F466544
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 586 | 315 | 580 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10202435|Ga0111539_102024351 |
| Length | 146 |
| Sequence | MRHRHGLRKLNRTSSHRLAMLRNMTNSLLRHEIIQTTLPKAKELRRVAEPIITLGKAATLANRRLAFNRLRDRAMVVKLFDELGPRYAARNGGYLRILKAGFRKGDNAPMALVELLDRPDAEVGADSGSERRAARNREEPAEQVAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 2 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 3 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 4 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 5 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 106 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 107 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 194 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 196 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 198 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 204 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 206 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 215 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 221 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 224 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 225 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 227 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 228 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 229 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 230 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 231 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 232 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 260 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 261 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 288 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 289 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 290 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 291 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 292 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 294 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 295 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 303 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 306 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 307 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 308 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 309 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 310 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 311 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 312 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 313 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 314 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 315 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.81 |
| Metatranscriptomes | 0.17 |
| Isolates | 1.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.53 |
| Nodule | 0 |
| Rhizoplane | 1.37 |
| Rhizosphere | 88.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10897771 | 3300005327 | Bacteria | 770 |
| 2 | Ga0070676_10782145 | 3300005328 | Bacteria | 703 |
| 3 | Ga0070683_100184513 | 3300005329 | Bacteria | 1980 |
| 4 | Ga0070683_100766444 | 3300005329 | Bacteria | 924 |
| 5 | Ga0070670_100041949 | 3300005331 | Bacteria | 3932 |
| 6 | Ga0070670_100397325 | 3300005331 | Bacteria | 1217 |
| 7 | Ga0070677_10318353 | 3300005333 | Bacteria | 796 |
| 8 | Ga0068869_100000239 | 3300005334 | Bacteria | 28911 |
| 9 | Ga0070666_10437128 | 3300005335 | Bacteria | 944 |
| 10 | Ga0070680_100082662 | 3300005336 | Bacteria | 2651 |
| 11 | Ga0070680_100702174 | 3300005336 | Bacteria | 870 |
| 12 | Ga0070682_100048033 | 3300005337 | Bacteria | 2656 |
| 13 | Ga0068868_100103199 | 3300005338 | Bacteria | 2309 |
| 14 | Ga0068868_100197383 | 3300005338 | Bacteria | 1676 |
| 15 | Ga0068868_101039356 | 3300005338 | Bacteria | 751 |
| 16 | Ga0070689_100359815 | 3300005340 | Bacteria | 1222 |
| 17 | Ga0070687_100123981 | 3300005343 | Bacteria | 1482 |
| 18 | Ga0070687_100450898 | 3300005343 | Bacteria | 856 |
| 19 | Ga0070661_100443759 | 3300005344 | Bacteria | 1032 |
| 20 | Ga0070692_10230773 | 3300005345 | Bacteria | 1099 |
| 21 | Ga0070692_10495726 | 3300005345 | Bacteria | 791 |
| 22 | Ga0070692_11310040 | 3300005345 | Bacteria | 520 |
| 23 | Ga0070668_100914534 | 3300005347 | Bacteria | 785 |
| 24 | Ga0070669_100932473 | 3300005353 | Bacteria | 743 |
| 25 | Ga0070675_100318733 | 3300005354 | Bacteria | 1373 |
| 26 | Ga0070675_100517107 | 3300005354 | Bacteria | 1077 |
| 27 | Ga0070671_100307220 | 3300005355 | Bacteria | 1351 |
| 28 | Ga0070671_100482469 | 3300005355 | Bacteria | 1065 |
| 29 | Ga0070674_100105296 | 3300005356 | Bacteria | 2062 |
| 30 | Ga0070674_100261564 | 3300005356 | Bacteria | 1363 |
| 31 | Ga0070673_100118890 | 3300005364 | Bacteria | 2201 |
| 32 | Ga0070673_100719881 | 3300005364 | Bacteria | 917 |
| 33 | Ga0070659_100111138 | 3300005366 | Bacteria | 2212 |
| 34 | Ga0070659_100322280 | 3300005366 | Bacteria | 1292 |
| 35 | Ga0070659_100961346 | 3300005366 | Bacteria | 748 |
| 36 | Ga0070667_100241938 | 3300005367 | Bacteria | 1611 |
| 37 | Ga0070709_11065518 | 3300005434 | Bacteria | 645 |
| 38 | Ga0070714_100346772 | 3300005435 | Bacteria | 1394 |
| 39 | Ga0070713_100670775 | 3300005436 | Bacteria | 988 |
| 40 | Ga0070713_101843916 | 3300005436 | Bacteria | 587 |
| 41 | Ga0070710_10387403 | 3300005437 | Bacteria | 934 |
| 42 | Ga0070701_10482390 | 3300005438 | Bacteria | 801 |
| 43 | Ga0070711_100376169 | 3300005439 | Unclassified | 1147 |
| 44 | Ga0070705_100827879 | 3300005440 | Bacteria | 739 |
| 45 | Ga0070705_100842409 | 3300005440 | Bacteria | 733 |
| 46 | Ga0070705_101686929 | 3300005440 | Bacteria | 535 |
| 47 | Ga0070700_100013966 | 3300005441 | Bacteria | 4526 |
| 48 | Ga0070700_100579275 | 3300005441 | Bacteria | 876 |
| 49 | Ga0070694_100431826 | 3300005444 | Bacteria | 1037 |
| 50 | Ga0070708_100969366 | 3300005445 | Bacteria | 798 |
| 51 | Ga0070678_100032926 | 3300005456 | Bacteria | 3593 |
| 52 | Ga0070678_100217204 | 3300005456 | Bacteria | 1587 |
| 53 | Ga0070681_10029739 | 3300005458 | Bacteria | 5484 |
| 54 | Ga0070681_10120986 | 3300005458 | Bacteria | 2553 |
| 55 | Ga0070681_11193925 | 3300005458 | Bacteria | 683 |
| 56 | Ga0068867_100230339 | 3300005459 | Bacteria | 1497 |
| 57 | Ga0068867_100328275 | 3300005459 | Bacteria | 1270 |
| 58 | Ga0068867_100515036 | 3300005459 | Bacteria | 1031 |
| 59 | Ga0068867_100521484 | 3300005459 | Bacteria | 1025 |
| 60 | Ga0068867_100735731 | 3300005459 | Bacteria | 874 |
| 61 | Ga0068867_101153455 | 3300005459 | Bacteria | 710 |
| 62 | Ga0070707_101050549 | 3300005468 | Bacteria | 780 |
| 63 | Ga0070698_100575864 | 3300005471 | Bacteria | 1066 |
| 64 | Ga0070698_101204345 | 3300005471 | Bacteria | 707 |
| 65 | Ga0070699_100954813 | 3300005518 | Bacteria | 786 |
| 66 | Ga0070699_100998353 | 3300005518 | Bacteria | 767 |
| 67 | Ga0070679_100078071 | 3300005530 | Bacteria | 3300 |
| 68 | Ga0070679_100129529 | 3300005530 | Bacteria | 2505 |
| 69 | Ga0070679_100151965 | 3300005530 | Bacteria | 2291 |
| 70 | Ga0070679_101219524 | 3300005530 | Bacteria | 698 |
| 71 | Ga0070684_100986388 | 3300005535 | Bacteria | 790 |
| 72 | Ga0070697_100106944 | 3300005536 | Bacteria | 2328 |
| 73 | Ga0068853_100131569 | 3300005539 | Bacteria | 2240 |
| 74 | Ga0068853_100173648 | 3300005539 | Bacteria | 1951 |
| 75 | Ga0068853_100461883 | 3300005539 | Bacteria | 1195 |
| 76 | Ga0068853_100811059 | 3300005539 | Bacteria | 896 |
| 77 | Ga0068853_101142045 | 3300005539 | Bacteria | 752 |
| 78 | Ga0070686_101124061 | 3300005544 | Bacteria | 650 |
| 79 | Ga0070696_100953509 | 3300005546 | Bacteria | 714 |
| 80 | Ga0070696_102007097 | 3300005546 | Bacteria | 502 |
| 81 | Ga0070693_100367732 | 3300005547 | Bacteria | 988 |
| 82 | Ga0070693_100837410 | 3300005547 | Bacteria | 685 |
| 83 | Ga0070665_100239175 | 3300005548 | Bacteria | 1816 |
| 84 | Ga0070665_101484214 | 3300005548 | Bacteria | 687 |
| 85 | Ga0070704_100117650 | 3300005549 | Bacteria | 2034 |
| 86 | Ga0070704_100499751 | 3300005549 | Bacteria | 1055 |
| 87 | Ga0068855_100008416 | 3300005563 | Bacteria | 12475 |
| 88 | Ga0068855_100017369 | 3300005563 | Bacteria | 8657 |
| 89 | Ga0068855_100019447 | 3300005563 | Bacteria | 8160 |
| 90 | Ga0068855_101356818 | 3300005563 | Bacteria | 734 |
| 91 | Ga0070664_100593092 | 3300005564 | Bacteria | 1027 |
| 92 | Ga0070664_101289173 | 3300005564 | Bacteria | 690 |
| 93 | Ga0070664_101469755 | 3300005564 | Bacteria | 645 |
| 94 | Ga0068857_101517694 | 3300005577 | Bacteria | 653 |
| 95 | Ga0068854_100562680 | 3300005578 | Bacteria | 969 |
| 96 | Ga0068856_100033727 | 3300005614 | Bacteria | 5014 |
| 97 | Ga0068856_100123081 | 3300005614 | Bacteria | 2596 |
| 98 | Ga0068856_100434983 | 3300005614 | Bacteria | 1332 |
| 99 | Ga0068856_101054662 | 3300005614 | Bacteria | 831 |
| 100 | Ga0070702_100616451 | 3300005615 | Bacteria | 816 |
| 101 | Ga0070702_100946193 | 3300005615 | Bacteria | 678 |
| 102 | Ga0070702_101270173 | 3300005615 | Bacteria | 596 |
| 103 | Ga0068852_100013995 | 3300005616 | Bacteria | 6155 |
| 104 | Ga0068852_100057823 | 3300005616 | Bacteria | 3356 |
| 105 | Ga0068859_100148571 | 3300005617 | Bacteria | 2419 |
| 106 | Ga0068864_100054268 | 3300005618 | Bacteria | 3459 |
| 107 | Ga0068866_10021978 | 3300005718 | Bacteria | 2946 |
| 108 | Ga0068861_100156950 | 3300005719 | Bacteria | 1873 |
| 109 | Ga0068861_100954198 | 3300005719 | Bacteria | 816 |
| 110 | Ga0068861_102591816 | 3300005719 | Bacteria | 511 |
| 111 | Ga0068851_10050452 | 3300005834 | Bacteria | 2112 |
| 112 | Ga0068851_10120112 | 3300005834 | Bacteria | 1411 |
| 113 | Ga0068870_10954823 | 3300005840 | Bacteria | 609 |
| 114 | Ga0068863_100005897 | 3300005841 | Bacteria | 12009 |
| 115 | Ga0068863_102167846 | 3300005841 | Bacteria | 566 |
| 116 | Ga0068858_100009002 | 3300005842 | Bacteria | 9549 |
| 117 | Ga0068858_100027257 | 3300005842 | Bacteria | 5309 |
| 118 | Ga0068858_100083384 | 3300005842 | Bacteria | 2972 |
| 119 | Ga0068858_100832406 | 3300005842 | Bacteria | 901 |
| 120 | Ga0068858_101201272 | 3300005842 | Bacteria | 745 |
| 121 | Ga0068858_101991896 | 3300005842 | Bacteria | 574 |
| 122 | Ga0068858_102409410 | 3300005842 | Bacteria | 520 |
| 123 | Ga0068862_100073979 | 3300005844 | Bacteria | 2945 |
| 124 | Ga0068862_100268762 | 3300005844 | Bacteria | 1559 |
| 125 | Ga0070717_11004923 | 3300006028 | Bacteria | 760 |
| 126 | Ga0075365_10147554 | 3300006038 | Bacteria | 1635 |
| 127 | Ga0075365_10678944 | 3300006038 | Bacteria | 728 |
| 128 | Ga0075368_10002682 | 3300006042 | Bacteria | 5858 |
| 129 | Ga0075363_100016443 | 3300006048 | Bacteria | 3654 |
| 130 | Ga0075363_100150445 | 3300006048 | Bacteria | 1314 |
| 131 | Ga0075364_10403081 | 3300006051 | Bacteria | 933 |
| 132 | Ga0075364_10617633 | 3300006051 | Bacteria | 741 |
| 133 | Ga0075364_11118474 | 3300006051 | Bacteria | 535 |
| 134 | Ga0070715_10224445 | 3300006163 | Bacteria | 968 |
| 135 | Ga0070712_100391971 | 3300006175 | Unclassified | 1145 |
| 136 | Ga0070712_100468283 | 3300006175 | Bacteria | 1052 |
| 137 | Ga0075362_10032262 | 3300006177 | Bacteria | 2272 |
| 138 | Ga0075367_10068609 | 3300006178 | Bacteria | 2127 |
| 139 | Ga0075367_10240455 | 3300006178 | Bacteria | 1135 |
| 140 | Ga0075369_10058580 | 3300006186 | Bacteria | 1677 |
| 141 | Ga0075366_10003900 | 3300006195 | Bacteria | 7953 |
| 142 | Ga0075366_10048007 | 3300006195 | Bacteria | 2531 |
| 143 | Ga0075366_10071039 | 3300006195 | Bacteria | 2074 |
| 144 | Ga0075366_10331180 | 3300006195 | Bacteria | 933 |
| 145 | Ga0097621_100347649 | 3300006237 | Bacteria | 1318 |
| 146 | Ga0075370_10007567 | 3300006353 | Bacteria | 5537 |
| 147 | Ga0068871_100003989 | 3300006358 | Bacteria | 10207 |
| 148 | Ga0068871_100041716 | 3300006358 | Bacteria | 3681 |
| 149 | Ga0068871_100992503 | 3300006358 | Bacteria | 782 |
| 150 | Ga0075428_100051648 | 3300006844 | Bacteria | 4508 |
| 151 | Ga0075428_100884281 | 3300006844 | Bacteria | 948 |
| 152 | Ga0075433_11246386 | 3300006852 | Bacteria | 645 |
| 153 | Ga0075434_100025576 | 3300006871 | Bacteria | 5776 |
| 154 | Ga0075434_100124409 | 3300006871 | Bacteria | 2596 |
| 155 | Ga0075434_100429316 | 3300006871 | Bacteria | 1342 |
| 156 | Ga0075434_100855297 | 3300006871 | Bacteria | 925 |
| 157 | Ga0068865_101025001 | 3300006881 | Bacteria | 724 |
| 158 | Ga0075436_100000862 | 3300006914 | Bacteria | 20155 |
| 159 | Ga0075436_100056376 | 3300006914 | Bacteria | 2714 |
| 160 | Ga0075436_100073902 | 3300006914 | Bacteria | 2360 |
| 161 | Ga0097620_100148573 | 3300006931 | Bacteria | 2419 |
| 162 | Ga0075435_100172209 | 3300007076 | Bacteria | 1827 |
| 163 | Ga0075435_101610583 | 3300007076 | Bacteria | 570 |
| 164 | Ga0099794_10015066 | 3300007265 | Bacteria | 3404 |
| 165 | Ga0099794_10025195 | 3300007265 | Bacteria | 2737 |
| 166 | Ga0099794_10355689 | 3300007265 | Bacteria | 762 |
| 167 | Ga0105251_10462060 | 3300009011 | Bacteria | 589 |
| 168 | Ga0105240_10003296 | 3300009093 | Bacteria | 25239 |
| 169 | Ga0105240_10070801 | 3300009093 | Bacteria | 4313 |
| 170 | Ga0105240_11018909 | 3300009093 | Bacteria | 885 |
| 171 | Ga0105240_11952901 | 3300009093 | Bacteria | 610 |
| 172 | Ga0105240_12043598 | 3300009093 | Bacteria | 595 |
| 173 | Ga0111539_10004777 | 3300009094 | Bacteria | 17692 |
| 174 | Ga0111539_10202435 | 3300009094 | Bacteria | 2315 |
| 175 | Ga0111539_11074802 | 3300009094 | Bacteria | 935 |
| 176 | Ga0105245_10044453 | 3300009098 | Bacteria | 3964 |
| 177 | Ga0105245_10187258 | 3300009098 | Bacteria | 1981 |
| 178 | Ga0105245_10578710 | 3300009098 | Bacteria | 1147 |
| 179 | Ga0105245_11358064 | 3300009098 | Bacteria | 760 |
| 180 | Ga0105247_10440622 | 3300009101 | Bacteria | 937 |
| 181 | Ga0114129_10573939 | 3300009147 | Bacteria | 1464 |
| 182 | Ga0105243_10050853 | 3300009148 | Bacteria | 3275 |
| 183 | Ga0105243_10168466 | 3300009148 | Bacteria | 1895 |
| 184 | Ga0105243_10535911 | 3300009148 | Bacteria | 1116 |
| 185 | Ga0105241_10133559 | 3300009174 | Bacteria | 2012 |
| 186 | Ga0105241_10286930 | 3300009174 | Bacteria | 1408 |
| 187 | Ga0105241_11543553 | 3300009174 | Bacteria | 640 |
| 188 | Ga0105241_12038162 | 3300009174 | Bacteria | 566 |
| 189 | Ga0105242_10006123 | 3300009176 | Bacteria | 9271 |
| 190 | Ga0105242_10081256 | 3300009176 | Bacteria | 2710 |
| 191 | Ga0105242_10249820 | 3300009176 | Bacteria | 1598 |
| 192 | Ga0105242_10941765 | 3300009176 | Bacteria | 867 |
| 193 | Ga0105248_10062805 | 3300009177 | Bacteria | 4170 |
| 194 | Ga0105248_10539955 | 3300009177 | Bacteria | 1315 |
| 195 | Ga0105248_11835285 | 3300009177 | Bacteria | 688 |
| 196 | Ga0105237_10033934 | 3300009545 | Bacteria | 5170 |
| 197 | Ga0105237_10041822 | 3300009545 | Bacteria | 4621 |
| 198 | Ga0105237_10600948 | 3300009545 | Bacteria | 1107 |
| 199 | Ga0105237_11058780 | 3300009545 | Bacteria | 818 |
| 200 | Ga0105237_11090614 | 3300009545 | Bacteria | 805 |
| 201 | Ga0105238_10351942 | 3300009551 | Bacteria | 1462 |
| 202 | Ga0105238_10492404 | 3300009551 | Bacteria | 1226 |
| 203 | Ga0105238_10690610 | 3300009551 | Bacteria | 1032 |
| 204 | Ga0105238_10786215 | 3300009551 | Bacteria | 967 |
| 205 | Ga0105238_11050577 | 3300009551 | Bacteria | 836 |
| 206 | Ga0105249_11801180 | 3300009553 | Bacteria | 685 |
| 207 | Ga0105249_12109979 | 3300009553 | Bacteria | 636 |
| 208 | Ga0105239_10016687 | 3300010375 | Bacteria | 8118 |
| 209 | Ga0105239_10224013 | 3300010375 | Bacteria | 2109 |
| 210 | Ga0105239_11159515 | 3300010375 | Bacteria | 890 |
| 211 | Ga0105239_12319771 | 3300010375 | Bacteria | 625 |
| 212 | Ga0157346_1012824 | 3300012480 | Bacteria | 639 |
| 213 | Ga0157318_1013691 | 3300012482 | Bacteria | 643 |
| 214 | Ga0157316_1064741 | 3300012510 | Bacteria | 538 |
| 215 | Ga0157373_10014959 | 3300013100 | Bacteria | 5679 |
| 216 | Ga0157373_10658576 | 3300013100 | Bacteria | 765 |
| 217 | Ga0157371_10549174 | 3300013102 | Bacteria | 856 |
| 218 | Ga0157371_10921248 | 3300013102 | Bacteria | 663 |
| 219 | Ga0157370_10008784 | 3300013104 | Bacteria | 10854 |
| 220 | Ga0157369_10290349 | 3300013105 | Bacteria | 1702 |
| 221 | Ga0157369_10470448 | 3300013105 | Bacteria | 1301 |
| 222 | Ga0157369_10473252 | 3300013105 | Bacteria | 1296 |
| 223 | Ga0157374_10142688 | 3300013296 | Bacteria | 2325 |
| 224 | Ga0157374_10144200 | 3300013296 | Bacteria | 2313 |
| 225 | Ga0157374_11689795 | 3300013296 | Bacteria | 658 |
| 226 | Ga0157378_10043202 | 3300013297 | Bacteria | 4002 |
| 227 | Ga0157378_10715357 | 3300013297 | Bacteria | 1022 |
| 228 | Ga0157378_11216466 | 3300013297 | Bacteria | 793 |
| 229 | Ga0163162_10113966 | 3300013306 | Bacteria | 2802 |
| 230 | Ga0163162_10621849 | 3300013306 | Bacteria | 1205 |
| 231 | Ga0163162_10841329 | 3300013306 | Bacteria | 1033 |
| 232 | Ga0163162_11162680 | 3300013306 | Bacteria | 875 |
| 233 | Ga0157372_10006865 | 3300013307 | Bacteria | 12114 |
| 234 | Ga0157372_11123795 | 3300013307 | Bacteria | 909 |
| 235 | Ga0157375_10050523 | 3300013308 | Bacteria | 4079 |
| 236 | Ga0163163_11579056 | 3300014325 | Bacteria | 717 |
| 237 | Ga0157380_10619532 | 3300014326 | Bacteria | 1074 |
| 238 | Ga0157380_10710913 | 3300014326 | Bacteria | 1011 |
| 239 | Ga0157380_11705514 | 3300014326 | Bacteria | 688 |
| 240 | Ga0182008_10018284 | 3300014497 | Bacteria | 3629 |
| 241 | Ga0157377_10124346 | 3300014745 | Bacteria | 1567 |
| 242 | Ga0157379_10068146 | 3300014968 | Bacteria | 3181 |
| 243 | Ga0157379_10125264 | 3300014968 | Bacteria | 2312 |
| 244 | Ga0157376_10051732 | 3300014969 | Bacteria | 3412 |
| 245 | Ga0157376_10618976 | 3300014969 | Bacteria | 1080 |
| 246 | Ga0157376_10763873 | 3300014969 | Bacteria | 977 |
| 247 | Ga0163161_10628811 | 3300017792 | Bacteria | 888 |
| 248 | Ga0163161_11512498 | 3300017792 | Bacteria | 589 |
| 249 | Ga0206354_10063477 | 3300020081 | Bacteria | 642 |
| 250 | Ga0213872_10021164 | 3300021361 | Bacteria | 2994 |
| 251 | Ga0213876_10162750 | 3300021384 | Bacteria | 1187 |
| 252 | Ga0207656_10001500 | 3300025321 | Bacteria | 7731 |
| 253 | Ga0207642_10125207 | 3300025899 | Bacteria | 1332 |
| 254 | Ga0207688_10061781 | 3300025901 | Bacteria | 2112 |
| 255 | Ga0207680_10374569 | 3300025903 | Bacteria | 1003 |
| 256 | Ga0207699_10850384 | 3300025906 | Bacteria | 672 |
| 257 | Ga0207645_10693848 | 3300025907 | Bacteria | 692 |
| 258 | Ga0207705_10260813 | 3300025909 | Bacteria | 1323 |
| 259 | Ga0207705_10468452 | 3300025909 | Bacteria | 977 |
| 260 | Ga0207705_10668060 | 3300025909 | Bacteria | 808 |
| 261 | Ga0207654_10324969 | 3300025911 | Bacteria | 1053 |
| 262 | Ga0207654_10562009 | 3300025911 | Bacteria | 811 |
| 263 | Ga0207707_10049882 | 3300025912 | Bacteria | 3647 |
| 264 | Ga0207707_10077125 | 3300025912 | Bacteria | 2908 |
| 265 | Ga0207707_10806939 | 3300025912 | Bacteria | 781 |
| 266 | Ga0207707_11171241 | 3300025912 | Bacteria | 623 |
| 267 | Ga0207695_10009540 | 3300025913 | Bacteria | 12001 |
| 268 | Ga0207695_10529200 | 3300025913 | Bacteria | 1060 |
| 269 | Ga0207671_10017161 | 3300025914 | Bacteria | 5593 |
| 270 | Ga0207671_10520013 | 3300025914 | Bacteria | 949 |
| 271 | Ga0207671_11163078 | 3300025914 | Bacteria | 604 |
| 272 | Ga0207693_10304221 | 3300025915 | Bacteria | 1249 |
| 273 | Ga0207693_10519131 | 3300025915 | Unclassified | 929 |
| 274 | Ga0207663_10056311 | 3300025916 | Bacteria | 2471 |
| 275 | Ga0207663_10662030 | 3300025916 | Unclassified | 825 |
| 276 | Ga0207660_10523218 | 3300025917 | Bacteria | 963 |
| 277 | Ga0207660_11637753 | 3300025917 | Bacteria | 518 |
| 278 | Ga0207662_10202198 | 3300025918 | Bacteria | 1286 |
| 279 | Ga0207662_10320382 | 3300025918 | Bacteria | 1035 |
| 280 | Ga0207649_10463214 | 3300025920 | Bacteria | 959 |
| 281 | Ga0207652_10100647 | 3300025921 | Bacteria | 2552 |
| 282 | Ga0207652_11096441 | 3300025921 | Bacteria | 696 |
| 283 | Ga0207681_10575209 | 3300025923 | Bacteria | 929 |
| 284 | Ga0207694_10015938 | 3300025924 | Bacteria | 5672 |
| 285 | Ga0207694_10428260 | 3300025924 | Bacteria | 1103 |
| 286 | Ga0207694_10438924 | 3300025924 | Bacteria | 1089 |
| 287 | Ga0207694_11540167 | 3300025924 | Bacteria | 561 |
| 288 | Ga0207650_10060557 | 3300025925 | Bacteria | 2825 |
| 289 | Ga0207650_11378094 | 3300025925 | Bacteria | 600 |
| 290 | Ga0207659_10243675 | 3300025926 | Bacteria | 1455 |
| 291 | Ga0207687_10062240 | 3300025927 | Bacteria | 2638 |
| 292 | Ga0207700_10107445 | 3300025928 | Bacteria | 2239 |
| 293 | Ga0207700_11085143 | 3300025928 | Bacteria | 716 |
| 294 | Ga0207664_10527148 | 3300025929 | Bacteria | 1059 |
| 295 | Ga0207644_10274777 | 3300025931 | Bacteria | 1351 |
| 296 | Ga0207644_10986571 | 3300025931 | Bacteria | 707 |
| 297 | Ga0207690_10099810 | 3300025932 | Bacteria | 2070 |
| 298 | Ga0207690_10238835 | 3300025932 | Bacteria | 1399 |
| 299 | Ga0207706_11225902 | 3300025933 | Bacteria | 623 |
| 300 | Ga0207686_10069757 | 3300025934 | Bacteria | 2256 |
| 301 | Ga0207686_10113674 | 3300025934 | Bacteria | 1831 |
| 302 | Ga0207686_10333869 | 3300025934 | Bacteria | 1136 |
| 303 | Ga0207686_11057720 | 3300025934 | Bacteria | 660 |
| 304 | Ga0207709_10451427 | 3300025935 | Bacteria | 994 |
| 305 | Ga0207669_10050079 | 3300025937 | Bacteria | 2494 |
| 306 | Ga0207669_11025655 | 3300025937 | Bacteria | 694 |
| 307 | Ga0207704_10759876 | 3300025938 | Bacteria | 807 |
| 308 | Ga0207704_11394964 | 3300025938 | Bacteria | 600 |
| 309 | Ga0207665_10136638 | 3300025939 | Bacteria | 1745 |
| 310 | Ga0207691_10083916 | 3300025940 | Bacteria | 2860 |
| 311 | Ga0207691_10849583 | 3300025940 | Bacteria | 765 |
| 312 | Ga0207711_10040325 | 3300025941 | Bacteria | 3972 |
| 313 | Ga0207689_10000370 | 3300025942 | Bacteria | 42422 |
| 314 | Ga0207689_10911461 | 3300025942 | Bacteria | 742 |
| 315 | Ga0207661_10841865 | 3300025944 | Bacteria | 844 |
| 316 | Ga0207679_10116237 | 3300025945 | Bacteria | 2121 |
| 317 | Ga0207667_10011637 | 3300025949 | Bacteria | 10213 |
| 318 | Ga0207667_10249444 | 3300025949 | Bacteria | 1816 |
| 319 | Ga0207667_12083654 | 3300025949 | Bacteria | 526 |
| 320 | Ga0207651_10015447 | 3300025960 | Bacteria | 4437 |
| 321 | Ga0207712_10982713 | 3300025961 | Bacteria | 748 |
| 322 | Ga0207640_10591020 | 3300025981 | Bacteria | 938 |
| 323 | Ga0207640_10911403 | 3300025981 | Bacteria | 768 |
| 324 | Ga0207658_10233208 | 3300025986 | Bacteria | 1555 |
| 325 | Ga0207658_10513691 | 3300025986 | Bacteria | 1068 |
| 326 | Ga0207677_10006249 | 3300026023 | Bacteria | 6514 |
| 327 | Ga0207677_10207482 | 3300026023 | Bacteria | 1562 |
| 328 | Ga0207677_10819256 | 3300026023 | Bacteria | 834 |
| 329 | Ga0207703_10069578 | 3300026035 | Bacteria | 2903 |
| 330 | Ga0207703_10489216 | 3300026035 | Bacteria | 1154 |
| 331 | Ga0207703_11271200 | 3300026035 | Bacteria | 708 |
| 332 | Ga0207639_10013232 | 3300026041 | Bacteria | 5768 |
| 333 | Ga0207639_10172407 | 3300026041 | Bacteria | 1833 |
| 334 | Ga0207639_10189767 | 3300026041 | Bacteria | 1754 |
| 335 | Ga0207639_10582061 | 3300026041 | Bacteria | 1030 |
| 336 | Ga0207678_10082772 | 3300026067 | Bacteria | 2746 |
| 337 | Ga0207708_10033659 | 3300026075 | Bacteria | 3895 |
| 338 | Ga0207708_10789366 | 3300026075 | Bacteria | 817 |
| 339 | Ga0207702_10015403 | 3300026078 | Bacteria | 6336 |
| 340 | Ga0207702_10272295 | 3300026078 | Bacteria | 1597 |
| 341 | Ga0207702_10367696 | 3300026078 | Bacteria | 1380 |
| 342 | Ga0207702_11052545 | 3300026078 | Bacteria | 807 |
| 343 | Ga0207702_11589147 | 3300026078 | Bacteria | 647 |
| 344 | Ga0207641_10190858 | 3300026088 | Bacteria | 1883 |
| 345 | Ga0207641_11353290 | 3300026088 | Bacteria | 713 |
| 346 | Ga0207641_11540651 | 3300026088 | Bacteria | 666 |
| 347 | Ga0207648_10090358 | 3300026089 | Bacteria | 2676 |
| 348 | Ga0207648_10283009 | 3300026089 | Bacteria | 1483 |
| 349 | Ga0207648_10325469 | 3300026089 | Bacteria | 1382 |
| 350 | Ga0207648_10870773 | 3300026089 | Bacteria | 840 |
| 351 | Ga0207648_12178312 | 3300026089 | Bacteria | 515 |
| 352 | Ga0207676_10176567 | 3300026095 | Bacteria | 1866 |
| 353 | Ga0207674_10150649 | 3300026116 | Bacteria | 2283 |
| 354 | Ga0207683_10038091 | 3300026121 | Bacteria | 4188 |
| 355 | Ga0207683_10040680 | 3300026121 | Bacteria | 4057 |
| 356 | Ga0207683_10111579 | 3300026121 | Bacteria | 2449 |
| 357 | Ga0207683_10622949 | 3300026121 | Bacteria | 999 |
| 358 | Ga0207698_10053328 | 3300026142 | Bacteria | 3104 |
| 359 | Ga0207698_10478473 | 3300026142 | Bacteria | 1207 |
| 360 | Ga0209969_1000383 | 3300027360 | Bacteria | 5901 |
| 361 | Ga0210000_1016818 | 3300027462 | Bacteria | 1106 |
| 362 | Ga0209999_1001158 | 3300027543 | Bacteria | 4500 |
| 363 | Ga0209588_1009253 | 3300027671 | Bacteria | 2940 |
| 364 | Ga0209588_1157021 | 3300027671 | Bacteria | 719 |
| 365 | Ga0209588_1233763 | 3300027671 | Bacteria | 565 |
| 366 | Ga0209971_1003675 | 3300027682 | Bacteria | 3636 |
| 367 | Ga0209998_10032618 | 3300027717 | Bacteria | 1158 |
| 368 | Ga0209813_10023151 | 3300027866 | Bacteria | 1764 |
| 369 | Ga0209813_10084750 | 3300027866 | Bacteria | 1054 |
| 370 | Ga0209974_10001043 | 3300027876 | Bacteria | 9809 |
| 371 | Ga0207428_10007467 | 3300027907 | Bacteria | 9965 |
| 372 | Ga0207428_10148918 | 3300027907 | Bacteria | 1782 |
| 373 | Ga0207428_11305681 | 3300027907 | Bacteria | 503 |
| 374 | Ga0268266_10118435 | 3300028379 | Bacteria | 2354 |
| 375 | Ga0268266_10149487 | 3300028379 | Bacteria | 2104 |
| 376 | Ga0268266_10199873 | 3300028379 | Bacteria | 1829 |
| 377 | Ga0268265_10084722 | 3300028380 | Bacteria | 2513 |
| 378 | Ga0268265_10233470 | 3300028380 | Bacteria | 1618 |
| 379 | Ga0268264_10083813 | 3300028381 | Bacteria | 2731 |
| 380 | Ga0307511_10000653 | 3300030521 | Bacteria | 37038 |
| 381 | Ga0265332_10048865 | 3300031238 | Bacteria | 1819 |
| 382 | Ga0265328_10000839 | 3300031239 | Bacteria | 14245 |
| 383 | Ga0265328_10021475 | 3300031239 | Bacteria | 2463 |
| 384 | Ga0265328_10114687 | 3300031239 | Bacteria | 1002 |
| 385 | Ga0265328_10134913 | 3300031239 | Bacteria | 925 |
| 386 | Ga0265331_10000050 | 3300031250 | Bacteria | 181286 |
| 387 | Ga0265331_10003466 | 3300031250 | Bacteria | 10177 |
| 388 | Ga0265327_10000109 | 3300031251 | Bacteria | 181275 |
| 389 | Ga0265327_10000161 | 3300031251 | Bacteria | 144768 |
| 390 | Ga0265327_10004575 | 3300031251 | Bacteria | 12181 |
| 391 | Ga0265316_10238687 | 3300031344 | Bacteria | 1337 |
| 392 | Ga0265316_10324601 | 3300031344 | Bacteria | 1118 |
| 393 | Ga0307408_100293848 | 3300031548 | Bacteria | 1358 |
| 394 | Ga0307406_10661368 | 3300031901 | Bacteria | 868 |
| 395 | Ga0307409_101363461 | 3300031995 | Bacteria | 735 |
| 396 | Ga0373958_0063341 | 3300034819 | Bacteria | 806 |
| 397 | Ga0373928_0127448 | 3300035084 | Bacteria | 687 |
| 398 | Ga0373932_0294181 | 3300035112 | Bacteria | 604 |
| 399 | Ga0373939_0327205 | 3300035114 | Bacteria | 618 |
| 400 | Ga0373953_0033407 | 3300035117 | Bacteria | 2012 |
| 401 | Ga0373954_0093041 | 3300035118 | Bacteria | 1449 |
| 402 | Ga0373956_0059357 | 3300035119 | Bacteria | 1730 |
| 403 | Ga0373957_0022817 | 3300035120 | Bacteria | 2233 |
| 404 | Ga0373957_0035427 | 3300035120 | Bacteria | 1854 |
| 405 | Ga0373955_0025822 | 3300035172 | Bacteria | 3020 |
| 406 | Ga0373955_0671310 | 3300035172 | Bacteria | 636 |
| 407 | Ga0373942_0209632 | 3300035207 | Bacteria | 649 |
| 408 | Ga0373962_0229417 | 3300035242 | Bacteria | 638 |
| 409 | Ga0373935_0573763 | 3300035692 | Bacteria | 824 |
| 410 | Ga0373935_1196402 | 3300035692 | Bacteria | 566 |
| 411 | Ga0373927_0173010 | 3300035695 | Bacteria | 1416 |
| 412 | Ga0373933_0013960 | 3300035724 | Bacteria | 4457 |
| 413 | Ga0373933_0211461 | 3300035724 | Bacteria | 1243 |
| 414 | Ga0373933_0880156 | 3300035724 | Bacteria | 590 |
| 415 | Ga0373937_0019465 | 3300036401 | Bacteria | 6077 |
| 416 | Ga0373937_0057553 | 3300036401 | Bacteria | 3572 |
| 417 | Ga0373937_0059217 | 3300036401 | Bacteria | 3519 |
| 418 | Ga0373937_0395335 | 3300036401 | Bacteria | 1311 |
| 419 | Ga0373925_0585040 | 3300037068 | Bacteria | 919 |
| 420 | Ga0395899_0171993 | 3300037312 | Bacteria | 1525 |
| 421 | Ga0395900_0884280 | 3300037418 | Bacteria | 817 |
| 422 | Ga0395905_0013092 | 3300037471 | Bacteria | 7964 |
| 423 | Ga0400483_057151 | 3300039062 | Bacteria | 1965 |
| 424 | Ga0400483_139236 | 3300039062 | Bacteria | 1444 |
| 425 | Ga0400483_186650 | 3300039062 | Bacteria | 2969 |
| 426 | Ga0436365_0854741 | 3300039437 | Bacteria | 685 |
| 427 | Ga0436365_1601346 | 3300039437 | Bacteria | 2241 |
| 428 | Ga0436361_0050017 | 3300039447 | Bacteria | 26618 |
| 429 | Ga0439447_163493 | 3300041407 | Bacteria | 513 |
| 430 | Ga0451789_1187517 | 3300041443 | Bacteria | 560 |
| 431 | Ga0451839_0692740 | 3300041496 | Bacteria | 650 |
| 432 | Ga0451853_0874889 | 3300041512 | Bacteria | 781 |
| 433 | Ga0451577_1007827 | 3300042876 | Bacteria | 748 |
| 434 | Ga0451577_1047828 | 3300042876 | Bacteria | 731 |
| 435 | Ga0453683_0674112 | 3300044673 | Bacteria | 677 |
| 436 | Ga0453684_0353189 | 3300044712 | Bacteria | 1657 |
| 437 | Ga0453684_0846607 | 3300044712 | Bacteria | 983 |
| 438 | Ga0451576_1049256 | 3300045051 | Bacteria | 854 |
| 439 | Ga0495603_0562736 | 3300046455 | Bacteria | 653 |
| 440 | Ga0495629_0319230 | 3300046459 | Bacteria | 1062 |
| 441 | Ga0495608_0103787 | 3300046511 | Bacteria | 1831 |
| 442 | Ga0495628_0006157 | 3300046516 | Bacteria | 10491 |
| 443 | Ga0495630_0110176 | 3300046517 | Bacteria | 2085 |
| 444 | Ga0495642_0434036 | 3300046528 | Bacteria | 580 |
| 445 | Ga0495640_0418098 | 3300046533 | Bacteria | 821 |
| 446 | Ga0495586_0043984 | 3300046535 | Bacteria | 2404 |
| 447 | Ga0495598_0417969 | 3300046537 | Bacteria | 526 |
| 448 | Ga0495621_0196828 | 3300046539 | Bacteria | 809 |
| 449 | Ga0495621_0412732 | 3300046539 | Bacteria | 574 |
| 450 | Ga0495645_0204491 | 3300046543 | Bacteria | 1337 |
| 451 | Ga0495622_0268605 | 3300046557 | Bacteria | 748 |
| 452 | Ga0495667_0023519 | 3300046559 | Bacteria | 4151 |
| 453 | Ga0495656_0795823 | 3300046615 | Bacteria | 511 |
| 454 | Ga0495668_0261270 | 3300046616 | Bacteria | 948 |
| 455 | Ga0495657_0146887 | 3300046675 | Bacteria | 1466 |
| 456 | Ga0495646_0340110 | 3300046680 | Bacteria | 788 |
| 457 | Ga0495647_0516737 | 3300046681 | Bacteria | 557 |
| 458 | Ga0495600_0073469 | 3300046809 | Bacteria | 2233 |
| 459 | Ga0495604_0039043 | 3300047317 | Bacteria | 3732 |
| 460 | Ga0495636_0103288 | 3300047318 | Bacteria | 1248 |
| 461 | Ga0495680_0172127 | 3300047322 | Bacteria | 1567 |
| 462 | Ga0495675_0365813 | 3300047444 | Bacteria | 846 |
| 463 | Ga0495684_0133481 | 3300047471 | Bacteria | 1863 |
| 464 | Ga0496102_0418388 | 3300048905 | Bacteria | 1259 |
| 465 | Ga0496104_0035628 | 3300048907 | Bacteria | 4647 |
| 466 | Ga0496104_0779031 | 3300048907 | Bacteria | 863 |
| 467 | Ga0496104_1106928 | 3300048907 | Bacteria | 696 |
| 468 | Ga0496110_0103024 | 3300048913 | Bacteria | 2560 |
| 469 | Ga0496113_0862544 | 3300048916 | Bacteria | 717 |
| 470 | Ga0496114_0756197 | 3300048917 | Bacteria | 849 |
| 471 | Ga0501031_0011216 | 3300049568 | Bacteria | 5841 |
| 472 | Ga0501032_0003598 | 3300049569 | Bacteria | 11803 |
| 473 | Ga0501032_0012634 | 3300049569 | Bacteria | 6025 |
| 474 | Ga0501033_0001817 | 3300049570 | Bacteria | 18639 |
| 475 | Ga0501033_0004521 | 3300049570 | Bacteria | 11131 |
| 476 | Ga0501033_0029294 | 3300049570 | Bacteria | 4137 |
| 477 | Ga0501034_0003361 | 3300049571 | Bacteria | 18264 |
| 478 | Ga0501034_0184133 | 3300049571 | Bacteria | 2052 |
| 479 | Ga0501036_0002120 | 3300049572 | Bacteria | 15493 |
| 480 | Ga0501036_0010828 | 3300049572 | Bacteria | 7534 |
| 481 | Ga0501036_0159394 | 3300049572 | Bacteria | 1903 |
| 482 | Ga0501037_0001263 | 3300049573 | Bacteria | 18639 |
| 483 | Ga0501037_0169944 | 3300049573 | Bacteria | 1550 |
| 484 | Ga0501037_0431822 | 3300049573 | Bacteria | 900 |
| 485 | Ga0501038_0003243 | 3300049574 | Bacteria | 15162 |
| 486 | Ga0501038_0004836 | 3300049574 | Bacteria | 12512 |
| 487 | Ga0501038_0009205 | 3300049574 | Bacteria | 9059 |
| 488 | Ga0501038_0027558 | 3300049574 | Bacteria | 5054 |
| 489 | Ga0501038_0371341 | 3300049574 | Bacteria | 1111 |
| 490 | Ga0501039_0021126 | 3300049575 | Bacteria | 4993 |
| 491 | Ga0501039_0022190 | 3300049575 | Bacteria | 4873 |
| 492 | Ga0501039_0382628 | 3300049575 | Bacteria | 1105 |
| 493 | Ga0501039_0636386 | 3300049575 | Bacteria | 835 |
| 494 | Ga0501042_0000031 | 3300049578 | Bacteria | 46017 |
| 495 | Ga0501042_0628147 | 3300049578 | Bacteria | 781 |
| 496 | Ga0501043_0000157 | 3300049579 | Bacteria | 62190 |
| 497 | Ga0501043_0012057 | 3300049579 | Bacteria | 6758 |
| 498 | Ga0501043_0012117 | 3300049579 | Bacteria | 6741 |
| 499 | Ga0501046_0002577 | 3300049580 | Bacteria | 16965 |
| 500 | Ga0501046_0078124 | 3300049580 | Bacteria | 2561 |
| 501 | Ga0501046_0321700 | 3300049580 | Bacteria | 1127 |
| 502 | Ga0501046_0575473 | 3300049580 | Bacteria | 801 |
| 503 | Ga0501047_0002207 | 3300049581 | Bacteria | 18639 |
| 504 | Ga0501047_0005455 | 3300049581 | Bacteria | 11968 |
| 505 | Ga0501047_0262852 | 3300049581 | Bacteria | 1573 |
| 506 | Ga0501048_0002716 | 3300049582 | Bacteria | 13496 |
| 507 | Ga0501067_0163311 | 3300049583 | Bacteria | 1240 |
| 508 | Ga0501068_0026149 | 3300049584 | Bacteria | 3437 |
| 509 | Ga0501068_0193725 | 3300049584 | Bacteria | 1288 |
| 510 | Ga0501068_0596027 | 3300049584 | Bacteria | 720 |
| 511 | Ga0501069_0001064 | 3300049585 | Bacteria | 13167 |
| 512 | Ga0501070_0001356 | 3300049586 | Bacteria | 21938 |
| 513 | Ga0501070_1090978 | 3300049586 | Bacteria | 616 |
| 514 | Ga0501073_0000321 | 3300049589 | Bacteria | 32033 |
| 515 | Ga0501073_0172366 | 3300049589 | Bacteria | 1498 |
| 516 | Ga0501074_0000097 | 3300049590 | Bacteria | 42311 |
| 517 | Ga0501075_1048991 | 3300049591 | Unclassified | 619 |
| 518 | Ga0501076_0318868 | 3300049592 | Bacteria | 1275 |
| 519 | Ga0501079_0010889 | 3300049741 | Bacteria | 6926 |
| 520 | Ga0501079_1135656 | 3300049741 | Bacteria | 616 |
| 521 | Ga0501080_0004551 | 3300049742 | Bacteria | 12361 |
| 522 | Ga0501080_0880816 | 3300049742 | Bacteria | 781 |
| 523 | Ga0501035_0000671 | 3300049822 | Bacteria | 37548 |
| 524 | Ga0501035_0022817 | 3300049822 | Bacteria | 5747 |
| 525 | Ga0501035_0031902 | 3300049822 | Bacteria | 4797 |
| 526 | Ga0501035_0157358 | 3300049822 | Bacteria | 1969 |
| 527 | Ga0501035_0433143 | 3300049822 | Bacteria | 1090 |
| 528 | Ga0501044_0000747 | 3300049823 | Bacteria | 39287 |
| 529 | Ga0501044_0029513 | 3300049823 | Bacteria | 5782 |
| 530 | Ga0501044_0164945 | 3300049823 | Bacteria | 2190 |
| 531 | Ga0501044_0167932 | 3300049823 | Bacteria | 2167 |
| 532 | Ga0501044_1384132 | 3300049823 | Bacteria | 569 |
| 533 | Ga0501045_0963725 | 3300049824 | Bacteria | 626 |
| 534 | Ga0501045_1402428 | 3300049824 | Bacteria | 507 |
| 535 | nmdc:mga03683_309215_c1 | 3300050489 | Bacteria | 742 |
| 536 | nmdc:mga03n38_323226_c1 | 3300050490 | Bacteria | 834 |
| 537 | nmdc:mga00v17_24107_c1 | 3300050491 | Bacteria | 3525 |
| 538 | nmdc:mga00v17_372343_c1 | 3300050491 | Bacteria | 929 |
| 539 | nmdc:mga0yw44_424857_c1 | 3300050492 | Bacteria | 900 |
| 540 | nmdc:mga0yw44_7154_c1 | 3300050492 | Bacteria | 5465 |
| 541 | nmdc:mga0k408_122686_c1 | 3300050493 | Bacteria | 1540 |
| 542 | nmdc:mga0k408_14579_c1 | 3300050493 | Bacteria | 4335 |
| 543 | nmdc:mga0k408_24801_c1 | 3300050493 | Bacteria | 3393 |
| 544 | nmdc:mga0k408_712_c1 | 3300050493 | Bacteria | 18213 |
| 545 | nmdc:mga06z11_198107_c1 | 3300050494 | Bacteria | 1165 |
| 546 | nmdc:mga06z11_32248_c1 | 3300050494 | Bacteria | 2554 |
| 547 | nmdc:mga04h51_63514_c1 | 3300050495 | Bacteria | 1272 |
| 548 | nmdc:mga07m45_21342_c1 | 3300050496 | Bacteria | 3525 |
| 549 | nmdc:mga07m45_775818_c1 | 3300050496 | Bacteria | 550 |
| 550 | nmdc:mga07m45_85577_c1 | 3300050496 | Bacteria | 1803 |
| 551 | nmdc:mga05p37_460365_c1 | 3300050507 | Bacteria | 1470 |
| 552 | nmdc:mga0qj67_365204_c1 | 3300050509 | Bacteria | 1166 |
| 553 | nmdc:mga08y16_54336_c1 | 3300050511 | Bacteria | 4185 |
| 554 | nmdc:mga08y16_65090_c1 | 3300050511 | Bacteria | 3805 |
| 555 | nmdc:mga0n895_16127_c1 | 3300050512 | Bacteria | 6845 |
| 556 | nmdc:mga0n895_477872_c1 | 3300050512 | Bacteria | 1257 |
| 557 | nmdc:mga0n895_565922_c1 | 3300050512 | Bacteria | 1141 |
| 558 | nmdc:mga0rr50_108788_c2 | 3300050513 | Bacteria | 1442 |
| 559 | nmdc:mga0rr50_1490777_c1 | 3300050513 | Bacteria | 572 |
| 560 | nmdc:mga08x19_46810_c1 | 3300050514 | Bacteria | 2767 |
| 561 | nmdc:mga08x19_63870_c1 | 3300050514 | Bacteria | 2389 |
| 562 | nmdc:mga08x19_8733_c1 | 3300050514 | Bacteria | 6043 |
| 563 | nmdc:mga0a205_11320_c1 | 3300050515 | Bacteria | 8211 |
| 564 | nmdc:mga0sz30_320539_c1 | 3300050516 | Bacteria | 692 |
| 565 | nmdc:mga0sz30_389495_c1 | 3300050516 | Bacteria | 624 |
| 566 | nmdc:mga0sz30_53980_c2 | 3300050516 | Bacteria | 1358 |
| 567 | Ga0495601_0013569 | 3300053077 | Bacteria | 4900 |
| 568 | Ga0495619_0507115 | 3300053085 | Bacteria | 829 |
| 569 | Ga0500646_0000869 | 3300053090 | Bacteria | 8331 |
| 570 | Ga0500583_0002645 | 3300053092 | Bacteria | 5434 |
| 571 | Ga0500583_0329071 | 3300053092 | Bacteria | 743 |
| 572 | Ga0500651_0262029 | 3300053093 | Bacteria | 1002 |
| 573 | Ga0500651_0515900 | 3300053093 | Bacteria | 657 |
| 574 | Ga0500641_0022818 | 3300053096 | Bacteria | 2401 |
| 575 | Ga0500562_175927 | 3300053108 | Bacteria | 581 |
| 576 | Ga0500594_0039541 | 3300053118 | Bacteria | 1283 |
| 577 | Ga0500642_0181849 | 3300053130 | Bacteria | 983 |
| 578 | Ga0500655_018398 | 3300053133 | Bacteria | 1297 |
| 579 | Ga0500604_0000727 | 3300053151 | Bacteria | 9013 |
| 580 | Ga0500645_154259 | 3300053730 | Bacteria | 631 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049591 | Ga0501075_1048991 | Ga0501075_1048991_11_379 | 112 |
| 2 | 3300050491 | nmdc:mga00v17_24107_c1 | nmdc:mga00v17_24107_c1_512_874 | 115 |
| 3 | 3300050493 | nmdc:mga0k408_122686_c1 | nmdc:mga0k408_122686_c1_994_1356 | 115 |
| 4 | 3300050494 | nmdc:mga06z11_198107_c1 | nmdc:mga06z11_198107_c1_707_1069 | 115 |
| 5 | 3300005355 | Ga0070671_100307220 | Ga0070671_1003072202 | 116 |
| 6 | 3300034819 | Ga0373958_0063341 | Ga0373958_0063341_398_763 | 116 |
| 7 | 3300035724 | Ga0373933_0880156 | Ga0373933_0880156_188_565 | 116 |
| 8 | 3300006871 | Ga0075434_100124409 | Ga0075434_1001244092 | 119 |
| 9 | 3300006914 | Ga0075436_100000862 | Ga0075436_1000008622 | 119 |
| 10 | 3300007076 | Ga0075435_100172209 | Ga0075435_1001722092 | 119 |
| 11 | 3300009147 | Ga0114129_10573939 | Ga0114129_105739392 | 119 |
| 12 | 3300050513 | nmdc:mga0rr50_108788_c2 | nmdc:mga0rr50_108788_c2_473_907 | 119 |
| 13 | 3300050514 | nmdc:mga08x19_8733_c1 | nmdc:mga08x19_8733_c1_2874_3308 | 119 |
| 14 | 3300005458 | Ga0070681_10120986 | Ga0070681_101209862 | 120 |
| 15 | 3300046539 | Ga0495621_0196828 | Ga0495621_0196828_80_481 | 122 |
| 16 | 3300005434 | Ga0070709_11065518 | Ga0070709_110655182 | 123 |
| 17 | 3300017792 | Ga0163161_11512498 | Ga0163161_115124981 | 123 |
| 18 | 3300050496 | nmdc:mga07m45_775818_c1 | nmdc:mga07m45_775818_c1_45_422 | 123 |
| 19 | 3300005842 | Ga0068858_101991896 | Ga0068858_1019918961 | 124 |
| 20 | iso_pu_bacteria | 2998344455 | 2998344559 | 124 |
| 21 | 3300005340 | Ga0070689_100359815 | Ga0070689_1003598152 | 125 |
| 22 | 3300005518 | Ga0070699_100998353 | Ga0070699_1009983531 | 125 |
| 23 | 3300044673 | Ga0453683_0674112 | Ga0453683_0674112_163_597 | 125 |
| 24 | iso_pu_bacteria | 2547132103 | 2547375495 | 125 |
| 25 | iso_pu_bacteria | 2843690924 | 2843691347 | 125 |
| 26 | iso_pu_bacteria | 2846033681 | 2846034396 | 125 |
| 27 | iso_pu_bacteria | 639633007 | 639788552 | 125 |
| 28 | 3300005445 | Ga0070708_100969366 | Ga0070708_1009693661 | 126 |
| 29 | 3300005471 | Ga0070698_101204345 | Ga0070698_1012043451 | 126 |
| 30 | 3300031239 | Ga0265328_10114687 | Ga0265328_101146872 | 126 |
| 31 | 3300031251 | Ga0265327_10000161 | Ga0265327_1000016138 | 126 |
| 32 | 3300044712 | Ga0453684_0353189 | Ga0453684_0353189_277_666 | 126 |
| 33 | 3300046537 | Ga0495598_0417969 | Ga0495598_0417969_53_433 | 126 |
| 34 | iso_pu_bacteria | 2547132512 | 2548846611 | 126 |
| 35 | 3300005544 | Ga0070686_101124061 | Ga0070686_1011240611 | 127 |
| 36 | 3300014326 | Ga0157380_11705514 | Ga0157380_117055141 | 127 |
| 37 | 3300026121 | Ga0207683_10622949 | Ga0207683_106229492 | 127 |
| 38 | 3300039062 | Ga0400483_057151 | Ga0400483_057151_54_452 | 127 |
| 39 | 3300039062 | Ga0400483_139236 | Ga0400483_139236_461_859 | 127 |
| 40 | 3300039062 | Ga0400483_186650 | Ga0400483_186650_51_449 | 127 |
| 41 | 3300048907 | Ga0496104_0779031 | Ga0496104_0779031_312_752 | 127 |
| 42 | 3300048917 | Ga0496114_0756197 | Ga0496114_0756197_133_573 | 127 |
| 43 | 3300005719 | Ga0068861_100954198 | Ga0068861_1009541982 | 128 |
| 44 | 3300027907 | Ga0207428_11305681 | Ga0207428_113056811 | 128 |
| 45 | 3300049574 | Ga0501038_0371341 | Ga0501038_0371341_87_473 | 128 |
| 46 | 3300049575 | Ga0501039_0636386 | Ga0501039_0636386_16_402 | 128 |
| 47 | 3300049592 | Ga0501076_0318868 | Ga0501076_0318868_108_494 | 128 |
| 48 | 3300049741 | Ga0501079_1135656 | Ga0501079_1135656_200_586 | 128 |
| 49 | 3300005336 | Ga0070680_100082662 | Ga0070680_1000826622 | 129 |
| 50 | 3300005338 | Ga0068868_101039356 | Ga0068868_1010393561 | 129 |
| 51 | 3300005345 | Ga0070692_11310040 | Ga0070692_113100401 | 129 |
| 52 | 3300005354 | Ga0070675_100318733 | Ga0070675_1003187331 | 129 |
| 53 | 3300005366 | Ga0070659_100322280 | Ga0070659_1003222802 | 129 |
| 54 | 3300005440 | Ga0070705_100842409 | Ga0070705_1008424092 | 129 |
| 55 | 3300005458 | Ga0070681_10029739 | Ga0070681_100297397 | 129 |
| 56 | 3300005530 | Ga0070679_100129529 | Ga0070679_1001295292 | 129 |
| 57 | 3300005539 | Ga0068853_100131569 | Ga0068853_1001315692 | 129 |
| 58 | 3300005539 | Ga0068853_100173648 | Ga0068853_1001736481 | 129 |
| 59 | 3300005549 | Ga0070704_100499751 | Ga0070704_1004997512 | 129 |
| 60 | 3300005564 | Ga0070664_100593092 | Ga0070664_1005930922 | 129 |
| 61 | 3300005564 | Ga0070664_101289173 | Ga0070664_1012891732 | 129 |
| 62 | 3300005577 | Ga0068857_101517694 | Ga0068857_1015176942 | 129 |
| 63 | 3300005614 | Ga0068856_100434983 | Ga0068856_1004349831 | 129 |
| 64 | 3300005615 | Ga0070702_100946193 | Ga0070702_1009461931 | 129 |
| 65 | 3300005719 | Ga0068861_102591816 | Ga0068861_1025918161 | 129 |
| 66 | 3300005842 | Ga0068858_102409410 | Ga0068858_1024094101 | 129 |
| 67 | 3300005844 | Ga0068862_100268762 | Ga0068862_1002687622 | 129 |
| 68 | 3300006195 | Ga0075366_10003900 | Ga0075366_100039002 | 129 |
| 69 | 3300006237 | Ga0097621_100347649 | Ga0097621_1003476491 | 129 |
| 70 | 3300006871 | Ga0075434_100855297 | Ga0075434_1008552972 | 129 |
| 71 | 3300009093 | Ga0105240_12043598 | Ga0105240_120435981 | 129 |
| 72 | 3300009098 | Ga0105245_10578710 | Ga0105245_105787101 | 129 |
| 73 | 3300009174 | Ga0105241_10286930 | Ga0105241_102869302 | 129 |
| 74 | 3300009545 | Ga0105237_10033934 | Ga0105237_100339343 | 129 |
| 75 | 3300009551 | Ga0105238_10351942 | Ga0105238_103519422 | 129 |
| 76 | 3300009551 | Ga0105238_11050577 | Ga0105238_110505771 | 129 |
| 77 | 3300009553 | Ga0105249_12109979 | Ga0105249_121099792 | 129 |
| 78 | 3300010375 | Ga0105239_10016687 | Ga0105239_100166872 | 129 |
| 79 | 3300010375 | Ga0105239_10224013 | Ga0105239_102240131 | 129 |
| 80 | 3300013105 | Ga0157369_10290349 | Ga0157369_102903492 | 129 |
| 81 | 3300013296 | Ga0157374_10142688 | Ga0157374_101426883 | 129 |
| 82 | 3300021361 | Ga0213872_10021164 | Ga0213872_100211642 | 129 |
| 83 | 3300025912 | Ga0207707_10077125 | Ga0207707_100771252 | 129 |
| 84 | 3300025914 | Ga0207671_10520013 | Ga0207671_105200132 | 129 |
| 85 | 3300025917 | Ga0207660_10523218 | Ga0207660_105232182 | 129 |
| 86 | 3300025917 | Ga0207660_11637753 | Ga0207660_116377531 | 129 |
| 87 | 3300025921 | Ga0207652_10100647 | Ga0207652_101006472 | 129 |
| 88 | 3300025924 | Ga0207694_11540167 | Ga0207694_115401671 | 129 |
| 89 | 3300025932 | Ga0207690_10238835 | Ga0207690_102388352 | 129 |
| 90 | 3300025939 | Ga0207665_10136638 | Ga0207665_101366382 | 129 |
| 91 | 3300025940 | Ga0207691_10849583 | Ga0207691_108495831 | 129 |
| 92 | 3300025942 | Ga0207689_10911461 | Ga0207689_109114611 | 129 |
| 93 | 3300025945 | Ga0207679_10116237 | Ga0207679_101162371 | 129 |
| 94 | 3300025961 | Ga0207712_10982713 | Ga0207712_109827132 | 129 |
| 95 | 3300025981 | Ga0207640_10911403 | Ga0207640_109114032 | 129 |
| 96 | 3300026023 | Ga0207677_10819256 | Ga0207677_108192562 | 129 |
| 97 | 3300026035 | Ga0207703_11271200 | Ga0207703_112712002 | 129 |
| 98 | 3300026041 | Ga0207639_10013232 | Ga0207639_100132322 | 129 |
| 99 | 3300026041 | Ga0207639_10189767 | Ga0207639_101897671 | 129 |
| 100 | 3300026078 | Ga0207702_10367696 | Ga0207702_103676962 | 129 |
| 101 | 3300026089 | Ga0207648_10283009 | Ga0207648_102830092 | 129 |
| 102 | 3300026116 | Ga0207674_10150649 | Ga0207674_101506492 | 129 |
| 103 | 3300028380 | Ga0268265_10233470 | Ga0268265_102334702 | 129 |
| 104 | 3300031239 | Ga0265328_10000839 | Ga0265328_1000083915 | 129 |
| 105 | 3300031239 | Ga0265328_10021475 | Ga0265328_100214753 | 129 |
| 106 | 3300031250 | Ga0265331_10000050 | Ga0265331_10000050114 | 129 |
| 107 | 3300031250 | Ga0265331_10003466 | Ga0265331_100034665 | 129 |
| 108 | 3300031251 | Ga0265327_10000109 | Ga0265327_10000109111 | 129 |
| 109 | 3300031251 | Ga0265327_10004575 | Ga0265327_100045752 | 129 |
| 110 | 3300031344 | Ga0265316_10238687 | Ga0265316_102386872 | 129 |
| 111 | 3300035120 | Ga0373957_0022817 | Ga0373957_0022817_910_1299 | 129 |
| 112 | 3300035242 | Ga0373962_0229417 | Ga0373962_0229417_197_586 | 129 |
| 113 | 3300035724 | Ga0373933_0211461 | Ga0373933_0211461_817_1206 | 129 |
| 114 | 3300036401 | Ga0373937_0019465 | Ga0373937_0019465_3717_4106 | 129 |
| 115 | 3300039447 | Ga0436361_0050017 | Ga0436361_0050017_12389_12784 | 129 |
| 116 | 3300041512 | Ga0451853_0874889 | Ga0451853_0874889_146_538 | 129 |
| 117 | 3300045051 | Ga0451576_1049256 | Ga0451576_1049256_320_709 | 129 |
| 118 | 3300048905 | Ga0496102_0418388 | Ga0496102_0418388_628_1017 | 129 |
| 119 | 3300048907 | Ga0496104_1106928 | Ga0496104_1106928_247_636 | 129 |
| 120 | 3300048913 | Ga0496110_0103024 | Ga0496110_0103024_1821_2210 | 129 |
| 121 | 3300048916 | Ga0496113_0862544 | Ga0496113_0862544_244_633 | 129 |
| 122 | 3300049823 | Ga0501044_1384132 | Ga0501044_1384132_80_472 | 129 |
| 123 | 3300050493 | nmdc:mga0k408_712_c1 | nmdc:mga0k408_712_c1_10397_10789 | 129 |
| 124 | 3300050512 | nmdc:mga0n895_565922_c1 | nmdc:mga0n895_565922_c1_315_704 | 129 |
| 125 | 3300005345 | Ga0070692_10230773 | Ga0070692_102307732 | 130 |
| 126 | 3300005435 | Ga0070714_100346772 | Ga0070714_1003467722 | 130 |
| 127 | 3300005436 | Ga0070713_101843916 | Ga0070713_1018439161 | 130 |
| 128 | 3300005439 | Ga0070711_100376169 | Ga0070711_1003761692 | 130 |
| 129 | 3300005441 | Ga0070700_100013966 | Ga0070700_1000139663 | 130 |
| 130 | 3300006038 | Ga0075365_10147554 | Ga0075365_101475543 | 130 |
| 131 | 3300006042 | Ga0075368_10002682 | Ga0075368_100026825 | 130 |
| 132 | 3300006048 | Ga0075363_100016443 | Ga0075363_1000164432 | 130 |
| 133 | 3300006051 | Ga0075364_10403081 | Ga0075364_104030812 | 130 |
| 134 | 3300006175 | Ga0070712_100391971 | Ga0070712_1003919712 | 130 |
| 135 | 3300006177 | Ga0075362_10032262 | Ga0075362_100322622 | 130 |
| 136 | 3300006178 | Ga0075367_10068609 | Ga0075367_100686092 | 130 |
| 137 | 3300006186 | Ga0075369_10058580 | Ga0075369_100585802 | 130 |
| 138 | 3300006195 | Ga0075366_10331180 | Ga0075366_103311802 | 130 |
| 139 | 3300006914 | Ga0075436_100073902 | Ga0075436_1000739023 | 130 |
| 140 | 3300009148 | Ga0105243_10168466 | Ga0105243_101684661 | 130 |
| 141 | 3300025915 | Ga0207693_10519131 | Ga0207693_105191311 | 130 |
| 142 | 3300025916 | Ga0207663_10662030 | Ga0207663_106620302 | 130 |
| 143 | 3300025928 | Ga0207700_11085143 | Ga0207700_110851431 | 130 |
| 144 | 3300025929 | Ga0207664_10527148 | Ga0207664_105271482 | 130 |
| 145 | 3300025938 | Ga0207704_10759876 | Ga0207704_107598762 | 130 |
| 146 | 3300026075 | Ga0207708_10033659 | Ga0207708_100336592 | 130 |
| 147 | 3300027866 | Ga0209813_10084750 | Ga0209813_100847501 | 130 |
| 148 | 3300031239 | Ga0265328_10134913 | Ga0265328_101349132 | 130 |
| 149 | 3300035692 | Ga0373935_0573763 | Ga0373935_0573763_249_641 | 130 |
| 150 | 3300046459 | Ga0495629_0319230 | Ga0495629_0319230_602_994 | 130 |
| 151 | 3300046681 | Ga0495647_0516737 | Ga0495647_0516737_31_423 | 130 |
| 152 | 3300049569 | Ga0501032_0012634 | Ga0501032_0012634_632_1027 | 130 |
| 153 | 3300049571 | Ga0501034_0184133 | Ga0501034_0184133_254_649 | 130 |
| 154 | 3300049574 | Ga0501038_0027558 | Ga0501038_0027558_407_802 | 130 |
| 155 | 3300049575 | Ga0501039_0021126 | Ga0501039_0021126_214_609 | 130 |
| 156 | 3300049580 | Ga0501046_0321700 | Ga0501046_0321700_507_902 | 130 |
| 157 | 3300049580 | Ga0501046_0575473 | Ga0501046_0575473_233_634 | 130 |
| 158 | 3300049581 | Ga0501047_0005455 | Ga0501047_0005455_5284_5685 | 130 |
| 159 | 3300049583 | Ga0501067_0163311 | Ga0501067_0163311_616_1017 | 130 |
| 160 | 3300049585 | Ga0501069_0001064 | Ga0501069_0001064_8686_9087 | 130 |
| 161 | 3300049586 | Ga0501070_0001356 | Ga0501070_0001356_7296_7697 | 130 |
| 162 | 3300049589 | Ga0501073_0000321 | Ga0501073_0000321_17505_17906 | 130 |
| 163 | 3300049589 | Ga0501073_0172366 | Ga0501073_0172366_266_658 | 130 |
| 164 | 3300049590 | Ga0501074_0000097 | Ga0501074_0000097_27652_28053 | 130 |
| 165 | 3300049741 | Ga0501079_0010889 | Ga0501079_0010889_3043_3444 | 130 |
| 166 | 3300049742 | Ga0501080_0004551 | Ga0501080_0004551_10627_11028 | 130 |
| 167 | 3300049822 | Ga0501035_0157358 | Ga0501035_0157358_1173_1568 | 130 |
| 168 | 3300049822 | Ga0501035_0433143 | Ga0501035_0433143_456_851 | 130 |
| 169 | 3300049823 | Ga0501044_0164945 | Ga0501044_0164945_1599_2000 | 130 |
| 170 | 3300049824 | Ga0501045_0963725 | Ga0501045_0963725_34_435 | 130 |
| 171 | 3300050490 | nmdc:mga03n38_323226_c1 | nmdc:mga03n38_323226_c1_386_781 | 130 |
