543 | 3300035242 | Ga0373962_0194317 | Ga0373962_0194317_87_629 | 161 |
| 544 | 3300035691 | Ga0373931_0002919 | Ga0373931_0002919_232_774 | 161 |
| 545 | 3300035695 | Ga0373927_0002293 | Ga0373927_0002293_5576_6061 | 161 |
| 546 | 3300035695 | Ga0373927_0271406 | Ga0373927_0271406_476_1018 | 161 |
| 547 | 3300035725 | Ga0373947_0106522 | Ga0373947_0106522_152_637 | 161 |
| 548 | 3300037068 | Ga0373925_0048125 | Ga0373925_0048125_953_1438 | 161 |
| 549 | 3300037068 | Ga0373925_0646131 | Ga0373925_0646131_95_580 | 161 |
| 550 | 3300037068 | Ga0373925_1139995 | Ga0373925_1139995_17_502 | 161 |
| 551 | 3300037471 | Ga0395905_0127901 | Ga0395905_0127901_1434_1919 | 161 |
| 552 | 3300045976 | Ga0466967_0046134 | Ga0466967_0046134_3229_3714 | 161 |
| 553 | 3300046455 | Ga0495603_0003213 | Ga0495603_0003213_4713_5198 | 161 |
| 554 | 3300046472 | Ga0495580_0026362 | Ga0495580_0026362_1639_2124 | 161 |
| 555 | 3300046476 | Ga0495662_0288997 | Ga0495662_0288997_57_587 | 161 |
| 556 | 3300046477 | Ga0495664_0132249 | Ga0495664_0132249_1003_1488 | 161 |
| 557 | 3300046499 | Ga0495594_0077975 | Ga0495594_0077975_1331_1816 | 161 |
| 558 | 3300046543 | Ga0495645_0109425 | Ga0495645_0109425_149_634 | 161 |
| 559 | 3300046615 | Ga0495656_0099871 | Ga0495656_0099871_174_659 | 161 |
| 560 | 3300046674 | Ga0495588_0145361 | Ga0495588_0145361_594_1079 | 161 |
| 561 | 3300046678 | Ga0495599_0180496 | Ga0495599_0180496_544_1029 | 161 |
| 562 | 3300046683 | Ga0495658_0199371 | Ga0495658_0199371_636_1121 | 161 |
| 563 | 3300046684 | Ga0495669_0454636 | Ga0495669_0454636_82_567 | 161 |
| 564 | 3300046689 | Ga0495613_0396526 | Ga0495613_0396526_430_915 | 161 |
| 565 | 3300048903 | Ga0496100_0844703 | Ga0496100_0844703_102_644 | 161 |
| 566 | 3300048905 | Ga0496102_0067840 | Ga0496102_0067840_585_1127 | 161 |
| 567 | 3300048906 | Ga0496103_0064217 | Ga0496103_0064217_400_942 | 161 |
| 568 | 3300048907 | Ga0496104_0020638 | Ga0496104_0020638_3431_3973 | 161 |
| 569 | 3300048908 | Ga0496105_0027529 | Ga0496105_0027529_3489_4031 | 161 |
| 570 | 3300048909 | Ga0496106_0046679 | Ga0496106_0046679_1082_1624 | 161 |
| 571 | 3300048910 | Ga0496107_0022390 | Ga0496107_0022390_1615_2157 | 161 |
| 572 | 3300048911 | Ga0496108_0117890 | Ga0496108_0117890_1314_1856 | 161 |
| 573 | 3300048911 | Ga0496108_0136620 | Ga0496108_0136620_423_908 | 161 |
| 574 | 3300048912 | Ga0496109_0275164 | Ga0496109_0275164_973_1515 | 161 |
| 575 | 3300048914 | Ga0496111_0078867 | Ga0496111_0078867_78_620 | 161 |
| 576 | 3300048914 | Ga0496111_0799896 | Ga0496111_0799896_114_599 | 161 |
| 577 | 3300048915 | Ga0496112_0127489 | Ga0496112_0127489_1938_2480 | 161 |
| 578 | 3300048917 | Ga0496114_0091581 | Ga0496114_0091581_1875_2417 | 161 |
| 579 | 3300048918 | Ga0496115_0123983 | Ga0496115_0123983_1323_1865 | 161 |
| 580 | 3300048918 | Ga0496115_0396721 | Ga0496115_0396721_173_658 | 161 |
| 581 | 3300048925 | Ga0496122_0103679 | Ga0496122_0103679_264_749 | 161 |
| 582 | 3300048929 | Ga0496126_0007041 | Ga0496126_0007041_10441_10926 | 161 |
| 583 | 3300048929 | Ga0496126_0565909 | Ga0496126_0565909_380_865 | 161 |
| 584 | 3300048929 | Ga0496126_0631730 | Ga0496126_0631730_269_754 | 161 |
| 585 | 3300053077 | Ga0495601_0427557 | Ga0495601_0427557_291_776 | 161 |
| 586 | 3300053078 | Ga0495612_0167296 | Ga0495612_0167296_253_738 | 161 |
| 587 | 3300053084 | Ga0495595_0077423 | Ga0495595_0077423_446_931 | 161 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ta7-assembly1.cif.gz_E-2 | crystal structure of human g3bp1-ntf2 in complex with human caprin1-derived solomon motif | 0.7414 | 36 | 77 |
| 4fcm-assembly1.cif.gz_B | crystal structure of the ntf2-like domain of human g3bp1 in complex with a peptide | 0.741 | 36 | 75 |
| 8th1-assembly1.cif.gz_A | crystal structure of the g3bp1 ntf2-like domain bound to the idr1 of sars-cov-2 nucleocapsid protein d3l mutant | 0.737 | 36 | 75 |
| 6ta7-assembly3.cif.gz_C | crystal structure of human g3bp1-ntf2 in complex with human caprin1-derived solomon motif | 0.7368 | 36 | 75 |
| 6ta7-assembly3.cif.gz_D | crystal structure of human g3bp1-ntf2 in complex with human caprin1-derived solomon motif | 0.7355 | 36 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ig0A00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8074 | 35 | 75 | 3.10.450.50 |
| af_Q9VRD6_2_130_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.754 | 35 | 77 | 3.10.450.50 |
| 5fw5A00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7497 | 38 | 75 | 3.10.450.50 |
| 1of5B00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7349 | 35 | 75 | 3.10.450.50 |
| af_A0A5S9MQL1_1_179_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7271 | 36 | 78 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6F8ND94-F1-model_v4 | deleted | 0.9056 | 31 | 161 |
|
| AF-A0A6F8ND94-F1-model_v4 | deleted | 0.8991 | 31 | 161 |
|
| AF-A0A0S6UFL0-F1-model_v4 | DUF992 domain-containing protein | 0.8647 | 22 | 161 |
|
| AF-A0A0D7F5S6-F1-model_v4 | DUF992 domain-containing protein | 0.8644 | 22 | 161 |
|
| AF-A0A1V4I1A6-F1-model_v4 | DUF992 domain-containing protein | 0.8481 | 20 | 161 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar