F466544

General Info

Members Datasets Scaffolds Average Seq Length
586 315 580 133

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10202435|Ga0111539_102024351
Length 146
Sequence MRHRHGLRKLNRTSSHRLAMLRNMTNSLLRHEIIQTTLPKAKELRRVAEPIITLGKAATLANRRLAFNRLRDRAMVVKLFDELGPRYAARNGGYLRILKAGFRKGDNAPMALVELLDRPDAEVGADSGSERRAARNREEPAEQVAG

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2547132512 Azospira oryzae 6a3 Isolate Unclassified
3 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
4 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
5 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
106 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
107 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
188 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
194 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
195 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
196 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
197 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
198 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
203 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
212 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
224 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
225 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
226 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
227 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
228 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
229 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
240 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
248 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
253 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
287 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
288 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
289 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
290 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
294 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
295 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
296 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
305 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
306 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
307 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
308 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
309 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
310 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
311 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
312 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
313 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
314 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
315 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0.17
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.53
Nodule 0
Rhizoplane 1.37
Rhizosphere 88.23
Stem 0
Stem Tuber 0
Unclassified 1.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10897771 3300005327 Bacteria 770
2 Ga0070676_10782145 3300005328 Bacteria 703
3 Ga0070683_100184513 3300005329 Bacteria 1980
4 Ga0070683_100766444 3300005329 Bacteria 924
5 Ga0070670_100041949 3300005331 Bacteria 3932
6 Ga0070670_100397325 3300005331 Bacteria 1217
7 Ga0070677_10318353 3300005333 Bacteria 796
8 Ga0068869_100000239 3300005334 Bacteria 28911
9 Ga0070666_10437128 3300005335 Bacteria 944
10 Ga0070680_100082662 3300005336 Bacteria 2651
11 Ga0070680_100702174 3300005336 Bacteria 870
12 Ga0070682_100048033 3300005337 Bacteria 2656
13 Ga0068868_100103199 3300005338 Bacteria 2309
14 Ga0068868_100197383 3300005338 Bacteria 1676
15 Ga0068868_101039356 3300005338 Bacteria 751
16 Ga0070689_100359815 3300005340 Bacteria 1222
17 Ga0070687_100123981 3300005343 Bacteria 1482
18 Ga0070687_100450898 3300005343 Bacteria 856
19 Ga0070661_100443759 3300005344 Bacteria 1032
20 Ga0070692_10230773 3300005345 Bacteria 1099
21 Ga0070692_10495726 3300005345 Bacteria 791
22 Ga0070692_11310040 3300005345 Bacteria 520
23 Ga0070668_100914534 3300005347 Bacteria 785
24 Ga0070669_100932473 3300005353 Bacteria 743
25 Ga0070675_100318733 3300005354 Bacteria 1373
26 Ga0070675_100517107 3300005354 Bacteria 1077
27 Ga0070671_100307220 3300005355 Bacteria 1351
28 Ga0070671_100482469 3300005355 Bacteria 1065
29 Ga0070674_100105296 3300005356 Bacteria 2062
30 Ga0070674_100261564 3300005356 Bacteria 1363
31 Ga0070673_100118890 3300005364 Bacteria 2201
32 Ga0070673_100719881 3300005364 Bacteria 917
33 Ga0070659_100111138 3300005366 Bacteria 2212
34 Ga0070659_100322280 3300005366 Bacteria 1292
35 Ga0070659_100961346 3300005366 Bacteria 748
36 Ga0070667_100241938 3300005367 Bacteria 1611
37 Ga0070709_11065518 3300005434 Bacteria 645
38 Ga0070714_100346772 3300005435 Bacteria 1394
39 Ga0070713_100670775 3300005436 Bacteria 988
40 Ga0070713_101843916 3300005436 Bacteria 587
41 Ga0070710_10387403 3300005437 Bacteria 934
42 Ga0070701_10482390 3300005438 Bacteria 801
43 Ga0070711_100376169 3300005439 Unclassified 1147
44 Ga0070705_100827879 3300005440 Bacteria 739
45 Ga0070705_100842409 3300005440 Bacteria 733
46 Ga0070705_101686929 3300005440 Bacteria 535
47 Ga0070700_100013966 3300005441 Bacteria 4526
48 Ga0070700_100579275 3300005441 Bacteria 876
49 Ga0070694_100431826 3300005444 Bacteria 1037
50 Ga0070708_100969366 3300005445 Bacteria 798
51 Ga0070678_100032926 3300005456 Bacteria 3593
52 Ga0070678_100217204 3300005456 Bacteria 1587
53 Ga0070681_10029739 3300005458 Bacteria 5484
54 Ga0070681_10120986 3300005458 Bacteria 2553
55 Ga0070681_11193925 3300005458 Bacteria 683
56 Ga0068867_100230339 3300005459 Bacteria 1497
57 Ga0068867_100328275 3300005459 Bacteria 1270
58 Ga0068867_100515036 3300005459 Bacteria 1031
59 Ga0068867_100521484 3300005459 Bacteria 1025
60 Ga0068867_100735731 3300005459 Bacteria 874
61 Ga0068867_101153455 3300005459 Bacteria 710
62 Ga0070707_101050549 3300005468 Bacteria 780
63 Ga0070698_100575864 3300005471 Bacteria 1066
64 Ga0070698_101204345 3300005471 Bacteria 707
65 Ga0070699_100954813 3300005518 Bacteria 786
66 Ga0070699_100998353 3300005518 Bacteria 767
67 Ga0070679_100078071 3300005530 Bacteria 3300
68 Ga0070679_100129529 3300005530 Bacteria 2505
69 Ga0070679_100151965 3300005530 Bacteria 2291
70 Ga0070679_101219524 3300005530 Bacteria 698
71 Ga0070684_100986388 3300005535 Bacteria 790
72 Ga0070697_100106944 3300005536 Bacteria 2328
73 Ga0068853_100131569 3300005539 Bacteria 2240
74 Ga0068853_100173648 3300005539 Bacteria 1951
75 Ga0068853_100461883 3300005539 Bacteria 1195
76 Ga0068853_100811059 3300005539 Bacteria 896
77 Ga0068853_101142045 3300005539 Bacteria 752
78 Ga0070686_101124061 3300005544 Bacteria 650
79 Ga0070696_100953509 3300005546 Bacteria 714
80 Ga0070696_102007097 3300005546 Bacteria 502
81 Ga0070693_100367732 3300005547 Bacteria 988
82 Ga0070693_100837410 3300005547 Bacteria 685
83 Ga0070665_100239175 3300005548 Bacteria 1816
84 Ga0070665_101484214 3300005548 Bacteria 687
85 Ga0070704_100117650 3300005549 Bacteria 2034
86 Ga0070704_100499751 3300005549 Bacteria 1055
87 Ga0068855_100008416 3300005563 Bacteria 12475
88 Ga0068855_100017369 3300005563 Bacteria 8657
89 Ga0068855_100019447 3300005563 Bacteria 8160
90 Ga0068855_101356818 3300005563 Bacteria 734
91 Ga0070664_100593092 3300005564 Bacteria 1027
92 Ga0070664_101289173 3300005564 Bacteria 690
93 Ga0070664_101469755 3300005564 Bacteria 645
94 Ga0068857_101517694 3300005577 Bacteria 653
95 Ga0068854_100562680 3300005578 Bacteria 969
96 Ga0068856_100033727 3300005614 Bacteria 5014
97 Ga0068856_100123081 3300005614 Bacteria 2596
98 Ga0068856_100434983 3300005614 Bacteria 1332
99 Ga0068856_101054662 3300005614 Bacteria 831
100 Ga0070702_100616451 3300005615 Bacteria 816
101 Ga0070702_100946193 3300005615 Bacteria 678
102 Ga0070702_101270173 3300005615 Bacteria 596
103 Ga0068852_100013995 3300005616 Bacteria 6155
104 Ga0068852_100057823 3300005616 Bacteria 3356
105 Ga0068859_100148571 3300005617 Bacteria 2419
106 Ga0068864_100054268 3300005618 Bacteria 3459
107 Ga0068866_10021978 3300005718 Bacteria 2946
108 Ga0068861_100156950 3300005719 Bacteria 1873
109 Ga0068861_100954198 3300005719 Bacteria 816
110 Ga0068861_102591816 3300005719 Bacteria 511
111 Ga0068851_10050452 3300005834 Bacteria 2112
112 Ga0068851_10120112 3300005834 Bacteria 1411
113 Ga0068870_10954823 3300005840 Bacteria 609
114 Ga0068863_100005897 3300005841 Bacteria 12009
115 Ga0068863_102167846 3300005841 Bacteria 566
116 Ga0068858_100009002 3300005842 Bacteria 9549
117 Ga0068858_100027257 3300005842 Bacteria 5309
118 Ga0068858_100083384 3300005842 Bacteria 2972
119 Ga0068858_100832406 3300005842 Bacteria 901
120 Ga0068858_101201272 3300005842 Bacteria 745
121 Ga0068858_101991896 3300005842 Bacteria 574
122 Ga0068858_102409410 3300005842 Bacteria 520
123 Ga0068862_100073979 3300005844 Bacteria 2945
124 Ga0068862_100268762 3300005844 Bacteria 1559
125 Ga0070717_11004923 3300006028 Bacteria 760
126 Ga0075365_10147554 3300006038 Bacteria 1635
127 Ga0075365_10678944 3300006038 Bacteria 728
128 Ga0075368_10002682 3300006042 Bacteria 5858
129 Ga0075363_100016443 3300006048 Bacteria 3654
130 Ga0075363_100150445 3300006048 Bacteria 1314
131 Ga0075364_10403081 3300006051 Bacteria 933
132 Ga0075364_10617633 3300006051 Bacteria 741
133 Ga0075364_11118474 3300006051 Bacteria 535
134 Ga0070715_10224445 3300006163 Bacteria 968
135 Ga0070712_100391971 3300006175 Unclassified 1145
136 Ga0070712_100468283 3300006175 Bacteria 1052
137 Ga0075362_10032262 3300006177 Bacteria 2272
138 Ga0075367_10068609 3300006178 Bacteria 2127
139 Ga0075367_10240455 3300006178 Bacteria 1135
140 Ga0075369_10058580 3300006186 Bacteria 1677
141 Ga0075366_10003900 3300006195 Bacteria 7953
142 Ga0075366_10048007 3300006195 Bacteria 2531
143 Ga0075366_10071039 3300006195 Bacteria 2074
144 Ga0075366_10331180 3300006195 Bacteria 933
145 Ga0097621_100347649 3300006237 Bacteria 1318
146 Ga0075370_10007567 3300006353 Bacteria 5537
147 Ga0068871_100003989 3300006358 Bacteria 10207
148 Ga0068871_100041716 3300006358 Bacteria 3681
149 Ga0068871_100992503 3300006358 Bacteria 782
150 Ga0075428_100051648 3300006844 Bacteria 4508
151 Ga0075428_100884281 3300006844 Bacteria 948
152 Ga0075433_11246386 3300006852 Bacteria 645
153 Ga0075434_100025576 3300006871 Bacteria 5776
154 Ga0075434_100124409 3300006871 Bacteria 2596
155 Ga0075434_100429316 3300006871 Bacteria 1342
156 Ga0075434_100855297 3300006871 Bacteria 925
157 Ga0068865_101025001 3300006881 Bacteria 724
158 Ga0075436_100000862 3300006914 Bacteria 20155
159 Ga0075436_100056376 3300006914 Bacteria 2714
160 Ga0075436_100073902 3300006914 Bacteria 2360
161 Ga0097620_100148573 3300006931 Bacteria 2419
162 Ga0075435_100172209 3300007076 Bacteria 1827
163 Ga0075435_101610583 3300007076 Bacteria 570
164 Ga0099794_10015066 3300007265 Bacteria 3404
165 Ga0099794_10025195 3300007265 Bacteria 2737
166 Ga0099794_10355689 3300007265 Bacteria 762
167 Ga0105251_10462060 3300009011 Bacteria 589
168 Ga0105240_10003296 3300009093 Bacteria 25239
169 Ga0105240_10070801 3300009093 Bacteria 4313
170 Ga0105240_11018909 3300009093 Bacteria 885
171 Ga0105240_11952901 3300009093 Bacteria 610
172 Ga0105240_12043598 3300009093 Bacteria 595
173 Ga0111539_10004777 3300009094 Bacteria 17692
174 Ga0111539_10202435 3300009094 Bacteria 2315
175 Ga0111539_11074802 3300009094 Bacteria 935
176 Ga0105245_10044453 3300009098 Bacteria 3964
177 Ga0105245_10187258 3300009098 Bacteria 1981
178 Ga0105245_10578710 3300009098 Bacteria 1147
179 Ga0105245_11358064 3300009098 Bacteria 760
180 Ga0105247_10440622 3300009101 Bacteria 937
181 Ga0114129_10573939 3300009147 Bacteria 1464
182 Ga0105243_10050853 3300009148 Bacteria 3275
183 Ga0105243_10168466 3300009148 Bacteria 1895
184 Ga0105243_10535911 3300009148 Bacteria 1116
185 Ga0105241_10133559 3300009174 Bacteria 2012
186 Ga0105241_10286930 3300009174 Bacteria 1408
187 Ga0105241_11543553 3300009174 Bacteria 640
188 Ga0105241_12038162 3300009174 Bacteria 566
189 Ga0105242_10006123 3300009176 Bacteria 9271
190 Ga0105242_10081256 3300009176 Bacteria 2710
191 Ga0105242_10249820 3300009176 Bacteria 1598
192 Ga0105242_10941765 3300009176 Bacteria 867
193 Ga0105248_10062805 3300009177 Bacteria 4170
194 Ga0105248_10539955 3300009177 Bacteria 1315
195 Ga0105248_11835285 3300009177 Bacteria 688
196 Ga0105237_10033934 3300009545 Bacteria 5170
197 Ga0105237_10041822 3300009545 Bacteria 4621
198 Ga0105237_10600948 3300009545 Bacteria 1107
199 Ga0105237_11058780 3300009545 Bacteria 818
200 Ga0105237_11090614 3300009545 Bacteria 805
201 Ga0105238_10351942 3300009551 Bacteria 1462
202 Ga0105238_10492404 3300009551 Bacteria 1226
203 Ga0105238_10690610 3300009551 Bacteria 1032
204 Ga0105238_10786215 3300009551 Bacteria 967
205 Ga0105238_11050577 3300009551 Bacteria 836
206 Ga0105249_11801180 3300009553 Bacteria 685
207 Ga0105249_12109979 3300009553 Bacteria 636
208 Ga0105239_10016687 3300010375 Bacteria 8118
209 Ga0105239_10224013 3300010375 Bacteria 2109
210 Ga0105239_11159515 3300010375 Bacteria 890
211 Ga0105239_12319771 3300010375 Bacteria 625
212 Ga0157346_1012824 3300012480 Bacteria 639
213 Ga0157318_1013691 3300012482 Bacteria 643
214 Ga0157316_1064741 3300012510 Bacteria 538
215 Ga0157373_10014959 3300013100 Bacteria 5679
216 Ga0157373_10658576 3300013100 Bacteria 765
217 Ga0157371_10549174 3300013102 Bacteria 856
218 Ga0157371_10921248 3300013102 Bacteria 663
219 Ga0157370_10008784 3300013104 Bacteria 10854
220 Ga0157369_10290349 3300013105 Bacteria 1702
221 Ga0157369_10470448 3300013105 Bacteria 1301
222 Ga0157369_10473252 3300013105 Bacteria 1296
223 Ga0157374_10142688 3300013296 Bacteria 2325
224 Ga0157374_10144200 3300013296 Bacteria 2313
225 Ga0157374_11689795 3300013296 Bacteria 658
226 Ga0157378_10043202 3300013297 Bacteria 4002
227 Ga0157378_10715357 3300013297 Bacteria 1022
228 Ga0157378_11216466 3300013297 Bacteria 793
229 Ga0163162_10113966 3300013306 Bacteria 2802
230 Ga0163162_10621849 3300013306 Bacteria 1205
231 Ga0163162_10841329 3300013306 Bacteria 1033
232 Ga0163162_11162680 3300013306 Bacteria 875
233 Ga0157372_10006865 3300013307 Bacteria 12114
234 Ga0157372_11123795 3300013307 Bacteria 909
235 Ga0157375_10050523 3300013308 Bacteria 4079
236 Ga0163163_11579056 3300014325 Bacteria 717
237 Ga0157380_10619532 3300014326 Bacteria 1074
238 Ga0157380_10710913 3300014326 Bacteria 1011
239 Ga0157380_11705514 3300014326 Bacteria 688
240 Ga0182008_10018284 3300014497 Bacteria 3629
241 Ga0157377_10124346 3300014745 Bacteria 1567
242 Ga0157379_10068146 3300014968 Bacteria 3181
243 Ga0157379_10125264 3300014968 Bacteria 2312
244 Ga0157376_10051732 3300014969 Bacteria 3412
245 Ga0157376_10618976 3300014969 Bacteria 1080
246 Ga0157376_10763873 3300014969 Bacteria 977
247 Ga0163161_10628811 3300017792 Bacteria 888
248 Ga0163161_11512498 3300017792 Bacteria 589
249 Ga0206354_10063477 3300020081 Bacteria 642
250 Ga0213872_10021164 3300021361 Bacteria 2994
251 Ga0213876_10162750 3300021384 Bacteria 1187
252 Ga0207656_10001500 3300025321 Bacteria 7731
253 Ga0207642_10125207 3300025899 Bacteria 1332
254 Ga0207688_10061781 3300025901 Bacteria 2112
255 Ga0207680_10374569 3300025903 Bacteria 1003
256 Ga0207699_10850384 3300025906 Bacteria 672
257 Ga0207645_10693848 3300025907 Bacteria 692
258 Ga0207705_10260813 3300025909 Bacteria 1323
259 Ga0207705_10468452 3300025909 Bacteria 977
260 Ga0207705_10668060 3300025909 Bacteria 808
261 Ga0207654_10324969 3300025911 Bacteria 1053
262 Ga0207654_10562009 3300025911 Bacteria 811
263 Ga0207707_10049882 3300025912 Bacteria 3647
264 Ga0207707_10077125 3300025912 Bacteria 2908
265 Ga0207707_10806939 3300025912 Bacteria 781
266 Ga0207707_11171241 3300025912 Bacteria 623
267 Ga0207695_10009540 3300025913 Bacteria 12001
268 Ga0207695_10529200 3300025913 Bacteria 1060
269 Ga0207671_10017161 3300025914 Bacteria 5593
270 Ga0207671_10520013 3300025914 Bacteria 949
271 Ga0207671_11163078 3300025914 Bacteria 604
272 Ga0207693_10304221 3300025915 Bacteria 1249
273 Ga0207693_10519131 3300025915 Unclassified 929
274 Ga0207663_10056311 3300025916 Bacteria 2471
275 Ga0207663_10662030 3300025916 Unclassified 825
276 Ga0207660_10523218 3300025917 Bacteria 963
277 Ga0207660_11637753 3300025917 Bacteria 518
278 Ga0207662_10202198 3300025918 Bacteria 1286
279 Ga0207662_10320382 3300025918 Bacteria 1035
280 Ga0207649_10463214 3300025920 Bacteria 959
281 Ga0207652_10100647 3300025921 Bacteria 2552
282 Ga0207652_11096441 3300025921 Bacteria 696
283 Ga0207681_10575209 3300025923 Bacteria 929
284 Ga0207694_10015938 3300025924 Bacteria 5672
285 Ga0207694_10428260 3300025924 Bacteria 1103
286 Ga0207694_10438924 3300025924 Bacteria 1089
287 Ga0207694_11540167 3300025924 Bacteria 561
288 Ga0207650_10060557 3300025925 Bacteria 2825
289 Ga0207650_11378094 3300025925 Bacteria 600
290 Ga0207659_10243675 3300025926 Bacteria 1455
291 Ga0207687_10062240 3300025927 Bacteria 2638
292 Ga0207700_10107445 3300025928 Bacteria 2239
293 Ga0207700_11085143 3300025928 Bacteria 716
294 Ga0207664_10527148 3300025929 Bacteria 1059
295 Ga0207644_10274777 3300025931 Bacteria 1351
296 Ga0207644_10986571 3300025931 Bacteria 707
297 Ga0207690_10099810 3300025932 Bacteria 2070
298 Ga0207690_10238835 3300025932 Bacteria 1399
299 Ga0207706_11225902 3300025933 Bacteria 623
300 Ga0207686_10069757 3300025934 Bacteria 2256
301 Ga0207686_10113674 3300025934 Bacteria 1831
302 Ga0207686_10333869 3300025934 Bacteria 1136
303 Ga0207686_11057720 3300025934 Bacteria 660
304 Ga0207709_10451427 3300025935 Bacteria 994
305 Ga0207669_10050079 3300025937 Bacteria 2494
306 Ga0207669_11025655 3300025937 Bacteria 694
307 Ga0207704_10759876 3300025938 Bacteria 807
308 Ga0207704_11394964 3300025938 Bacteria 600
309 Ga0207665_10136638 3300025939 Bacteria 1745
310 Ga0207691_10083916 3300025940 Bacteria 2860
311 Ga0207691_10849583 3300025940 Bacteria 765
312 Ga0207711_10040325 3300025941 Bacteria 3972
313 Ga0207689_10000370 3300025942 Bacteria 42422
314 Ga0207689_10911461 3300025942 Bacteria 742
315 Ga0207661_10841865 3300025944 Bacteria 844
316 Ga0207679_10116237 3300025945 Bacteria 2121
317 Ga0207667_10011637 3300025949 Bacteria 10213
318 Ga0207667_10249444 3300025949 Bacteria 1816
319 Ga0207667_12083654 3300025949 Bacteria 526
320 Ga0207651_10015447 3300025960 Bacteria 4437
321 Ga0207712_10982713 3300025961 Bacteria 748
322 Ga0207640_10591020 3300025981 Bacteria 938
323 Ga0207640_10911403 3300025981 Bacteria 768
324 Ga0207658_10233208 3300025986 Bacteria 1555
325 Ga0207658_10513691 3300025986 Bacteria 1068
326 Ga0207677_10006249 3300026023 Bacteria 6514
327 Ga0207677_10207482 3300026023 Bacteria 1562
328 Ga0207677_10819256 3300026023 Bacteria 834
329 Ga0207703_10069578 3300026035 Bacteria 2903
330 Ga0207703_10489216 3300026035 Bacteria 1154
331 Ga0207703_11271200 3300026035 Bacteria 708
332 Ga0207639_10013232 3300026041 Bacteria 5768
333 Ga0207639_10172407 3300026041 Bacteria 1833
334 Ga0207639_10189767 3300026041 Bacteria 1754
335 Ga0207639_10582061 3300026041 Bacteria 1030
336 Ga0207678_10082772 3300026067 Bacteria 2746
337 Ga0207708_10033659 3300026075 Bacteria 3895
338 Ga0207708_10789366 3300026075 Bacteria 817
339 Ga0207702_10015403 3300026078 Bacteria 6336
340 Ga0207702_10272295 3300026078 Bacteria 1597
341 Ga0207702_10367696 3300026078 Bacteria 1380
342 Ga0207702_11052545 3300026078 Bacteria 807
343 Ga0207702_11589147 3300026078 Bacteria 647
344 Ga0207641_10190858 3300026088 Bacteria 1883
345 Ga0207641_11353290 3300026088 Bacteria 713
346 Ga0207641_11540651 3300026088 Bacteria 666
347 Ga0207648_10090358 3300026089 Bacteria 2676
348 Ga0207648_10283009 3300026089 Bacteria 1483
349 Ga0207648_10325469 3300026089 Bacteria 1382
350 Ga0207648_10870773 3300026089 Bacteria 840
351 Ga0207648_12178312 3300026089 Bacteria 515
352 Ga0207676_10176567 3300026095 Bacteria 1866
353 Ga0207674_10150649 3300026116 Bacteria 2283
354 Ga0207683_10038091 3300026121 Bacteria 4188
355 Ga0207683_10040680 3300026121 Bacteria 4057
356 Ga0207683_10111579 3300026121 Bacteria 2449
357 Ga0207683_10622949 3300026121 Bacteria 999
358 Ga0207698_10053328 3300026142 Bacteria 3104
359 Ga0207698_10478473 3300026142 Bacteria 1207
360 Ga0209969_1000383 3300027360 Bacteria 5901
361 Ga0210000_1016818 3300027462 Bacteria 1106
362 Ga0209999_1001158 3300027543 Bacteria 4500
363 Ga0209588_1009253 3300027671 Bacteria 2940
364 Ga0209588_1157021 3300027671 Bacteria 719
365 Ga0209588_1233763 3300027671 Bacteria 565
366 Ga0209971_1003675 3300027682 Bacteria 3636
367 Ga0209998_10032618 3300027717 Bacteria 1158
368 Ga0209813_10023151 3300027866 Bacteria 1764
369 Ga0209813_10084750 3300027866 Bacteria 1054
370 Ga0209974_10001043 3300027876 Bacteria 9809
371 Ga0207428_10007467 3300027907 Bacteria 9965
372 Ga0207428_10148918 3300027907 Bacteria 1782
373 Ga0207428_11305681 3300027907 Bacteria 503
374 Ga0268266_10118435 3300028379 Bacteria 2354
375 Ga0268266_10149487 3300028379 Bacteria 2104
376 Ga0268266_10199873 3300028379 Bacteria 1829
377 Ga0268265_10084722 3300028380 Bacteria 2513
378 Ga0268265_10233470 3300028380 Bacteria 1618
379 Ga0268264_10083813 3300028381 Bacteria 2731
380 Ga0307511_10000653 3300030521 Bacteria 37038
381 Ga0265332_10048865 3300031238 Bacteria 1819
382 Ga0265328_10000839 3300031239 Bacteria 14245
383 Ga0265328_10021475 3300031239 Bacteria 2463
384 Ga0265328_10114687 3300031239 Bacteria 1002
385 Ga0265328_10134913 3300031239 Bacteria 925
386 Ga0265331_10000050 3300031250 Bacteria 181286
387 Ga0265331_10003466 3300031250 Bacteria 10177
388 Ga0265327_10000109 3300031251 Bacteria 181275
389 Ga0265327_10000161 3300031251 Bacteria 144768
390 Ga0265327_10004575 3300031251 Bacteria 12181
391 Ga0265316_10238687 3300031344 Bacteria 1337
392 Ga0265316_10324601 3300031344 Bacteria 1118
393 Ga0307408_100293848 3300031548 Bacteria 1358
394 Ga0307406_10661368 3300031901 Bacteria 868
395 Ga0307409_101363461 3300031995 Bacteria 735
396 Ga0373958_0063341 3300034819 Bacteria 806
397 Ga0373928_0127448 3300035084 Bacteria 687
398 Ga0373932_0294181 3300035112 Bacteria 604
399 Ga0373939_0327205 3300035114 Bacteria 618
400 Ga0373953_0033407 3300035117 Bacteria 2012
401 Ga0373954_0093041 3300035118 Bacteria 1449
402 Ga0373956_0059357 3300035119 Bacteria 1730
403 Ga0373957_0022817 3300035120 Bacteria 2233
404 Ga0373957_0035427 3300035120 Bacteria 1854
405 Ga0373955_0025822 3300035172 Bacteria 3020
406 Ga0373955_0671310 3300035172 Bacteria 636
407 Ga0373942_0209632 3300035207 Bacteria 649
408 Ga0373962_0229417 3300035242 Bacteria 638
409 Ga0373935_0573763 3300035692 Bacteria 824
410 Ga0373935_1196402 3300035692 Bacteria 566
411 Ga0373927_0173010 3300035695 Bacteria 1416
412 Ga0373933_0013960 3300035724 Bacteria 4457
413 Ga0373933_0211461 3300035724 Bacteria 1243
414 Ga0373933_0880156 3300035724 Bacteria 590
415 Ga0373937_0019465 3300036401 Bacteria 6077
416 Ga0373937_0057553 3300036401 Bacteria 3572
417 Ga0373937_0059217 3300036401 Bacteria 3519
418 Ga0373937_0395335 3300036401 Bacteria 1311
419 Ga0373925_0585040 3300037068 Bacteria 919
420 Ga0395899_0171993 3300037312 Bacteria 1525
421 Ga0395900_0884280 3300037418 Bacteria 817
422 Ga0395905_0013092 3300037471 Bacteria 7964
423 Ga0400483_057151 3300039062 Bacteria 1965
424 Ga0400483_139236 3300039062 Bacteria 1444
425 Ga0400483_186650 3300039062 Bacteria 2969
426 Ga0436365_0854741 3300039437 Bacteria 685
427 Ga0436365_1601346 3300039437 Bacteria 2241
428 Ga0436361_0050017 3300039447 Bacteria 26618
429 Ga0439447_163493 3300041407 Bacteria 513
430 Ga0451789_1187517 3300041443 Bacteria 560
431 Ga0451839_0692740 3300041496 Bacteria 650
432 Ga0451853_0874889 3300041512 Bacteria 781
433 Ga0451577_1007827 3300042876 Bacteria 748
434 Ga0451577_1047828 3300042876 Bacteria 731
435 Ga0453683_0674112 3300044673 Bacteria 677
436 Ga0453684_0353189 3300044712 Bacteria 1657
437 Ga0453684_0846607 3300044712 Bacteria 983
438 Ga0451576_1049256 3300045051 Bacteria 854
439 Ga0495603_0562736 3300046455 Bacteria 653
440 Ga0495629_0319230 3300046459 Bacteria 1062
441 Ga0495608_0103787 3300046511 Bacteria 1831
442 Ga0495628_0006157 3300046516 Bacteria 10491
443 Ga0495630_0110176 3300046517 Bacteria 2085
444 Ga0495642_0434036 3300046528 Bacteria 580
445 Ga0495640_0418098 3300046533 Bacteria 821
446 Ga0495586_0043984 3300046535 Bacteria 2404
447 Ga0495598_0417969 3300046537 Bacteria 526
448 Ga0495621_0196828 3300046539 Bacteria 809
449 Ga0495621_0412732 3300046539 Bacteria 574
450 Ga0495645_0204491 3300046543 Bacteria 1337
451 Ga0495622_0268605 3300046557 Bacteria 748
452 Ga0495667_0023519 3300046559 Bacteria 4151
453 Ga0495656_0795823 3300046615 Bacteria 511
454 Ga0495668_0261270 3300046616 Bacteria 948
455 Ga0495657_0146887 3300046675 Bacteria 1466
456 Ga0495646_0340110 3300046680 Bacteria 788
457 Ga0495647_0516737 3300046681 Bacteria 557
458 Ga0495600_0073469 3300046809 Bacteria 2233
459 Ga0495604_0039043 3300047317 Bacteria 3732
460 Ga0495636_0103288 3300047318 Bacteria 1248
461 Ga0495680_0172127 3300047322 Bacteria 1567
462 Ga0495675_0365813 3300047444 Bacteria 846
463 Ga0495684_0133481 3300047471 Bacteria 1863
464 Ga0496102_0418388 3300048905 Bacteria 1259
465 Ga0496104_0035628 3300048907 Bacteria 4647
466 Ga0496104_0779031 3300048907 Bacteria 863
467 Ga0496104_1106928 3300048907 Bacteria 696
468 Ga0496110_0103024 3300048913 Bacteria 2560
469 Ga0496113_0862544 3300048916 Bacteria 717
470 Ga0496114_0756197 3300048917 Bacteria 849
471 Ga0501031_0011216 3300049568 Bacteria 5841
472 Ga0501032_0003598 3300049569 Bacteria 11803
473 Ga0501032_0012634 3300049569 Bacteria 6025
474 Ga0501033_0001817 3300049570 Bacteria 18639
475 Ga0501033_0004521 3300049570 Bacteria 11131
476 Ga0501033_0029294 3300049570 Bacteria 4137
477 Ga0501034_0003361 3300049571 Bacteria 18264
478 Ga0501034_0184133 3300049571 Bacteria 2052
479 Ga0501036_0002120 3300049572 Bacteria 15493
480 Ga0501036_0010828 3300049572 Bacteria 7534
481 Ga0501036_0159394 3300049572 Bacteria 1903
482 Ga0501037_0001263 3300049573 Bacteria 18639
483 Ga0501037_0169944 3300049573 Bacteria 1550
484 Ga0501037_0431822 3300049573 Bacteria 900
485 Ga0501038_0003243 3300049574 Bacteria 15162
486 Ga0501038_0004836 3300049574 Bacteria 12512
487 Ga0501038_0009205 3300049574 Bacteria 9059
488 Ga0501038_0027558 3300049574 Bacteria 5054
489 Ga0501038_0371341 3300049574 Bacteria 1111
490 Ga0501039_0021126 3300049575 Bacteria 4993
491 Ga0501039_0022190 3300049575 Bacteria 4873
492 Ga0501039_0382628 3300049575 Bacteria 1105
493 Ga0501039_0636386 3300049575 Bacteria 835
494 Ga0501042_0000031 3300049578 Bacteria 46017
495 Ga0501042_0628147 3300049578 Bacteria 781
496 Ga0501043_0000157 3300049579 Bacteria 62190
497 Ga0501043_0012057 3300049579 Bacteria 6758
498 Ga0501043_0012117 3300049579 Bacteria 6741
499 Ga0501046_0002577 3300049580 Bacteria 16965
500 Ga0501046_0078124 3300049580 Bacteria 2561
501 Ga0501046_0321700 3300049580 Bacteria 1127
502 Ga0501046_0575473 3300049580 Bacteria 801
503 Ga0501047_0002207 3300049581 Bacteria 18639
504 Ga0501047_0005455 3300049581 Bacteria 11968
505 Ga0501047_0262852 3300049581 Bacteria 1573
506 Ga0501048_0002716 3300049582 Bacteria 13496
507 Ga0501067_0163311 3300049583 Bacteria 1240
508 Ga0501068_0026149 3300049584 Bacteria 3437
509 Ga0501068_0193725 3300049584 Bacteria 1288
510 Ga0501068_0596027 3300049584 Bacteria 720
511 Ga0501069_0001064 3300049585 Bacteria 13167
512 Ga0501070_0001356 3300049586 Bacteria 21938
513 Ga0501070_1090978 3300049586 Bacteria 616
514 Ga0501073_0000321 3300049589 Bacteria 32033
515 Ga0501073_0172366 3300049589 Bacteria 1498
516 Ga0501074_0000097 3300049590 Bacteria 42311
517 Ga0501075_1048991 3300049591 Unclassified 619
518 Ga0501076_0318868 3300049592 Bacteria 1275
519 Ga0501079_0010889 3300049741 Bacteria 6926
520 Ga0501079_1135656 3300049741 Bacteria 616
521 Ga0501080_0004551 3300049742 Bacteria 12361
522 Ga0501080_0880816 3300049742 Bacteria 781
523 Ga0501035_0000671 3300049822 Bacteria 37548
524 Ga0501035_0022817 3300049822 Bacteria 5747
525 Ga0501035_0031902 3300049822 Bacteria 4797
526 Ga0501035_0157358 3300049822 Bacteria 1969
527 Ga0501035_0433143 3300049822 Bacteria 1090
528 Ga0501044_0000747 3300049823 Bacteria 39287
529 Ga0501044_0029513 3300049823 Bacteria 5782
530 Ga0501044_0164945 3300049823 Bacteria 2190
531 Ga0501044_0167932 3300049823 Bacteria 2167
532 Ga0501044_1384132 3300049823 Bacteria 569
533 Ga0501045_0963725 3300049824 Bacteria 626
534 Ga0501045_1402428 3300049824 Bacteria 507
535 nmdc:mga03683_309215_c1 3300050489 Bacteria 742
536 nmdc:mga03n38_323226_c1 3300050490 Bacteria 834
537 nmdc:mga00v17_24107_c1 3300050491 Bacteria 3525
538 nmdc:mga00v17_372343_c1 3300050491 Bacteria 929
539 nmdc:mga0yw44_424857_c1 3300050492 Bacteria 900
540 nmdc:mga0yw44_7154_c1 3300050492 Bacteria 5465
541 nmdc:mga0k408_122686_c1 3300050493 Bacteria 1540
542 nmdc:mga0k408_14579_c1 3300050493 Bacteria 4335
543 nmdc:mga0k408_24801_c1 3300050493 Bacteria 3393
544 nmdc:mga0k408_712_c1 3300050493 Bacteria 18213
545 nmdc:mga06z11_198107_c1 3300050494 Bacteria 1165
546 nmdc:mga06z11_32248_c1 3300050494 Bacteria 2554
547 nmdc:mga04h51_63514_c1 3300050495 Bacteria 1272
548 nmdc:mga07m45_21342_c1 3300050496 Bacteria 3525
549 nmdc:mga07m45_775818_c1 3300050496 Bacteria 550
550 nmdc:mga07m45_85577_c1 3300050496 Bacteria 1803
551 nmdc:mga05p37_460365_c1 3300050507 Bacteria 1470
552 nmdc:mga0qj67_365204_c1 3300050509 Bacteria 1166
553 nmdc:mga08y16_54336_c1 3300050511 Bacteria 4185
554 nmdc:mga08y16_65090_c1 3300050511 Bacteria 3805
555 nmdc:mga0n895_16127_c1 3300050512 Bacteria 6845
556 nmdc:mga0n895_477872_c1 3300050512 Bacteria 1257
557 nmdc:mga0n895_565922_c1 3300050512 Bacteria 1141
558 nmdc:mga0rr50_108788_c2 3300050513 Bacteria 1442
559 nmdc:mga0rr50_1490777_c1 3300050513 Bacteria 572
560 nmdc:mga08x19_46810_c1 3300050514 Bacteria 2767
561 nmdc:mga08x19_63870_c1 3300050514 Bacteria 2389
562 nmdc:mga08x19_8733_c1 3300050514 Bacteria 6043
563 nmdc:mga0a205_11320_c1 3300050515 Bacteria 8211
564 nmdc:mga0sz30_320539_c1 3300050516 Bacteria 692
565 nmdc:mga0sz30_389495_c1 3300050516 Bacteria 624
566 nmdc:mga0sz30_53980_c2 3300050516 Bacteria 1358
567 Ga0495601_0013569 3300053077 Bacteria 4900
568 Ga0495619_0507115 3300053085 Bacteria 829
569 Ga0500646_0000869 3300053090 Bacteria 8331
570 Ga0500583_0002645 3300053092 Bacteria 5434
571 Ga0500583_0329071 3300053092 Bacteria 743
572 Ga0500651_0262029 3300053093 Bacteria 1002
573 Ga0500651_0515900 3300053093 Bacteria 657
574 Ga0500641_0022818 3300053096 Bacteria 2401
575 Ga0500562_175927 3300053108 Bacteria 581
576 Ga0500594_0039541 3300053118 Bacteria 1283
577 Ga0500642_0181849 3300053130 Bacteria 983
578 Ga0500655_018398 3300053133 Bacteria 1297
579 Ga0500604_0000727 3300053151 Bacteria 9013
580 Ga0500645_154259 3300053730 Bacteria 631

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_1048991 Ga0501075_1048991_11_379 112
2 3300050491 nmdc:mga00v17_24107_c1 nmdc:mga00v17_24107_c1_512_874 115
3 3300050493 nmdc:mga0k408_122686_c1 nmdc:mga0k408_122686_c1_994_1356 115
4 3300050494 nmdc:mga06z11_198107_c1 nmdc:mga06z11_198107_c1_707_1069 115
5 3300005355 Ga0070671_100307220 Ga0070671_1003072202 116
6 3300034819 Ga0373958_0063341 Ga0373958_0063341_398_763 116
7 3300035724 Ga0373933_0880156 Ga0373933_0880156_188_565 116
8 3300006871 Ga0075434_100124409 Ga0075434_1001244092 119
9 3300006914 Ga0075436_100000862 Ga0075436_1000008622 119
10 3300007076 Ga0075435_100172209 Ga0075435_1001722092 119
11 3300009147 Ga0114129_10573939 Ga0114129_105739392 119
12 3300050513 nmdc:mga0rr50_108788_c2 nmdc:mga0rr50_108788_c2_473_907 119
13 3300050514 nmdc:mga08x19_8733_c1 nmdc:mga08x19_8733_c1_2874_3308 119
14 3300005458 Ga0070681_10120986 Ga0070681_101209862 120
15 3300046539 Ga0495621_0196828 Ga0495621_0196828_80_481 122
16 3300005434 Ga0070709_11065518 Ga0070709_110655182 123
17 3300017792 Ga0163161_11512498 Ga0163161_115124981 123
18 3300050496 nmdc:mga07m45_775818_c1 nmdc:mga07m45_775818_c1_45_422 123
19 3300005842 Ga0068858_101991896 Ga0068858_1019918961 124
20 iso_pu_bacteria 2998344455 2998344559 124
21 3300005340 Ga0070689_100359815 Ga0070689_1003598152 125
22 3300005518 Ga0070699_100998353 Ga0070699_1009983531 125
23 3300044673 Ga0453683_0674112 Ga0453683_0674112_163_597 125
24 iso_pu_bacteria 2547132103 2547375495 125
25 iso_pu_bacteria 2843690924 2843691347 125
26 iso_pu_bacteria 2846033681 2846034396 125
27 iso_pu_bacteria 639633007 639788552 125
28 3300005445 Ga0070708_100969366 Ga0070708_1009693661 126
29 3300005471 Ga0070698_101204345 Ga0070698_1012043451 126
30 3300031239 Ga0265328_10114687 Ga0265328_101146872 126
31 3300031251 Ga0265327_10000161 Ga0265327_1000016138 126
32 3300044712 Ga0453684_0353189 Ga0453684_0353189_277_666 126
33 3300046537 Ga0495598_0417969 Ga0495598_0417969_53_433 126
34 iso_pu_bacteria 2547132512 2548846611 126
35 3300005544 Ga0070686_101124061 Ga0070686_1011240611 127
36 3300014326 Ga0157380_11705514 Ga0157380_117055141 127
37 3300026121 Ga0207683_10622949 Ga0207683_106229492 127
38 3300039062 Ga0400483_057151 Ga0400483_057151_54_452 127
39 3300039062 Ga0400483_139236 Ga0400483_139236_461_859 127
40 3300039062 Ga0400483_186650 Ga0400483_186650_51_449 127
41 3300048907 Ga0496104_0779031 Ga0496104_0779031_312_752 127
42 3300048917 Ga0496114_0756197 Ga0496114_0756197_133_573 127
43 3300005719 Ga0068861_100954198 Ga0068861_1009541982 128
44 3300027907 Ga0207428_11305681 Ga0207428_113056811 128
45 3300049574 Ga0501038_0371341 Ga0501038_0371341_87_473 128
46 3300049575 Ga0501039_0636386 Ga0501039_0636386_16_402 128
47 3300049592 Ga0501076_0318868 Ga0501076_0318868_108_494 128
48 3300049741 Ga0501079_1135656 Ga0501079_1135656_200_586 128
49 3300005336 Ga0070680_100082662 Ga0070680_1000826622 129
50 3300005338 Ga0068868_101039356 Ga0068868_1010393561 129
51 3300005345 Ga0070692_11310040 Ga0070692_113100401 129
52 3300005354 Ga0070675_100318733 Ga0070675_1003187331 129
53 3300005366 Ga0070659_100322280 Ga0070659_1003222802 129
54 3300005440 Ga0070705_100842409 Ga0070705_1008424092 129
55 3300005458 Ga0070681_10029739 Ga0070681_100297397 129
56 3300005530 Ga0070679_100129529 Ga0070679_1001295292 129
57 3300005539 Ga0068853_100131569 Ga0068853_1001315692 129
58 3300005539 Ga0068853_100173648 Ga0068853_1001736481 129
59 3300005549 Ga0070704_100499751 Ga0070704_1004997512 129
60 3300005564 Ga0070664_100593092 Ga0070664_1005930922 129
61 3300005564 Ga0070664_101289173 Ga0070664_1012891732 129
62 3300005577 Ga0068857_101517694 Ga0068857_1015176942 129
63 3300005614 Ga0068856_100434983 Ga0068856_1004349831 129
64 3300005615 Ga0070702_100946193 Ga0070702_1009461931 129
65 3300005719 Ga0068861_102591816 Ga0068861_1025918161 129
66 3300005842 Ga0068858_102409410 Ga0068858_1024094101 129
67 3300005844 Ga0068862_100268762 Ga0068862_1002687622 129
68 3300006195 Ga0075366_10003900 Ga0075366_100039002 129
69 3300006237 Ga0097621_100347649 Ga0097621_1003476491 129
70 3300006871 Ga0075434_100855297 Ga0075434_1008552972 129
71 3300009093 Ga0105240_12043598 Ga0105240_120435981 129
72 3300009098 Ga0105245_10578710 Ga0105245_105787101 129
73 3300009174 Ga0105241_10286930 Ga0105241_102869302 129
74 3300009545 Ga0105237_10033934 Ga0105237_100339343 129
75 3300009551 Ga0105238_10351942 Ga0105238_103519422 129
76 3300009551 Ga0105238_11050577 Ga0105238_110505771 129
77 3300009553 Ga0105249_12109979 Ga0105249_121099792 129
78 3300010375 Ga0105239_10016687 Ga0105239_100166872 129
79 3300010375 Ga0105239_10224013 Ga0105239_102240131 129
80 3300013105 Ga0157369_10290349 Ga0157369_102903492 129
81 3300013296 Ga0157374_10142688 Ga0157374_101426883 129
82 3300021361 Ga0213872_10021164 Ga0213872_100211642 129
83 3300025912 Ga0207707_10077125 Ga0207707_100771252 129
84 3300025914 Ga0207671_10520013 Ga0207671_105200132 129
85 3300025917 Ga0207660_10523218 Ga0207660_105232182 129
86 3300025917 Ga0207660_11637753 Ga0207660_116377531 129
87 3300025921 Ga0207652_10100647 Ga0207652_101006472 129
88 3300025924 Ga0207694_11540167 Ga0207694_115401671 129
89 3300025932 Ga0207690_10238835 Ga0207690_102388352 129
90 3300025939 Ga0207665_10136638 Ga0207665_101366382 129
91 3300025940 Ga0207691_10849583 Ga0207691_108495831 129
92 3300025942 Ga0207689_10911461 Ga0207689_109114611 129
93 3300025945 Ga0207679_10116237 Ga0207679_101162371 129
94 3300025961 Ga0207712_10982713 Ga0207712_109827132 129
95 3300025981 Ga0207640_10911403 Ga0207640_109114032 129
96 3300026023 Ga0207677_10819256 Ga0207677_108192562 129
97 3300026035 Ga0207703_11271200 Ga0207703_112712002 129
98 3300026041 Ga0207639_10013232 Ga0207639_100132322 129
99 3300026041 Ga0207639_10189767 Ga0207639_101897671 129
100 3300026078 Ga0207702_10367696 Ga0207702_103676962 129
101 3300026089 Ga0207648_10283009 Ga0207648_102830092 129
102 3300026116 Ga0207674_10150649 Ga0207674_101506492 129
103 3300028380 Ga0268265_10233470 Ga0268265_102334702 129
104 3300031239 Ga0265328_10000839 Ga0265328_1000083915 129
105 3300031239 Ga0265328_10021475 Ga0265328_100214753 129
106 3300031250 Ga0265331_10000050 Ga0265331_10000050114 129
107 3300031250 Ga0265331_10003466 Ga0265331_100034665 129
108 3300031251 Ga0265327_10000109 Ga0265327_10000109111 129
109 3300031251 Ga0265327_10004575 Ga0265327_100045752 129
110 3300031344 Ga0265316_10238687 Ga0265316_102386872 129
111 3300035120 Ga0373957_0022817 Ga0373957_0022817_910_1299 129
112 3300035242 Ga0373962_0229417 Ga0373962_0229417_197_586 129
113 3300035724 Ga0373933_0211461 Ga0373933_0211461_817_1206 129
114 3300036401 Ga0373937_0019465 Ga0373937_0019465_3717_4106 129
115 3300039447 Ga0436361_0050017 Ga0436361_0050017_12389_12784 129
116 3300041512 Ga0451853_0874889 Ga0451853_0874889_146_538 129
117 3300045051 Ga0451576_1049256 Ga0451576_1049256_320_709 129
118 3300048905 Ga0496102_0418388 Ga0496102_0418388_628_1017 129
119 3300048907 Ga0496104_1106928 Ga0496104_1106928_247_636 129
120 3300048913 Ga0496110_0103024 Ga0496110_0103024_1821_2210 129
121 3300048916 Ga0496113_0862544 Ga0496113_0862544_244_633 129
122 3300049823 Ga0501044_1384132 Ga0501044_1384132_80_472 129
123 3300050493 nmdc:mga0k408_712_c1 nmdc:mga0k408_712_c1_10397_10789 129
124 3300050512 nmdc:mga0n895_565922_c1 nmdc:mga0n895_565922_c1_315_704 129
125 3300005345 Ga0070692_10230773 Ga0070692_102307732 130
126 3300005435 Ga0070714_100346772 Ga0070714_1003467722 130
127 3300005436 Ga0070713_101843916 Ga0070713_1018439161 130
128 3300005439 Ga0070711_100376169 Ga0070711_1003761692 130
129 3300005441 Ga0070700_100013966 Ga0070700_1000139663 130
130 3300006038 Ga0075365_10147554 Ga0075365_101475543 130
131 3300006042 Ga0075368_10002682 Ga0075368_100026825 130
132 3300006048 Ga0075363_100016443 Ga0075363_1000164432 130
133 3300006051 Ga0075364_10403081 Ga0075364_104030812 130
134 3300006175 Ga0070712_100391971 Ga0070712_1003919712 130
135 3300006177 Ga0075362_10032262 Ga0075362_100322622 130
136 3300006178 Ga0075367_10068609 Ga0075367_100686092 130
137 3300006186 Ga0075369_10058580 Ga0075369_100585802 130
138 3300006195 Ga0075366_10331180 Ga0075366_103311802 130
139 3300006914 Ga0075436_100073902 Ga0075436_1000739023 130
140 3300009148 Ga0105243_10168466 Ga0105243_101684661 130
141 3300025915 Ga0207693_10519131 Ga0207693_105191311 130
142 3300025916 Ga0207663_10662030 Ga0207663_106620302 130
143 3300025928 Ga0207700_11085143 Ga0207700_110851431 130
144 3300025929 Ga0207664_10527148 Ga0207664_105271482 130
145 3300025938 Ga0207704_10759876 Ga0207704_107598762 130
146 3300026075 Ga0207708_10033659 Ga0207708_100336592 130
147 3300027866 Ga0209813_10084750 Ga0209813_100847501 130
148 3300031239 Ga0265328_10134913 Ga0265328_101349132 130
149 3300035692 Ga0373935_0573763 Ga0373935_0573763_249_641 130
150 3300046459 Ga0495629_0319230 Ga0495629_0319230_602_994 130
151 3300046681 Ga0495647_0516737 Ga0495647_0516737_31_423 130
152 3300049569 Ga0501032_0012634 Ga0501032_0012634_632_1027 130
153 3300049571 Ga0501034_0184133 Ga0501034_0184133_254_649 130
154 3300049574 Ga0501038_0027558 Ga0501038_0027558_407_802 130
155 3300049575 Ga0501039_0021126 Ga0501039_0021126_214_609 130
156 3300049580 Ga0501046_0321700 Ga0501046_0321700_507_902 130
157 3300049580 Ga0501046_0575473 Ga0501046_0575473_233_634 130
158 3300049581 Ga0501047_0005455 Ga0501047_0005455_5284_5685 130
159 3300049583 Ga0501067_0163311 Ga0501067_0163311_616_1017 130
160 3300049585 Ga0501069_0001064 Ga0501069_0001064_8686_9087 130
161 3300049586 Ga0501070_0001356 Ga0501070_0001356_7296_7697 130
162 3300049589 Ga0501073_0000321 Ga0501073_0000321_17505_17906 130
163 3300049589 Ga0501073_0172366 Ga0501073_0172366_266_658 130
164 3300049590 Ga0501074_0000097 Ga0501074_0000097_27652_28053 130
165 3300049741 Ga0501079_0010889 Ga0501079_0010889_3043_3444 130
166 3300049742 Ga0501080_0004551 Ga0501080_0004551_10627_11028 130
167 3300049822 Ga0501035_0157358 Ga0501035_0157358_1173_1568 130
168 3300049822 Ga0501035_0433143 Ga0501035_0433143_456_851 130
169 3300049823 Ga0501044_0164945 Ga0501044_0164945_1599_2000 130
170 3300049824 Ga0501045_0963725 Ga0501045_0963725_34_435 130
171 3300050490 nmdc:mga03n38_323226_c1 nmdc:mga03n38_323226_c1_386_781 130
172 3300050491 nmdc:mga00v17_372343_c1 nmdc:mga00v17_372343_c1_21_416 130
173 3300050492 nmdc:mga0yw44_7154_c1 nmdc:mga0yw44_7154_c1_3483_3878 130
174 3300050493 nmdc:mga0k408_24801_c1 nmdc:mga0k408_24801_c1_2065_2460 130
175 3300050494 nmdc:mga06z11_32248_c1 nmdc:mga06z11_32248_c1_934_1329 130
176 3300050495 nmdc:mga04h51_63514_c1 nmdc:mga04h51_63514_c1_727_1122 130
177 3300050496 nmdc:mga07m45_85577_c1 nmdc:mga07m45_85577_c1_357_752 130
178 3300050516 nmdc:mga0sz30_320539_c1 nmdc:mga0sz30_320539_c1_287_682 130
179 3300053108 Ga0500562_175927 Ga0500562_175927_24_419 130
180 3300053118 Ga0500594_0039541 Ga0500594_0039541_217_612 130
181 3300005329 Ga0070683_100184513 Ga0070683_1001845132 131
182 3300005336 Ga0070680_100702174 Ga0070680_1007021742 131
183 3300005337 Ga0070682_100048033 Ga0070682_1000480333 131
184 3300005468 Ga0070707_101050549 Ga0070707_1010505492 131
185 3300005536 Ga0070697_100106944 Ga0070697_1001069442 131
186 3300005539 Ga0068853_100461883 Ga0068853_1004618831 131
187 3300005546 Ga0070696_102007097 Ga0070696_1020070971 131
188 3300005549 Ga0070704_100117650 Ga0070704_1001176501 131
189 3300005563 Ga0068855_100017369 Ga0068855_1000173695 131
190 3300005563 Ga0068855_101356818 Ga0068855_1013568181 131
191 3300005564 Ga0070664_101469755 Ga0070664_1014697551 131
192 3300005614 Ga0068856_100033727 Ga0068856_1000337271 131
193 3300005614 Ga0068856_100123081 Ga0068856_1001230812 131
194 3300005834 Ga0068851_10120112 Ga0068851_101201122 131
195 3300005842 Ga0068858_100832406 Ga0068858_1008324062 131
196 3300006038 Ga0075365_10678944 Ga0075365_106789442 131
197 3300006048 Ga0075363_100150445 Ga0075363_1001504452 131
198 3300006051 Ga0075364_10617633 Ga0075364_106176332 131
199 3300006163 Ga0070715_10224445 Ga0070715_102244452 131
200 3300006178 Ga0075367_10240455 Ga0075367_102404552 131
201 3300006195 Ga0075366_10048007 Ga0075366_100480072 131
202 3300006852 Ga0075433_11246386 Ga0075433_112463862 131
203 3300006914 Ga0075436_100056376 Ga0075436_1000563762 131
204 3300007265 Ga0099794_10015066 Ga0099794_100150661 131
205 3300007265 Ga0099794_10025195 Ga0099794_100251952 131
206 3300007265 Ga0099794_10355689 Ga0099794_103556892 131
207 3300009093 Ga0105240_10003296 Ga0105240_100032962 131
208 3300009545 Ga0105237_11058780 Ga0105237_110587801 131
209 3300013100 Ga0157373_10658576 Ga0157373_106585762 131
210 3300013105 Ga0157369_10473252 Ga0157369_104732521 131
211 3300014497 Ga0182008_10018284 Ga0182008_100182842 131
212 3300025321 Ga0207656_10001500 Ga0207656_100015001 131
213 3300025911 Ga0207654_10324969 Ga0207654_103249692 131
214 3300025912 Ga0207707_10806939 Ga0207707_108069391 131
215 3300025913 Ga0207695_10009540 Ga0207695_100095402 131
216 3300025924 Ga0207694_10015938 Ga0207694_1001593810 131
217 3300025944 Ga0207661_10841865 Ga0207661_108418651 131
218 3300025949 Ga0207667_10011637 Ga0207667_100116376 131
219 3300026035 Ga0207703_10489216 Ga0207703_104892162 131
220 3300026067 Ga0207678_10082772 Ga0207678_100827723 131
221 3300026078 Ga0207702_10015403 Ga0207702_100154032 131
222 3300026078 Ga0207702_10272295 Ga0207702_102722952 131
223 3300027671 Ga0209588_1009253 Ga0209588_10092535 131
224 3300027671 Ga0209588_1157021 Ga0209588_11570211 131
225 3300027671 Ga0209588_1233763 Ga0209588_12337632 131
226 3300030521 Ga0307511_10000653 Ga0307511_1000065330 131
227 3300031238 Ga0265332_10048865 Ga0265332_100488652 131
228 3300035117 Ga0373953_0033407 Ga0373953_0033407_594_992 131
229 3300035118 Ga0373954_0093041 Ga0373954_0093041_247_645 131
230 3300035119 Ga0373956_0059357 Ga0373956_0059357_463_861 131
231 3300035120 Ga0373957_0035427 Ga0373957_0035427_806_1204 131
232 3300035172 Ga0373955_0025822 Ga0373955_0025822_1694_2092 131
233 3300035172 Ga0373955_0671310 Ga0373955_0671310_41_439 131
234 3300035692 Ga0373935_1196402 Ga0373935_1196402_71_469 131
235 3300035724 Ga0373933_0013960 Ga0373933_0013960_1018_1416 131
236 3300036401 Ga0373937_0059217 Ga0373937_0059217_589_987 131
237 3300036401 Ga0373937_0395335 Ga0373937_0395335_811_1209 131
238 3300044712 Ga0453684_0846607 Ga0453684_0846607_182_580 131
239 3300046511 Ga0495608_0103787 Ga0495608_0103787_1266_1664 131
240 3300046516 Ga0495628_0006157 Ga0495628_0006157_7143_7541 131
241 3300046517 Ga0495630_0110176 Ga0495630_0110176_670_1068 131
242 3300046533 Ga0495640_0418098 Ga0495640_0418098_290_688 131
243 3300046535 Ga0495586_0043984 Ga0495586_0043984_989_1387 131
244 3300046543 Ga0495645_0204491 Ga0495645_0204491_689_1087 131
245 3300046557 Ga0495622_0268605 Ga0495622_0268605_132_530 131
246 3300046559 Ga0495667_0023519 Ga0495667_0023519_1018_1416 131
247 3300046675 Ga0495657_0146887 Ga0495657_0146887_185_583 131
248 3300046680 Ga0495646_0340110 Ga0495646_0340110_95_493 131
249 3300046809 Ga0495600_0073469 Ga0495600_0073469_602_1000 131
250 3300047317 Ga0495604_0039043 Ga0495604_0039043_759_1157 131
251 3300047318 Ga0495636_0103288 Ga0495636_0103288_592_990 131
252 3300047322 Ga0495680_0172127 Ga0495680_0172127_791_1189 131
253 3300047444 Ga0495675_0365813 Ga0495675_0365813_367_765 131
254 3300047471 Ga0495684_0133481 Ga0495684_0133481_746_1144 131
255 3300050492 nmdc:mga0yw44_424857_c1 nmdc:mga0yw44_424857_c1_167_565 131
256 3300050514 nmdc:mga08x19_46810_c1 nmdc:mga08x19_46810_c1_1364_1762 131
257 3300050514 nmdc:mga08x19_63870_c1 nmdc:mga08x19_63870_c1_1857_2255 131
258 3300050516 nmdc:mga0sz30_53980_c2 nmdc:mga0sz30_53980_c2_205_603 131
259 3300053077 Ga0495601_0013569 Ga0495601_0013569_2216_2614 131
260 3300053085 Ga0495619_0507115 Ga0495619_0507115_123_521 131
261 3300053090 Ga0500646_0000869 Ga0500646_0000869_7369_7767 131
262 3300053092 Ga0500583_0002645 Ga0500583_0002645_355_753 131
263 3300053092 Ga0500583_0329071 Ga0500583_0329071_17_415 131
264 3300053093 Ga0500651_0515900 Ga0500651_0515900_33_431 131
265 3300053130 Ga0500642_0181849 Ga0500642_0181849_302_700 131
266 3300053133 Ga0500655_018398 Ga0500655_018398_693_1091 131
267 3300053151 Ga0500604_0000727 Ga0500604_0000727_354_752 131
268 3300053730 Ga0500645_154259 Ga0500645_154259_27_425 131
269 3300005328 Ga0070676_10782145 Ga0070676_107821451 132
270 3300005353 Ga0070669_100932473 Ga0070669_1009324731 132
271 3300005356 Ga0070674_100261564 Ga0070674_1002615642 132
272 3300005364 Ga0070673_100719881 Ga0070673_1007198812 132
273 3300005438 Ga0070701_10482390 Ga0070701_104823901 132
274 3300005441 Ga0070700_100579275 Ga0070700_1005792752 132
275 3300005459 Ga0068867_100328275 Ga0068867_1003282751 132
276 3300005530 Ga0070679_100151965 Ga0070679_1001519652 132
277 3300005546 Ga0070696_100953509 Ga0070696_1009535092 132
278 3300005578 Ga0068854_100562680 Ga0068854_1005626802 132
279 3300005615 Ga0070702_100616451 Ga0070702_1006164511 132
280 3300006844 Ga0075428_100884281 Ga0075428_1008842811 132
281 3300006881 Ga0068865_101025001 Ga0068865_1010250012 132
282 3300009098 Ga0105245_11358064 Ga0105245_113580642 132
283 3300009176 Ga0105242_10941765 Ga0105242_109417651 132
284 3300013100 Ga0157373_10014959 Ga0157373_100149596 132
285 3300013296 Ga0157374_10144200 Ga0157374_101442003 132
286 3300013297 Ga0157378_10715357 Ga0157378_107153572 132
287 3300013307 Ga0157372_11123795 Ga0157372_111237952 132
288 3300014969 Ga0157376_10618976 Ga0157376_106189762 132
289 3300025906 Ga0207699_10850384 Ga0207699_108503842 132
290 3300025920 Ga0207649_10463214 Ga0207649_104632142 132
291 3300025934 Ga0207686_11057720 Ga0207686_110577202 132
292 3300025937 Ga0207669_10050079 Ga0207669_100500792 132
293 3300026089 Ga0207648_10870773 Ga0207648_108707731 132
294 3300026121 Ga0207683_10040680 Ga0207683_100406802 132
295 3300037068 Ga0373925_0585040 Ga0373925_0585040_292_690 132
296 3300046539 Ga0495621_0412732 Ga0495621_0412732_110_511 132
297 3300049568 Ga0501031_0011216 Ga0501031_0011216_3132_3530 132
298 3300049569 Ga0501032_0003598 Ga0501032_0003598_7436_7834 132
299 3300049570 Ga0501033_0001817 Ga0501033_0001817_14236_14634 132
300 3300049570 Ga0501033_0004521 Ga0501033_0004521_6741_7139 132
301 3300049570 Ga0501033_0029294 Ga0501033_0029294_503_901 132
302 3300049571 Ga0501034_0003361 Ga0501034_0003361_14236_14634 132
303 3300049572 Ga0501036_0002120 Ga0501036_0002120_14231_14629 132
304 3300049572 Ga0501036_0010828 Ga0501036_0010828_391_789 132
305 3300049572 Ga0501036_0159394 Ga0501036_0159394_437_835 132
306 3300049573 Ga0501037_0001263 Ga0501037_0001263_4006_4404 132
307 3300049573 Ga0501037_0169944 Ga0501037_0169944_217_615 132
308 3300049573 Ga0501037_0431822 Ga0501037_0431822_226_624 132
309 3300049574 Ga0501038_0003243 Ga0501038_0003243_4006_4404 132
310 3300049574 Ga0501038_0004836 Ga0501038_0004836_3742_4140 132
311 3300049574 Ga0501038_0009205 Ga0501038_0009205_4792_5190 132
312 3300049575 Ga0501039_0022190 Ga0501039_0022190_2743_3141 132
313 3300049575 Ga0501039_0382628 Ga0501039_0382628_192_590 132
314 3300049578 Ga0501042_0000031 Ga0501042_0000031_4294_4692 132
315 3300049579 Ga0501043_0000157 Ga0501043_0000157_57787_58185 132
316 3300049579 Ga0501043_0012057 Ga0501043_0012057_3365_3763 132
317 3300049579 Ga0501043_0012117 Ga0501043_0012117_3231_3629 132
318 3300049580 Ga0501046_0002577 Ga0501046_0002577_14215_14613 132
319 3300049580 Ga0501046_0078124 Ga0501046_0078124_758_1156 132
320 3300049581 Ga0501047_0002207 Ga0501047_0002207_4006_4404 132
321 3300049581 Ga0501047_0262852 Ga0501047_0262852_428_826 132
322 3300049582 Ga0501048_0002716 Ga0501048_0002716_3977_4375 132
323 3300049584 Ga0501068_0026149 Ga0501068_0026149_259_657 132
324 3300049584 Ga0501068_0596027 Ga0501068_0596027_297_695 132
325 3300049586 Ga0501070_1090978 Ga0501070_1090978_191_589 132
326 3300049742 Ga0501080_0880816 Ga0501080_0880816_328_726 132
327 3300049822 Ga0501035_0000671 Ga0501035_0000671_4092_4490 132
328 3300049822 Ga0501035_0022817 Ga0501035_0022817_1652_2050 132
329 3300049822 Ga0501035_0031902 Ga0501035_0031902_2052_2450 132
330 3300049823 Ga0501044_0000747 Ga0501044_0000747_36419_36817 132
331 3300049823 Ga0501044_0029513 Ga0501044_0029513_3719_4117 132