| 172 | 3300050491 | nmdc:mga00v17_372343_c1 | nmdc:mga00v17_372343_c1_21_416 | 130 |
| 173 | 3300050492 | nmdc:mga0yw44_7154_c1 | nmdc:mga0yw44_7154_c1_3483_3878 | 130 |
| 174 | 3300050493 | nmdc:mga0k408_24801_c1 | nmdc:mga0k408_24801_c1_2065_2460 | 130 |
| 175 | 3300050494 | nmdc:mga06z11_32248_c1 | nmdc:mga06z11_32248_c1_934_1329 | 130 |
| 176 | 3300050495 | nmdc:mga04h51_63514_c1 | nmdc:mga04h51_63514_c1_727_1122 | 130 |
| 177 | 3300050496 | nmdc:mga07m45_85577_c1 | nmdc:mga07m45_85577_c1_357_752 | 130 |
| 178 | 3300050516 | nmdc:mga0sz30_320539_c1 | nmdc:mga0sz30_320539_c1_287_682 | 130 |
| 179 | 3300053108 | Ga0500562_175927 | Ga0500562_175927_24_419 | 130 |
| 180 | 3300053118 | Ga0500594_0039541 | Ga0500594_0039541_217_612 | 130 |
| 181 | 3300005329 | Ga0070683_100184513 | Ga0070683_1001845132 | 131 |
| 182 | 3300005336 | Ga0070680_100702174 | Ga0070680_1007021742 | 131 |
| 183 | 3300005337 | Ga0070682_100048033 | Ga0070682_1000480333 | 131 |
| 184 | 3300005468 | Ga0070707_101050549 | Ga0070707_1010505492 | 131 |
| 185 | 3300005536 | Ga0070697_100106944 | Ga0070697_1001069442 | 131 |
| 186 | 3300005539 | Ga0068853_100461883 | Ga0068853_1004618831 | 131 |
| 187 | 3300005546 | Ga0070696_102007097 | Ga0070696_1020070971 | 131 |
| 188 | 3300005549 | Ga0070704_100117650 | Ga0070704_1001176501 | 131 |
| 189 | 3300005563 | Ga0068855_100017369 | Ga0068855_1000173695 | 131 |
| 190 | 3300005563 | Ga0068855_101356818 | Ga0068855_1013568181 | 131 |
| 191 | 3300005564 | Ga0070664_101469755 | Ga0070664_1014697551 | 131 |
| 192 | 3300005614 | Ga0068856_100033727 | Ga0068856_1000337271 | 131 |
| 193 | 3300005614 | Ga0068856_100123081 | Ga0068856_1001230812 | 131 |
| 194 | 3300005834 | Ga0068851_10120112 | Ga0068851_101201122 | 131 |
| 195 | 3300005842 | Ga0068858_100832406 | Ga0068858_1008324062 | 131 |
| 196 | 3300006038 | Ga0075365_10678944 | Ga0075365_106789442 | 131 |
| 197 | 3300006048 | Ga0075363_100150445 | Ga0075363_1001504452 | 131 |
| 198 | 3300006051 | Ga0075364_10617633 | Ga0075364_106176332 | 131 |
| 199 | 3300006163 | Ga0070715_10224445 | Ga0070715_102244452 | 131 |
| 200 | 3300006178 | Ga0075367_10240455 | Ga0075367_102404552 | 131 |
| 201 | 3300006195 | Ga0075366_10048007 | Ga0075366_100480072 | 131 |
| 202 | 3300006852 | Ga0075433_11246386 | Ga0075433_112463862 | 131 |
| 203 | 3300006914 | Ga0075436_100056376 | Ga0075436_1000563762 | 131 |
| 204 | 3300007265 | Ga0099794_10015066 | Ga0099794_100150661 | 131 |
| 205 | 3300007265 | Ga0099794_10025195 | Ga0099794_100251952 | 131 |
| 206 | 3300007265 | Ga0099794_10355689 | Ga0099794_103556892 | 131 |
| 207 | 3300009093 | Ga0105240_10003296 | Ga0105240_100032962 | 131 |
| 208 | 3300009545 | Ga0105237_11058780 | Ga0105237_110587801 | 131 |
| 209 | 3300013100 | Ga0157373_10658576 | Ga0157373_106585762 | 131 |
| 210 | 3300013105 | Ga0157369_10473252 | Ga0157369_104732521 | 131 |
| 211 | 3300014497 | Ga0182008_10018284 | Ga0182008_100182842 | 131 |
| 212 | 3300025321 | Ga0207656_10001500 | Ga0207656_100015001 | 131 |
| 213 | 3300025911 | Ga0207654_10324969 | Ga0207654_103249692 | 131 |
| 214 | 3300025912 | Ga0207707_10806939 | Ga0207707_108069391 | 131 |
| 215 | 3300025913 | Ga0207695_10009540 | Ga0207695_100095402 | 131 |
| 216 | 3300025924 | Ga0207694_10015938 | Ga0207694_1001593810 | 131 |
| 217 | 3300025944 | Ga0207661_10841865 | Ga0207661_108418651 | 131 |
| 218 | 3300025949 | Ga0207667_10011637 | Ga0207667_100116376 | 131 |
| 219 | 3300026035 | Ga0207703_10489216 | Ga0207703_104892162 | 131 |
| 220 | 3300026067 | Ga0207678_10082772 | Ga0207678_100827723 | 131 |
| 221 | 3300026078 | Ga0207702_10015403 | Ga0207702_100154032 | 131 |
| 222 | 3300026078 | Ga0207702_10272295 | Ga0207702_102722952 | 131 |
| 223 | 3300027671 | Ga0209588_1009253 | Ga0209588_10092535 | 131 |
| 224 | 3300027671 | Ga0209588_1157021 | Ga0209588_11570211 | 131 |
| 225 | 3300027671 | Ga0209588_1233763 | Ga0209588_12337632 | 131 |
| 226 | 3300030521 | Ga0307511_10000653 | Ga0307511_1000065330 | 131 |
| 227 | 3300031238 | Ga0265332_10048865 | Ga0265332_100488652 | 131 |
| 228 | 3300035117 | Ga0373953_0033407 | Ga0373953_0033407_594_992 | 131 |
| 229 | 3300035118 | Ga0373954_0093041 | Ga0373954_0093041_247_645 | 131 |
| 230 | 3300035119 | Ga0373956_0059357 | Ga0373956_0059357_463_861 | 131 |
| 231 | 3300035120 | Ga0373957_0035427 | Ga0373957_0035427_806_1204 | 131 |
| 232 | 3300035172 | Ga0373955_0025822 | Ga0373955_0025822_1694_2092 | 131 |
| 233 | 3300035172 | Ga0373955_0671310 | Ga0373955_0671310_41_439 | 131 |
| 234 | 3300035692 | Ga0373935_1196402 | Ga0373935_1196402_71_469 | 131 |
| 235 | 3300035724 | Ga0373933_0013960 | Ga0373933_0013960_1018_1416 | 131 |
| 236 | 3300036401 | Ga0373937_0059217 | Ga0373937_0059217_589_987 | 131 |
| 237 | 3300036401 | Ga0373937_0395335 | Ga0373937_0395335_811_1209 | 131 |
| 238 | 3300044712 | Ga0453684_0846607 | Ga0453684_0846607_182_580 | 131 |
| 239 | 3300046511 | Ga0495608_0103787 | Ga0495608_0103787_1266_1664 | 131 |
| 240 | 3300046516 | Ga0495628_0006157 | Ga0495628_0006157_7143_7541 | 131 |
| 241 | 3300046517 | Ga0495630_0110176 | Ga0495630_0110176_670_1068 | 131 |
| 242 | 3300046533 | Ga0495640_0418098 | Ga0495640_0418098_290_688 | 131 |
| 243 | 3300046535 | Ga0495586_0043984 | Ga0495586_0043984_989_1387 | 131 |
| 244 | 3300046543 | Ga0495645_0204491 | Ga0495645_0204491_689_1087 | 131 |
| 245 | 3300046557 | Ga0495622_0268605 | Ga0495622_0268605_132_530 | 131 |
| 246 | 3300046559 | Ga0495667_0023519 | Ga0495667_0023519_1018_1416 | 131 |
| 247 | 3300046675 | Ga0495657_0146887 | Ga0495657_0146887_185_583 | 131 |
| 248 | 3300046680 | Ga0495646_0340110 | Ga0495646_0340110_95_493 | 131 |
| 249 | 3300046809 | Ga0495600_0073469 | Ga0495600_0073469_602_1000 | 131 |
| 250 | 3300047317 | Ga0495604_0039043 | Ga0495604_0039043_759_1157 | 131 |
| 251 | 3300047318 | Ga0495636_0103288 | Ga0495636_0103288_592_990 | 131 |
| 252 | 3300047322 | Ga0495680_0172127 | Ga0495680_0172127_791_1189 | 131 |
| 253 | 3300047444 | Ga0495675_0365813 | Ga0495675_0365813_367_765 | 131 |
| 254 | 3300047471 | Ga0495684_0133481 | Ga0495684_0133481_746_1144 | 131 |
| 255 | 3300050492 | nmdc:mga0yw44_424857_c1 | nmdc:mga0yw44_424857_c1_167_565 | 131 |
| 256 | 3300050514 | nmdc:mga08x19_46810_c1 | nmdc:mga08x19_46810_c1_1364_1762 | 131 |
| 257 | 3300050514 | nmdc:mga08x19_63870_c1 | nmdc:mga08x19_63870_c1_1857_2255 | 131 |
| 258 | 3300050516 | nmdc:mga0sz30_53980_c2 | nmdc:mga0sz30_53980_c2_205_603 | 131 |
| 259 | 3300053077 | Ga0495601_0013569 | Ga0495601_0013569_2216_2614 | 131 |
| 260 | 3300053085 | Ga0495619_0507115 | Ga0495619_0507115_123_521 | 131 |
| 261 | 3300053090 | Ga0500646_0000869 | Ga0500646_0000869_7369_7767 | 131 |
| 262 | 3300053092 | Ga0500583_0002645 | Ga0500583_0002645_355_753 | 131 |
| 263 | 3300053092 | Ga0500583_0329071 | Ga0500583_0329071_17_415 | 131 |
| 264 | 3300053093 | Ga0500651_0515900 | Ga0500651_0515900_33_431 | 131 |
| 265 | 3300053130 | Ga0500642_0181849 | Ga0500642_0181849_302_700 | 131 |
| 266 | 3300053133 | Ga0500655_018398 | Ga0500655_018398_693_1091 | 131 |
| 267 | 3300053151 | Ga0500604_0000727 | Ga0500604_0000727_354_752 | 131 |
| 268 | 3300053730 | Ga0500645_154259 | Ga0500645_154259_27_425 | 131 |
| 269 | 3300005328 | Ga0070676_10782145 | Ga0070676_107821451 | 132 |
| 270 | 3300005353 | Ga0070669_100932473 | Ga0070669_1009324731 | 132 |
| 271 | 3300005356 | Ga0070674_100261564 | Ga0070674_1002615642 | 132 |
| 272 | 3300005364 | Ga0070673_100719881 | Ga0070673_1007198812 | 132 |
| 273 | 3300005438 | Ga0070701_10482390 | Ga0070701_104823901 | 132 |
| 274 | 3300005441 | Ga0070700_100579275 | Ga0070700_1005792752 | 132 |
| 275 | 3300005459 | Ga0068867_100328275 | Ga0068867_1003282751 | 132 |
| 276 | 3300005530 | Ga0070679_100151965 | Ga0070679_1001519652 | 132 |
| 277 | 3300005546 | Ga0070696_100953509 | Ga0070696_1009535092 | 132 |
| 278 | 3300005578 | Ga0068854_100562680 | Ga0068854_1005626802 | 132 |
| 279 | 3300005615 | Ga0070702_100616451 | Ga0070702_1006164511 | 132 |
| 280 | 3300006844 | Ga0075428_100884281 | Ga0075428_1008842811 | 132 |
| 281 | 3300006881 | Ga0068865_101025001 | Ga0068865_1010250012 | 132 |
| 282 | 3300009098 | Ga0105245_11358064 | Ga0105245_113580642 | 132 |
| 283 | 3300009176 | Ga0105242_10941765 | Ga0105242_109417651 | 132 |
| 284 | 3300013100 | Ga0157373_10014959 | Ga0157373_100149596 | 132 |
| 285 | 3300013296 | Ga0157374_10144200 | Ga0157374_101442003 | 132 |
| 286 | 3300013297 | Ga0157378_10715357 | Ga0157378_107153572 | 132 |
| 287 | 3300013307 | Ga0157372_11123795 | Ga0157372_111237952 | 132 |
| 288 | 3300014969 | Ga0157376_10618976 | Ga0157376_106189762 | 132 |
| 289 | 3300025906 | Ga0207699_10850384 | Ga0207699_108503842 | 132 |
| 290 | 3300025920 | Ga0207649_10463214 | Ga0207649_104632142 | 132 |
| 291 | 3300025934 | Ga0207686_11057720 | Ga0207686_110577202 | 132 |
| 292 | 3300025937 | Ga0207669_10050079 | Ga0207669_100500792 | 132 |
| 293 | 3300026089 | Ga0207648_10870773 | Ga0207648_108707731 | 132 |
| 294 | 3300026121 | Ga0207683_10040680 | Ga0207683_100406802 | 132 |
| 295 | 3300037068 | Ga0373925_0585040 | Ga0373925_0585040_292_690 | 132 |
| 296 | 3300046539 | Ga0495621_0412732 | Ga0495621_0412732_110_511 | 132 |
| 297 | 3300049568 | Ga0501031_0011216 | Ga0501031_0011216_3132_3530 | 132 |
| 298 | 3300049569 | Ga0501032_0003598 | Ga0501032_0003598_7436_7834 | 132 |
| 299 | 3300049570 | Ga0501033_0001817 | Ga0501033_0001817_14236_14634 | 132 |
| 300 | 3300049570 | Ga0501033_0004521 | Ga0501033_0004521_6741_7139 | 132 |
| 301 | 3300049570 | Ga0501033_0029294 | Ga0501033_0029294_503_901 | 132 |
| 302 | 3300049571 | Ga0501034_0003361 | Ga0501034_0003361_14236_14634 | 132 |
| 303 | 3300049572 | Ga0501036_0002120 | Ga0501036_0002120_14231_14629 | 132 |
| 304 | 3300049572 | Ga0501036_0010828 | Ga0501036_0010828_391_789 | 132 |
| 305 | 3300049572 | Ga0501036_0159394 | Ga0501036_0159394_437_835 | 132 |
| 306 | 3300049573 | Ga0501037_0001263 | Ga0501037_0001263_4006_4404 | 132 |
| 307 | 3300049573 | Ga0501037_0169944 | Ga0501037_0169944_217_615 | 132 |
| 308 | 3300049573 | Ga0501037_0431822 | Ga0501037_0431822_226_624 | 132 |
| 309 | 3300049574 | Ga0501038_0003243 | Ga0501038_0003243_4006_4404 | 132 |
| 310 | 3300049574 | Ga0501038_0004836 | Ga0501038_0004836_3742_4140 | 132 |
| 311 | 3300049574 | Ga0501038_0009205 | Ga0501038_0009205_4792_5190 | 132 |
| 312 | 3300049575 | Ga0501039_0022190 | Ga0501039_0022190_2743_3141 | 132 |
| 313 | 3300049575 | Ga0501039_0382628 | Ga0501039_0382628_192_590 | 132 |
| 314 | 3300049578 | Ga0501042_0000031 | Ga0501042_0000031_4294_4692 | 132 |
| 315 | 3300049579 | Ga0501043_0000157 | Ga0501043_0000157_57787_58185 | 132 |
| 316 | 3300049579 | Ga0501043_0012057 | Ga0501043_0012057_3365_3763 | 132 |
| 317 | 3300049579 | Ga0501043_0012117 | Ga0501043_0012117_3231_3629 | 132 |
| 318 | 3300049580 | Ga0501046_0002577 | Ga0501046_0002577_14215_14613 | 132 |
| 319 | 3300049580 | Ga0501046_0078124 | Ga0501046_0078124_758_1156 | 132 |
| 320 | 3300049581 | Ga0501047_0002207 | Ga0501047_0002207_4006_4404 | 132 |
| 321 | 3300049581 | Ga0501047_0262852 | Ga0501047_0262852_428_826 | 132 |
| 322 | 3300049582 | Ga0501048_0002716 | Ga0501048_0002716_3977_4375 | 132 |
| 323 | 3300049584 | Ga0501068_0026149 | Ga0501068_0026149_259_657 | 132 |
| 324 | 3300049584 | Ga0501068_0596027 | Ga0501068_0596027_297_695 | 132 |
| 325 | 3300049586 | Ga0501070_1090978 | Ga0501070_1090978_191_589 | 132 |
| 326 | 3300049742 | Ga0501080_0880816 | Ga0501080_0880816_328_726 | 132 |
| 327 | 3300049822 | Ga0501035_0000671 | Ga0501035_0000671_4092_4490 | 132 |
| 328 | 3300049822 | Ga0501035_0022817 | Ga0501035_0022817_1652_2050 | 132 |
| 329 | 3300049822 | Ga0501035_0031902 | Ga0501035_0031902_2052_2450 | 132 |
| 330 | 3300049823 | Ga0501044_0000747 | Ga0501044_0000747_36419_36817 | 132 |
| 331 | 3300049823 | Ga0501044_0029513 | Ga0501044_0029513_3719_4117 | 132 |
| 332 | 3300049823 | Ga0501044_0167932 | Ga0501044_0167932_818_1216 | 132 |
| 333 | 3300049824 | Ga0501045_1402428 | Ga0501045_1402428_22_420 | 132 |
| 334 | 3300005333 | Ga0070677_10318353 | Ga0070677_103183531 | 133 |
| 335 | 3300005334 | Ga0068869_100000239 | Ga0068869_10000023914 | 133 |
| 336 | 3300005335 | Ga0070666_10437128 | Ga0070666_104371281 | 133 |
| 337 | 3300005338 | Ga0068868_100197383 | Ga0068868_1001973832 | 133 |
| 338 | 3300005343 | Ga0070687_100123981 | Ga0070687_1001239812 | 133 |
| 339 | 3300005347 | Ga0070668_100914534 | Ga0070668_1009145341 | 133 |
| 340 | 3300005355 | Ga0070671_100482469 | Ga0070671_1004824691 | 133 |
| 341 | 3300005356 | Ga0070674_100105296 | Ga0070674_1001052961 | 133 |
| 342 | 3300005364 | Ga0070673_100118890 | Ga0070673_1001188901 | 133 |
| 343 | 3300005367 | Ga0070667_100241938 | Ga0070667_1002419382 | 133 |
| 344 | 3300005440 | Ga0070705_101686929 | Ga0070705_1016869291 | 133 |
| 345 | 3300005456 | Ga0070678_100032926 | Ga0070678_1000329262 | 133 |
| 346 | 3300005459 | Ga0068867_100515036 | Ga0068867_1005150361 | 133 |
| 347 | 3300005547 | Ga0070693_100837410 | Ga0070693_1008374102 | 133 |
| 348 | 3300005617 | Ga0068859_100148571 | Ga0068859_1001485711 | 133 |
| 349 | 3300005618 | Ga0068864_100054268 | Ga0068864_1000542682 | 133 |
| 350 | 3300005719 | Ga0068861_100156950 | Ga0068861_1001569501 | 133 |
| 351 | 3300005841 | Ga0068863_100005897 | Ga0068863_1000058976 | 133 |
| 352 | 3300005842 | Ga0068858_100027257 | Ga0068858_1000272572 | 133 |
| 353 | 3300005844 | Ga0068862_100073979 | Ga0068862_1000739792 | 133 |
| 354 | 3300006358 | Ga0068871_100003989 | Ga0068871_10000398917 | 133 |
| 355 | 3300006931 | Ga0097620_100148573 | Ga0097620_1001485734 | 133 |
| 356 | 3300009011 | Ga0105251_10462060 | Ga0105251_104620601 | 133 |
| 357 | 3300009093 | Ga0105240_10070801 | Ga0105240_100708012 | 133 |
| 358 | 3300009098 | Ga0105245_10044453 | Ga0105245_100444534 | 133 |
| 359 | 3300009098 | Ga0105245_10187258 | Ga0105245_101872583 | 133 |
| 360 | 3300009148 | Ga0105243_10050853 | Ga0105243_100508532 | 133 |
| 361 | 3300009174 | Ga0105241_10133559 | Ga0105241_101335592 | 133 |
| 362 | 3300009545 | Ga0105237_10041822 | Ga0105237_100418225 | 133 |
| 363 | 3300010375 | Ga0105239_12319771 | Ga0105239_123197712 | 133 |
| 364 | 3300013297 | Ga0157378_10043202 | Ga0157378_100432023 | 133 |
| 365 | 3300013306 | Ga0163162_10841329 | Ga0163162_108413292 | 133 |
| 366 | 3300013308 | Ga0157375_10050523 | Ga0157375_100505234 | 133 |
| 367 | 3300014326 | Ga0157380_10710913 | Ga0157380_107109132 | 133 |
| 368 | 3300014968 | Ga0157379_10125264 | Ga0157379_101252642 | 133 |
| 369 | 3300014969 | Ga0157376_10051732 | Ga0157376_100517322 | 133 |
| 370 | 3300025899 | Ga0207642_10125207 | Ga0207642_101252072 | 133 |
| 371 | 3300025903 | Ga0207680_10374569 | Ga0207680_103745692 | 133 |
| 372 | 3300025914 | Ga0207671_10017161 | Ga0207671_100171612 | 133 |
| 373 | 3300025918 | Ga0207662_10202198 | Ga0207662_102021982 | 133 |
| 374 | 3300025927 | Ga0207687_10062240 | Ga0207687_100622402 | 133 |
| 375 | 3300025934 | Ga0207686_10113674 | Ga0207686_101136742 | 133 |
| 376 | 3300025935 | Ga0207709_10451427 | Ga0207709_104514271 | 133 |
| 377 | 3300025942 | Ga0207689_10000370 | Ga0207689_1000037030 | 133 |
| 378 | 3300025960 | Ga0207651_10015447 | Ga0207651_100154472 | 133 |
| 379 | 3300025981 | Ga0207640_10591020 | Ga0207640_105910202 | 133 |
| 380 | 3300025986 | Ga0207658_10233208 | Ga0207658_102332082 | 133 |
| 381 | 3300026023 | Ga0207677_10006249 | Ga0207677_100062492 | 133 |
| 382 | 3300026041 | Ga0207639_10172407 | Ga0207639_101724071 | 133 |
| 383 | 3300026088 | Ga0207641_10190858 | Ga0207641_101908582 | 133 |
| 384 | 3300026095 | Ga0207676_10176567 | Ga0207676_101765672 | 133 |
| 385 | 3300026121 | Ga0207683_10038091 | Ga0207683_100380912 | 133 |
| 386 | 3300027717 | Ga0209998_10032618 | Ga0209998_100326182 | 133 |
| 387 | 3300028379 | Ga0268266_10149487 | Ga0268266_101494871 | 133 |
| 388 | 3300028380 | Ga0268265_10084722 | Ga0268265_100847222 | 133 |
| 389 | 3300028381 | Ga0268264_10083813 | Ga0268264_100838132 | 133 |
| 390 | 3300035695 | Ga0373927_0173010 | Ga0373927_0173010_494_895 | 133 |
| 391 | 3300005331 | Ga0070670_100041949 | Ga0070670_1000419497 | 134 |
| 392 | 3300005458 | Ga0070681_11193925 | Ga0070681_111939251 | 134 |
| 393 | 3300005459 | Ga0068867_101153455 | Ga0068867_1011534552 | 134 |
| 394 | 3300005563 | Ga0068855_100008416 | Ga0068855_1000084162 | 134 |
| 395 | 3300009093 | Ga0105240_11018909 | Ga0105240_110189092 | 134 |
| 396 | 3300009177 | Ga0105248_11835285 | Ga0105248_118352852 | 134 |
| 397 | 3300009553 | Ga0105249_11801180 | Ga0105249_118011802 | 134 |
| 398 | 3300013102 | Ga0157371_10549174 | Ga0157371_105491741 | 134 |
| 399 | 3300013104 | Ga0157370_10008784 | Ga0157370_100087846 | 134 |
| 400 | 3300025907 | Ga0207645_10693848 | Ga0207645_106938482 | 134 |
| 401 | 3300025912 | Ga0207707_11171241 | Ga0207707_111712411 | 134 |
| 402 | 3300025913 | Ga0207695_10529200 | Ga0207695_105292002 | 134 |
| 403 | 3300025925 | Ga0207650_10060557 | Ga0207650_100605573 | 134 |
| 404 | 3300025931 | Ga0207644_10986571 | Ga0207644_109865711 | 134 |
| 405 | 3300025949 | Ga0207667_10249444 | Ga0207667_102494443 | 134 |
| 406 | 3300026089 | Ga0207648_12178312 | Ga0207648_121783121 | 134 |
| 407 | 3300027360 | Ga0209969_1000383 | Ga0209969_10003838 | 134 |
| 408 | 3300027462 | Ga0210000_1016818 | Ga0210000_10168182 | 134 |
| 409 | 3300027543 | Ga0209999_1001158 | Ga0209999_10011586 | 134 |
| 410 | 3300027682 | Ga0209971_1003675 | Ga0209971_10036755 | 134 |
| 411 | 3300027876 | Ga0209974_10001043 | Ga0209974_1000104311 | 134 |
| 412 | 3300031901 | Ga0307406_10661368 | Ga0307406_106613682 | 134 |
| 413 | 3300039437 | Ga0436365_0854741 | Ga0436365_0854741_246_659 | 134 |
| 414 | 3300049584 | Ga0501068_0193725 | Ga0501068_0193725_689_1102 | 134 |
| 415 | 3300005331 | Ga0070670_100397325 | Ga0070670_1003973251 | 135 |
| 416 | 3300005338 | Ga0068868_100103199 | Ga0068868_1001031992 | 135 |
| 417 | 3300005343 | Ga0070687_100450898 | Ga0070687_1004508982 | 135 |
| 418 | 3300005344 | Ga0070661_100443759 | Ga0070661_1004437591 | 135 |
| 419 | 3300005345 | Ga0070692_10495726 | Ga0070692_104957262 | 135 |
| 420 | 3300005354 | Ga0070675_100517107 | Ga0070675_1005171072 | 135 |
| 421 | 3300005366 | Ga0070659_100961346 | Ga0070659_1009613462 | 135 |
| 422 | 3300005436 | Ga0070713_100670775 | Ga0070713_1006707751 | 135 |
| 423 | 3300005440 | Ga0070705_100827879 | Ga0070705_1008278792 | 135 |
| 424 | 3300005444 | Ga0070694_100431826 | Ga0070694_1004318262 | 135 |
| 425 | 3300005456 | Ga0070678_100217204 | Ga0070678_1002172042 | 135 |
| 426 | 3300005459 | Ga0068867_100230339 | Ga0068867_1002303392 | 135 |
| 427 | 3300005459 | Ga0068867_100521484 | Ga0068867_1005214841 | 135 |
| 428 | 3300005459 | Ga0068867_100735731 | Ga0068867_1007357312 | 135 |
| 429 | 3300005471 | Ga0070698_100575864 | Ga0070698_1005758641 | 135 |
| 430 | 3300005518 | Ga0070699_100954813 | Ga0070699_1009548131 | 135 |
| 431 | 3300005530 | Ga0070679_101219524 | Ga0070679_1012195241 | 135 |
| 432 | 3300005539 | Ga0068853_101142045 | Ga0068853_1011420451 | 135 |
| 433 | 3300005547 | Ga0070693_100367732 | Ga0070693_1003677322 | 135 |
| 434 | 3300005548 | Ga0070665_100239175 | Ga0070665_1002391752 | 135 |
| 435 | 3300005548 | Ga0070665_101484214 | Ga0070665_1014842142 | 135 |
| 436 | 3300005615 | Ga0070702_101270173 | Ga0070702_1012701731 | 135 |
| 437 | 3300005718 | Ga0068866_10021978 | Ga0068866_100219784 | 135 |
| 438 | 3300005840 | Ga0068870_10954823 | Ga0068870_109548231 | 135 |
| 439 | 3300005841 | Ga0068863_102167846 | Ga0068863_1021678461 | 135 |
| 440 | 3300005842 | Ga0068858_100009002 | Ga0068858_1000090022 | 135 |
| 441 | 3300005842 | Ga0068858_100083384 | Ga0068858_1000833842 | 135 |
| 442 | 3300005842 | Ga0068858_101201272 | Ga0068858_1012012722 | 135 |
| 443 | 3300006028 | Ga0070717_11004923 | Ga0070717_110049232 | 135 |
| 444 | 3300006051 | Ga0075364_11118474 | Ga0075364_111184741 | 135 |