332 3300049823 Ga0501044_0167932 Ga0501044_0167932_818_1216 132
333 3300049824 Ga0501045_1402428 Ga0501045_1402428_22_420 132
334 3300005333 Ga0070677_10318353 Ga0070677_103183531 133
335 3300005334 Ga0068869_100000239 Ga0068869_10000023914 133
336 3300005335 Ga0070666_10437128 Ga0070666_104371281 133
337 3300005338 Ga0068868_100197383 Ga0068868_1001973832 133
338 3300005343 Ga0070687_100123981 Ga0070687_1001239812 133
339 3300005347 Ga0070668_100914534 Ga0070668_1009145341 133
340 3300005355 Ga0070671_100482469 Ga0070671_1004824691 133
341 3300005356 Ga0070674_100105296 Ga0070674_1001052961 133
342 3300005364 Ga0070673_100118890 Ga0070673_1001188901 133
343 3300005367 Ga0070667_100241938 Ga0070667_1002419382 133
344 3300005440 Ga0070705_101686929 Ga0070705_1016869291 133
345 3300005456 Ga0070678_100032926 Ga0070678_1000329262 133
346 3300005459 Ga0068867_100515036 Ga0068867_1005150361 133
347 3300005547 Ga0070693_100837410 Ga0070693_1008374102 133
348 3300005617 Ga0068859_100148571 Ga0068859_1001485711 133
349 3300005618 Ga0068864_100054268 Ga0068864_1000542682 133
350 3300005719 Ga0068861_100156950 Ga0068861_1001569501 133
351 3300005841 Ga0068863_100005897 Ga0068863_1000058976 133
352 3300005842 Ga0068858_100027257 Ga0068858_1000272572 133
353 3300005844 Ga0068862_100073979 Ga0068862_1000739792 133
354 3300006358 Ga0068871_100003989 Ga0068871_10000398917 133
355 3300006931 Ga0097620_100148573 Ga0097620_1001485734 133
356 3300009011 Ga0105251_10462060 Ga0105251_104620601 133
357 3300009093 Ga0105240_10070801 Ga0105240_100708012 133
358 3300009098 Ga0105245_10044453 Ga0105245_100444534 133
359 3300009098 Ga0105245_10187258 Ga0105245_101872583 133
360 3300009148 Ga0105243_10050853 Ga0105243_100508532 133
361 3300009174 Ga0105241_10133559 Ga0105241_101335592 133
362 3300009545 Ga0105237_10041822 Ga0105237_100418225 133
363 3300010375 Ga0105239_12319771 Ga0105239_123197712 133
364 3300013297 Ga0157378_10043202 Ga0157378_100432023 133
365 3300013306 Ga0163162_10841329 Ga0163162_108413292 133
366 3300013308 Ga0157375_10050523 Ga0157375_100505234 133
367 3300014326 Ga0157380_10710913 Ga0157380_107109132 133
368 3300014968 Ga0157379_10125264 Ga0157379_101252642 133
369 3300014969 Ga0157376_10051732 Ga0157376_100517322 133
370 3300025899 Ga0207642_10125207 Ga0207642_101252072 133
371 3300025903 Ga0207680_10374569 Ga0207680_103745692 133
372 3300025914 Ga0207671_10017161 Ga0207671_100171612 133
373 3300025918 Ga0207662_10202198 Ga0207662_102021982 133
374 3300025927 Ga0207687_10062240 Ga0207687_100622402 133
375 3300025934 Ga0207686_10113674 Ga0207686_101136742 133
376 3300025935 Ga0207709_10451427 Ga0207709_104514271 133
377 3300025942 Ga0207689_10000370 Ga0207689_1000037030 133
378 3300025960 Ga0207651_10015447 Ga0207651_100154472 133
379 3300025981 Ga0207640_10591020 Ga0207640_105910202 133
380 3300025986 Ga0207658_10233208 Ga0207658_102332082 133
381 3300026023 Ga0207677_10006249 Ga0207677_100062492 133
382 3300026041 Ga0207639_10172407 Ga0207639_101724071 133
383 3300026088 Ga0207641_10190858 Ga0207641_101908582 133
384 3300026095 Ga0207676_10176567 Ga0207676_101765672 133
385 3300026121 Ga0207683_10038091 Ga0207683_100380912 133
386 3300027717 Ga0209998_10032618 Ga0209998_100326182 133
387 3300028379 Ga0268266_10149487 Ga0268266_101494871 133
388 3300028380 Ga0268265_10084722 Ga0268265_100847222 133
389 3300028381 Ga0268264_10083813 Ga0268264_100838132 133
390 3300035695 Ga0373927_0173010 Ga0373927_0173010_494_895 133
391 3300005331 Ga0070670_100041949 Ga0070670_1000419497 134
392 3300005458 Ga0070681_11193925 Ga0070681_111939251 134
393 3300005459 Ga0068867_101153455 Ga0068867_1011534552 134
394 3300005563 Ga0068855_100008416 Ga0068855_1000084162 134
395 3300009093 Ga0105240_11018909 Ga0105240_110189092 134
396 3300009177 Ga0105248_11835285 Ga0105248_118352852 134
397 3300009553 Ga0105249_11801180 Ga0105249_118011802 134
398 3300013102 Ga0157371_10549174 Ga0157371_105491741 134
399 3300013104 Ga0157370_10008784 Ga0157370_100087846 134
400 3300025907 Ga0207645_10693848 Ga0207645_106938482 134
401 3300025912 Ga0207707_11171241 Ga0207707_111712411 134
402 3300025913 Ga0207695_10529200 Ga0207695_105292002 134
403 3300025925 Ga0207650_10060557 Ga0207650_100605573 134
404 3300025931 Ga0207644_10986571 Ga0207644_109865711 134
405 3300025949 Ga0207667_10249444 Ga0207667_102494443 134
406 3300026089 Ga0207648_12178312 Ga0207648_121783121 134
407 3300027360 Ga0209969_1000383 Ga0209969_10003838 134
408 3300027462 Ga0210000_1016818 Ga0210000_10168182 134
409 3300027543 Ga0209999_1001158 Ga0209999_10011586 134
410 3300027682 Ga0209971_1003675 Ga0209971_10036755 134
411 3300027876 Ga0209974_10001043 Ga0209974_1000104311 134
412 3300031901 Ga0307406_10661368 Ga0307406_106613682 134
413 3300039437 Ga0436365_0854741 Ga0436365_0854741_246_659 134
414 3300049584 Ga0501068_0193725 Ga0501068_0193725_689_1102 134
415 3300005331 Ga0070670_100397325 Ga0070670_1003973251 135
416 3300005338 Ga0068868_100103199 Ga0068868_1001031992 135
417 3300005343 Ga0070687_100450898 Ga0070687_1004508982 135
418 3300005344 Ga0070661_100443759 Ga0070661_1004437591 135
419 3300005345 Ga0070692_10495726 Ga0070692_104957262 135
420 3300005354 Ga0070675_100517107 Ga0070675_1005171072 135
421 3300005366 Ga0070659_100961346 Ga0070659_1009613462 135
422 3300005436 Ga0070713_100670775 Ga0070713_1006707751 135
423 3300005440 Ga0070705_100827879 Ga0070705_1008278792 135
424 3300005444 Ga0070694_100431826 Ga0070694_1004318262 135
425 3300005456 Ga0070678_100217204 Ga0070678_1002172042 135
426 3300005459 Ga0068867_100230339 Ga0068867_1002303392 135
427 3300005459 Ga0068867_100521484 Ga0068867_1005214841 135
428 3300005459 Ga0068867_100735731 Ga0068867_1007357312 135
429 3300005471 Ga0070698_100575864 Ga0070698_1005758641 135
430 3300005518 Ga0070699_100954813 Ga0070699_1009548131 135
431 3300005530 Ga0070679_101219524 Ga0070679_1012195241 135
432 3300005539 Ga0068853_101142045 Ga0068853_1011420451 135
433 3300005547 Ga0070693_100367732 Ga0070693_1003677322 135
434 3300005548 Ga0070665_100239175 Ga0070665_1002391752 135
435 3300005548 Ga0070665_101484214 Ga0070665_1014842142 135
436 3300005615 Ga0070702_101270173 Ga0070702_1012701731 135
437 3300005718 Ga0068866_10021978 Ga0068866_100219784 135
438 3300005840 Ga0068870_10954823 Ga0068870_109548231 135
439 3300005841 Ga0068863_102167846 Ga0068863_1021678461 135
440 3300005842 Ga0068858_100009002 Ga0068858_1000090022 135
441 3300005842 Ga0068858_100083384 Ga0068858_1000833842 135
442 3300005842 Ga0068858_101201272 Ga0068858_1012012722 135
443 3300006028 Ga0070717_11004923 Ga0070717_110049232 135
444 3300006051 Ga0075364_11118474 Ga0075364_111184741 135
445 3300006175 Ga0070712_100468283 Ga0070712_1004682832 135
446 3300006195 Ga0075366_10071039 Ga0075366_100710392 135
447 3300006353 Ga0075370_10007567 Ga0075370_100075678 135
448 3300006358 Ga0068871_100041716 Ga0068871_1000417164 135
449 3300006358 Ga0068871_100992503 Ga0068871_1009925031 135
450 3300006844 Ga0075428_100051648 Ga0075428_1000516485 135
451 3300006871 Ga0075434_100025576 Ga0075434_1000255761 135
452 3300006871 Ga0075434_100429316 Ga0075434_1004293162 135
453 3300007076 Ga0075435_101610583 Ga0075435_1016105831 135
454 3300009093 Ga0105240_11952901 Ga0105240_119529011 135
455 3300009094 Ga0111539_10004777 Ga0111539_100047776 135
456 3300009094 Ga0111539_11074802 Ga0111539_110748022 135
457 3300009101 Ga0105247_10440622 Ga0105247_104406222 135
458 3300009148 Ga0105243_10535911 Ga0105243_105359112 135
459 3300009174 Ga0105241_11543553 Ga0105241_115435532 135
460 3300009174 Ga0105241_12038162 Ga0105241_120381621 135
461 3300009176 Ga0105242_10006123 Ga0105242_100061232 135
462 3300009176 Ga0105242_10081256 Ga0105242_100812563 135
463 3300009176 Ga0105242_10249820 Ga0105242_102498201 135
464 3300009177 Ga0105248_10062805 Ga0105248_100628053 135
465 3300009177 Ga0105248_10539955 Ga0105248_105399552 135
466 3300009545 Ga0105237_10600948 Ga0105237_106009482 135
467 3300009545 Ga0105237_11090614 Ga0105237_110906142 135
468 3300009551 Ga0105238_10492404 Ga0105238_104924042 135
469 3300009551 Ga0105238_10690610 Ga0105238_106906102 135
470 3300009551 Ga0105238_10786215 Ga0105238_107862152 135
471 3300012480 Ga0157346_1012824 Ga0157346_10128242 135
472 3300012482 Ga0157318_1013691 Ga0157318_10136911 135
473 3300012510 Ga0157316_1064741 Ga0157316_10647411 135
474 3300013296 Ga0157374_11689795 Ga0157374_116897951 135
475 3300013297 Ga0157378_11216466 Ga0157378_112164661 135
476 3300013306 Ga0163162_10113966 Ga0163162_101139662 135
477 3300013306 Ga0163162_10621849 Ga0163162_106218492 135
478 3300013306 Ga0163162_11162680 Ga0163162_111626802 135
479 3300014325 Ga0163163_11579056 Ga0163163_115790562 135
480 3300014326 Ga0157380_10619532 Ga0157380_106195322 135
481 3300014745 Ga0157377_10124346 Ga0157377_101243461 135
482 3300014968 Ga0157379_10068146 Ga0157379_100681463 135
483 3300014969 Ga0157376_10763873 Ga0157376_107638732 135
484 3300017792 Ga0163161_10628811 Ga0163161_106288112 135
485 3300021384 Ga0213876_10162750 Ga0213876_101627502 135
486 3300025901 Ga0207688_10061781 Ga0207688_100617813 135
487 3300025909 Ga0207705_10668060 Ga0207705_106680602 135
488 3300025911 Ga0207654_10562009 Ga0207654_105620091 135
489 3300025912 Ga0207707_10049882 Ga0207707_100498822 135
490 3300025914 Ga0207671_11163078 Ga0207671_111630781 135
491 3300025915 Ga0207693_10304221 Ga0207693_103042212 135
492 3300025916 Ga0207663_10056311 Ga0207663_100563112 135
493 3300025918 Ga0207662_10320382 Ga0207662_103203822 135
494 3300025921 Ga0207652_11096441 Ga0207652_110964411 135
495 3300025923 Ga0207681_10575209 Ga0207681_105752091 135
496 3300025924 Ga0207694_10428260 Ga0207694_104282602 135
497 3300025924 Ga0207694_10438924 Ga0207694_104389242 135
498 3300025925 Ga0207650_11378094 Ga0207650_113780941 135
499 3300025926 Ga0207659_10243675 Ga0207659_102436753 135
500 3300025928 Ga0207700_10107445 Ga0207700_101074452 135
501 3300025931 Ga0207644_10274777 Ga0207644_102747772 135
502 3300025933 Ga0207706_11225902 Ga0207706_112259022 135
503 3300025934 Ga0207686_10069757 Ga0207686_100697572 135
504 3300025934 Ga0207686_10333869 Ga0207686_103338692 135
505 3300025937 Ga0207669_11025655 Ga0207669_110256551 135
506 3300025938 Ga0207704_11394964 Ga0207704_113949642 135
507 3300025940 Ga0207691_10083916 Ga0207691_100839162 135
508 3300025941 Ga0207711_10040325 Ga0207711_100403253 135
509 3300025986 Ga0207658_10513691 Ga0207658_105136911 135
510 3300026023 Ga0207677_10207482 Ga0207677_102074822 135
511 3300026035 Ga0207703_10069578 Ga0207703_100695781 135
512 3300026075 Ga0207708_10789366 Ga0207708_107893662 135
513 3300026078 Ga0207702_11589147 Ga0207702_115891471 135
514 3300026088 Ga0207641_11353290 Ga0207641_113532902 135
515 3300026088 Ga0207641_11540651 Ga0207641_115406511 135
516 3300026089 Ga0207648_10090358 Ga0207648_100903583 135
517 3300026089 Ga0207648_10325469 Ga0207648_103254692 135
518 3300026121 Ga0207683_10111579 Ga0207683_101115792 135
519 3300027866 Ga0209813_10023151 Ga0209813_100231512 135
520 3300027907 Ga0207428_10007467 Ga0207428_100074672 135
521 3300028379 Ga0268266_10118435 Ga0268266_101184353 135
522 3300028379 Ga0268266_10199873 Ga0268266_101998731 135
523 3300031344 Ga0265316_10324601 Ga0265316_103246012 135
524 3300031548 Ga0307408_100293848 Ga0307408_1002938482 135
525 3300031995 Ga0307409_101363461 Ga0307409_1013634612 135
526 3300035084 Ga0373928_0127448 Ga0373928_0127448_237_644 135
527 3300035112 Ga0373932_0294181 Ga0373932_0294181_37_444 135
528 3300035114 Ga0373939_0327205 Ga0373939_0327205_74_496 135
529 3300035207 Ga0373942_0209632 Ga0373942_0209632_207_614 135
530 3300036401 Ga0373937_0057553 Ga0373937_0057553_599_1006 135
531 3300039437 Ga0436365_1601346 Ga0436365_1601346_799_1206 135
532 3300041407 Ga0439447_163493 Ga0439447_163493_50_457 135
533 3300041443 Ga0451789_1187517 Ga0451789_1187517_133_540 135
534 3300041496 Ga0451839_0692740 Ga0451839_0692740_58_492 135
535 3300042876 Ga0451577_1047828 Ga0451577_1047828_63_470 135
536 3300046455 Ga0495603_0562736 Ga0495603_0562736_121_528 135
537 3300046528 Ga0495642_0434036 Ga0495642_0434036_60_467 135
538 3300046615 Ga0495656_0795823 Ga0495656_0795823_20_448 135
539 3300046616 Ga0495668_0261270 Ga0495668_0261270_404_826 135
540 3300048907 Ga0496104_0035628 Ga0496104_0035628_1553_1960 135
541 3300049578 Ga0501042_0628147 Ga0501042_0628147_271_708 135
542 3300050489 nmdc:mga03683_309215_c1 nmdc:mga03683_309215_c1_145_573 135
543 3300050493 nmdc:mga0k408_14579_c1 nmdc:mga0k408_14579_c1_2828_3235 135
544 3300050496 nmdc:mga07m45_21342_c1 nmdc:mga07m45_21342_c1_81_488 135
545 3300050507 nmdc:mga05p37_460365_c1 nmdc:mga05p37_460365_c1_839_1246 135
546 3300050509 nmdc:mga0qj67_365204_c1 nmdc:mga0qj67_365204_c1_220_627 135
547 3300050511 nmdc:mga08y16_54336_c1 nmdc:mga08y16_54336_c1_2337_2744 135
548 3300050512 nmdc:mga0n895_16127_c1 nmdc:mga0n895_16127_c1_174_608 135
549 3300050512 nmdc:mga0n895_477872_c1 nmdc:mga0n895_477872_c1_521_928 135
550 3300050513 nmdc:mga0rr50_1490777_c1 nmdc:mga0rr50_1490777_c1_14_448 135
551 3300050515 nmdc:mga0a205_11320_c1 nmdc:mga0a205_11320_c1_3332_3739 135
552 3300050516 nmdc:mga0sz30_389495_c1 nmdc:mga0sz30_389495_c1_43_465 135
553 3300053093 Ga0500651_0262029 Ga0500651_0262029_509_931 135
554 3300053096 Ga0500641_0022818 Ga0500641_0022818_1102_1530 135
555 3300005327 Ga0070658_10897771 Ga0070658_108977711 136
556 3300005329 Ga0070683_100766444 Ga0070683_1007664442 136
557 3300005366 Ga0070659_100111138 Ga0070659_1001111382 136
558 3300005437 Ga0070710_10387403 Ga0070710_103874032 136
559 3300005530 Ga0070679_100078071 Ga0070679_1000780712 136
560 3300005535 Ga0070684_100986388 Ga0070684_1009863882 136
561 3300005539 Ga0068853_100811059 Ga0068853_1008110592 136
562 3300005563 Ga0068855_100019447 Ga0068855_1000194478 136
563 3300005614 Ga0068856_101054662 Ga0068856_1010546621 136
564 3300005616 Ga0068852_100013995 Ga0068852_1000139953 136
565 3300005616 Ga0068852_100057823 Ga0068852_1000578232 136
566 3300005834 Ga0068851_10050452 Ga0068851_100504522 136
567 3300009094 Ga0111539_10202435 Ga0111539_102024351 136
568 3300010375 Ga0105239_11159515 Ga0105239_111595152 136
569 3300013102 Ga0157371_10921248 Ga0157371_109212481 136
570 3300013105 Ga0157369_10470448 Ga0157369_104704482 136
571 3300013307 Ga0157372_10006865 Ga0157372_100068652 136
572 3300020081 Ga0206354_10063477 Ga0206354_100634772 136
573 3300025909 Ga0207705_10260813 Ga0207705_102608132 136
574 3300025909 Ga0207705_10468452 Ga0207705_104684522 136
575 3300025932 Ga0207690_10099810 Ga0207690_100998102 136
576 3300025949 Ga0207667_12083654 Ga0207667_120836541 136
577 3300026041 Ga0207639_10582061 Ga0207639_105820612 136
578 3300026078 Ga0207702_11052545 Ga0207702_110525452 136
579 3300026142 Ga0207698_10053328 Ga0207698_100533283 136
580 3300026142 Ga0207698_10478473 Ga0207698_104784732 136
581 3300027907 Ga0207428_10148918 Ga0207428_101489183 136
582 3300037312 Ga0395899_0171993 Ga0395899_0171993_1085_1495 136
583 3300037418 Ga0395900_0884280 Ga0395900_0884280_268_678 136
584 3300037471 Ga0395905_0013092 Ga0395905_0013092_6168_6578 136
585 3300042876 Ga0451577_1007827 Ga0451577_1007827_164_601 136
586 3300050511 nmdc:mga08y16_65090_c1 nmdc:mga08y16_65090_c1_1370_1810 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01196

Ribosomal_L17

Ribosomal protein L17

20

116

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sfr-assembly1.cif.gz_N unmethylated mtb ribosome 50s with seq-9 0.973 14 116
5xym-assembly1.cif.gz_N large subunit of mycobacterium smegmatis 0.9681 13 116
4v4p-assembly1.cif.gz_A0 crystal structure of 70s ribosome with thrs operator and trnas. 0.9502 14 117
4v4p-assembly1.cif.gz_A0 crystal structure of 70s ribosome with thrs operator and trnas. 0.933 14 117
8cvm-assembly1.cif.gz_m cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9319 10 116
ID Description Score Start End Superfamily
1vt2N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9679 14 115 3.90.1030.10
5v7qN00 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9637 13 116 3.90.1030.10
1vs8N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9623 14 115 3.90.1030.10
1vt2N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9498 14 115 3.90.1030.10
1vs8N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9443 14 115 3.90.1030.10
ID Description Score Start End GO Terms
AF-A0A3A4VDG7-F1-model_v4 50S ribosomal protein L17 0.9828 22 116 GO:0003735
GO:0006412
GO:0022625
AF-A0A1F9ENG3-F1-model_v4 50S ribosomal protein L17 0.9828 20 114 GO:0003735
GO:0006412
GO:0022625
AF-A0A2E2TK58-F1-model_v4 50S ribosomal protein L17 0.9823 23 118 GO:0003735
GO:0006412
GO:0022625
AF-A0A5Q4FRT6-F1-model_v4 Large ribosomal subunit protein bL17 0.9806 14 116 GO:0003735
GO:0006412
GO:0022625
AF-A0A6J5Z5J0-F1-model_v4 Unannotated protein 0.98 14 116 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
84.27 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map