| 445 | 3300006175 | Ga0070712_100468283 | Ga0070712_1004682832 | 135 |
| 446 | 3300006195 | Ga0075366_10071039 | Ga0075366_100710392 | 135 |
| 447 | 3300006353 | Ga0075370_10007567 | Ga0075370_100075678 | 135 |
| 448 | 3300006358 | Ga0068871_100041716 | Ga0068871_1000417164 | 135 |
| 449 | 3300006358 | Ga0068871_100992503 | Ga0068871_1009925031 | 135 |
| 450 | 3300006844 | Ga0075428_100051648 | Ga0075428_1000516485 | 135 |
| 451 | 3300006871 | Ga0075434_100025576 | Ga0075434_1000255761 | 135 |
| 452 | 3300006871 | Ga0075434_100429316 | Ga0075434_1004293162 | 135 |
| 453 | 3300007076 | Ga0075435_101610583 | Ga0075435_1016105831 | 135 |
| 454 | 3300009093 | Ga0105240_11952901 | Ga0105240_119529011 | 135 |
| 455 | 3300009094 | Ga0111539_10004777 | Ga0111539_100047776 | 135 |
| 456 | 3300009094 | Ga0111539_11074802 | Ga0111539_110748022 | 135 |
| 457 | 3300009101 | Ga0105247_10440622 | Ga0105247_104406222 | 135 |
| 458 | 3300009148 | Ga0105243_10535911 | Ga0105243_105359112 | 135 |
| 459 | 3300009174 | Ga0105241_11543553 | Ga0105241_115435532 | 135 |
| 460 | 3300009174 | Ga0105241_12038162 | Ga0105241_120381621 | 135 |
| 461 | 3300009176 | Ga0105242_10006123 | Ga0105242_100061232 | 135 |
| 462 | 3300009176 | Ga0105242_10081256 | Ga0105242_100812563 | 135 |
| 463 | 3300009176 | Ga0105242_10249820 | Ga0105242_102498201 | 135 |
| 464 | 3300009177 | Ga0105248_10062805 | Ga0105248_100628053 | 135 |
| 465 | 3300009177 | Ga0105248_10539955 | Ga0105248_105399552 | 135 |
| 466 | 3300009545 | Ga0105237_10600948 | Ga0105237_106009482 | 135 |
| 467 | 3300009545 | Ga0105237_11090614 | Ga0105237_110906142 | 135 |
| 468 | 3300009551 | Ga0105238_10492404 | Ga0105238_104924042 | 135 |
| 469 | 3300009551 | Ga0105238_10690610 | Ga0105238_106906102 | 135 |
| 470 | 3300009551 | Ga0105238_10786215 | Ga0105238_107862152 | 135 |
| 471 | 3300012480 | Ga0157346_1012824 | Ga0157346_10128242 | 135 |
| 472 | 3300012482 | Ga0157318_1013691 | Ga0157318_10136911 | 135 |
| 473 | 3300012510 | Ga0157316_1064741 | Ga0157316_10647411 | 135 |
| 474 | 3300013296 | Ga0157374_11689795 | Ga0157374_116897951 | 135 |
| 475 | 3300013297 | Ga0157378_11216466 | Ga0157378_112164661 | 135 |
| 476 | 3300013306 | Ga0163162_10113966 | Ga0163162_101139662 | 135 |
| 477 | 3300013306 | Ga0163162_10621849 | Ga0163162_106218492 | 135 |
| 478 | 3300013306 | Ga0163162_11162680 | Ga0163162_111626802 | 135 |
| 479 | 3300014325 | Ga0163163_11579056 | Ga0163163_115790562 | 135 |
| 480 | 3300014326 | Ga0157380_10619532 | Ga0157380_106195322 | 135 |
| 481 | 3300014745 | Ga0157377_10124346 | Ga0157377_101243461 | 135 |
| 482 | 3300014968 | Ga0157379_10068146 | Ga0157379_100681463 | 135 |
| 483 | 3300014969 | Ga0157376_10763873 | Ga0157376_107638732 | 135 |
| 484 | 3300017792 | Ga0163161_10628811 | Ga0163161_106288112 | 135 |
| 485 | 3300021384 | Ga0213876_10162750 | Ga0213876_101627502 | 135 |
| 486 | 3300025901 | Ga0207688_10061781 | Ga0207688_100617813 | 135 |
| 487 | 3300025909 | Ga0207705_10668060 | Ga0207705_106680602 | 135 |
| 488 | 3300025911 | Ga0207654_10562009 | Ga0207654_105620091 | 135 |
| 489 | 3300025912 | Ga0207707_10049882 | Ga0207707_100498822 | 135 |
| 490 | 3300025914 | Ga0207671_11163078 | Ga0207671_111630781 | 135 |
| 491 | 3300025915 | Ga0207693_10304221 | Ga0207693_103042212 | 135 |
| 492 | 3300025916 | Ga0207663_10056311 | Ga0207663_100563112 | 135 |
| 493 | 3300025918 | Ga0207662_10320382 | Ga0207662_103203822 | 135 |
| 494 | 3300025921 | Ga0207652_11096441 | Ga0207652_110964411 | 135 |
| 495 | 3300025923 | Ga0207681_10575209 | Ga0207681_105752091 | 135 |
| 496 | 3300025924 | Ga0207694_10428260 | Ga0207694_104282602 | 135 |
| 497 | 3300025924 | Ga0207694_10438924 | Ga0207694_104389242 | 135 |
| 498 | 3300025925 | Ga0207650_11378094 | Ga0207650_113780941 | 135 |
| 499 | 3300025926 | Ga0207659_10243675 | Ga0207659_102436753 | 135 |
| 500 | 3300025928 | Ga0207700_10107445 | Ga0207700_101074452 | 135 |
| 501 | 3300025931 | Ga0207644_10274777 | Ga0207644_102747772 | 135 |
| 502 | 3300025933 | Ga0207706_11225902 | Ga0207706_112259022 | 135 |
| 503 | 3300025934 | Ga0207686_10069757 | Ga0207686_100697572 | 135 |
| 504 | 3300025934 | Ga0207686_10333869 | Ga0207686_103338692 | 135 |
| 505 | 3300025937 | Ga0207669_11025655 | Ga0207669_110256551 | 135 |
| 506 | 3300025938 | Ga0207704_11394964 | Ga0207704_113949642 | 135 |
| 507 | 3300025940 | Ga0207691_10083916 | Ga0207691_100839162 | 135 |
| 508 | 3300025941 | Ga0207711_10040325 | Ga0207711_100403253 | 135 |
| 509 | 3300025986 | Ga0207658_10513691 | Ga0207658_105136911 | 135 |
| 510 | 3300026023 | Ga0207677_10207482 | Ga0207677_102074822 | 135 |
| 511 | 3300026035 | Ga0207703_10069578 | Ga0207703_100695781 | 135 |
| 512 | 3300026075 | Ga0207708_10789366 | Ga0207708_107893662 | 135 |
| 513 | 3300026078 | Ga0207702_11589147 | Ga0207702_115891471 | 135 |
| 514 | 3300026088 | Ga0207641_11353290 | Ga0207641_113532902 | 135 |
| 515 | 3300026088 | Ga0207641_11540651 | Ga0207641_115406511 | 135 |
| 516 | 3300026089 | Ga0207648_10090358 | Ga0207648_100903583 | 135 |
| 517 | 3300026089 | Ga0207648_10325469 | Ga0207648_103254692 | 135 |
| 518 | 3300026121 | Ga0207683_10111579 | Ga0207683_101115792 | 135 |
| 519 | 3300027866 | Ga0209813_10023151 | Ga0209813_100231512 | 135 |
| 520 | 3300027907 | Ga0207428_10007467 | Ga0207428_100074672 | 135 |
| 521 | 3300028379 | Ga0268266_10118435 | Ga0268266_101184353 | 135 |
| 522 | 3300028379 | Ga0268266_10199873 | Ga0268266_101998731 | 135 |
| 523 | 3300031344 | Ga0265316_10324601 | Ga0265316_103246012 | 135 |
| 524 | 3300031548 | Ga0307408_100293848 | Ga0307408_1002938482 | 135 |
| 525 | 3300031995 | Ga0307409_101363461 | Ga0307409_1013634612 | 135 |
| 526 | 3300035084 | Ga0373928_0127448 | Ga0373928_0127448_237_644 | 135 |
| 527 | 3300035112 | Ga0373932_0294181 | Ga0373932_0294181_37_444 | 135 |
| 528 | 3300035114 | Ga0373939_0327205 | Ga0373939_0327205_74_496 | 135 |
| 529 | 3300035207 | Ga0373942_0209632 | Ga0373942_0209632_207_614 | 135 |
| 530 | 3300036401 | Ga0373937_0057553 | Ga0373937_0057553_599_1006 | 135 |
| 531 | 3300039437 | Ga0436365_1601346 | Ga0436365_1601346_799_1206 | 135 |
| 532 | 3300041407 | Ga0439447_163493 | Ga0439447_163493_50_457 | 135 |
| 533 | 3300041443 | Ga0451789_1187517 | Ga0451789_1187517_133_540 | 135 |
| 534 | 3300041496 | Ga0451839_0692740 | Ga0451839_0692740_58_492 | 135 |
| 535 | 3300042876 | Ga0451577_1047828 | Ga0451577_1047828_63_470 | 135 |
| 536 | 3300046455 | Ga0495603_0562736 | Ga0495603_0562736_121_528 | 135 |
| 537 | 3300046528 | Ga0495642_0434036 | Ga0495642_0434036_60_467 | 135 |
| 538 | 3300046615 | Ga0495656_0795823 | Ga0495656_0795823_20_448 | 135 |
| 539 | 3300046616 | Ga0495668_0261270 | Ga0495668_0261270_404_826 | 135 |
| 540 | 3300048907 | Ga0496104_0035628 | Ga0496104_0035628_1553_1960 | 135 |
| 541 | 3300049578 | Ga0501042_0628147 | Ga0501042_0628147_271_708 | 135 |
| 542 | 3300050489 | nmdc:mga03683_309215_c1 | nmdc:mga03683_309215_c1_145_573 | 135 |
| 543 | 3300050493 | nmdc:mga0k408_14579_c1 | nmdc:mga0k408_14579_c1_2828_3235 | 135 |
| 544 | 3300050496 | nmdc:mga07m45_21342_c1 | nmdc:mga07m45_21342_c1_81_488 | 135 |
| 545 | 3300050507 | nmdc:mga05p37_460365_c1 | nmdc:mga05p37_460365_c1_839_1246 | 135 |
| 546 | 3300050509 | nmdc:mga0qj67_365204_c1 | nmdc:mga0qj67_365204_c1_220_627 | 135 |
| 547 | 3300050511 | nmdc:mga08y16_54336_c1 | nmdc:mga08y16_54336_c1_2337_2744 | 135 |
| 548 | 3300050512 | nmdc:mga0n895_16127_c1 | nmdc:mga0n895_16127_c1_174_608 | 135 |
| 549 | 3300050512 | nmdc:mga0n895_477872_c1 | nmdc:mga0n895_477872_c1_521_928 | 135 |
| 550 | 3300050513 | nmdc:mga0rr50_1490777_c1 | nmdc:mga0rr50_1490777_c1_14_448 | 135 |
| 551 | 3300050515 | nmdc:mga0a205_11320_c1 | nmdc:mga0a205_11320_c1_3332_3739 | 135 |
| 552 | 3300050516 | nmdc:mga0sz30_389495_c1 | nmdc:mga0sz30_389495_c1_43_465 | 135 |
| 553 | 3300053093 | Ga0500651_0262029 | Ga0500651_0262029_509_931 | 135 |
| 554 | 3300053096 | Ga0500641_0022818 | Ga0500641_0022818_1102_1530 | 135 |
| 555 | 3300005327 | Ga0070658_10897771 | Ga0070658_108977711 | 136 |
| 556 | 3300005329 | Ga0070683_100766444 | Ga0070683_1007664442 | 136 |
| 557 | 3300005366 | Ga0070659_100111138 | Ga0070659_1001111382 | 136 |
| 558 | 3300005437 | Ga0070710_10387403 | Ga0070710_103874032 | 136 |
| 559 | 3300005530 | Ga0070679_100078071 | Ga0070679_1000780712 | 136 |
| 560 | 3300005535 | Ga0070684_100986388 | Ga0070684_1009863882 | 136 |
| 561 | 3300005539 | Ga0068853_100811059 | Ga0068853_1008110592 | 136 |
| 562 | 3300005563 | Ga0068855_100019447 | Ga0068855_1000194478 | 136 |
| 563 | 3300005614 | Ga0068856_101054662 | Ga0068856_1010546621 | 136 |
| 564 | 3300005616 | Ga0068852_100013995 | Ga0068852_1000139953 | 136 |
| 565 | 3300005616 | Ga0068852_100057823 | Ga0068852_1000578232 | 136 |
| 566 | 3300005834 | Ga0068851_10050452 | Ga0068851_100504522 | 136 |
| 567 | 3300009094 | Ga0111539_10202435 | Ga0111539_102024351 | 136 |
| 568 | 3300010375 | Ga0105239_11159515 | Ga0105239_111595152 | 136 |
| 569 | 3300013102 | Ga0157371_10921248 | Ga0157371_109212481 | 136 |
| 570 | 3300013105 | Ga0157369_10470448 | Ga0157369_104704482 | 136 |
| 571 | 3300013307 | Ga0157372_10006865 | Ga0157372_100068652 | 136 |
| 572 | 3300020081 | Ga0206354_10063477 | Ga0206354_100634772 | 136 |
| 573 | 3300025909 | Ga0207705_10260813 | Ga0207705_102608132 | 136 |
| 574 | 3300025909 | Ga0207705_10468452 | Ga0207705_104684522 | 136 |
| 575 | 3300025932 | Ga0207690_10099810 | Ga0207690_100998102 | 136 |
| 576 | 3300025949 | Ga0207667_12083654 | Ga0207667_120836541 | 136 |
| 577 | 3300026041 | Ga0207639_10582061 | Ga0207639_105820612 | 136 |
| 578 | 3300026078 | Ga0207702_11052545 | Ga0207702_110525452 | 136 |
| 579 | 3300026142 | Ga0207698_10053328 | Ga0207698_100533283 | 136 |
| 580 | 3300026142 | Ga0207698_10478473 | Ga0207698_104784732 | 136 |
| 581 | 3300027907 | Ga0207428_10148918 | Ga0207428_101489183 | 136 |
| 582 | 3300037312 | Ga0395899_0171993 | Ga0395899_0171993_1085_1495 | 136 |
| 583 | 3300037418 | Ga0395900_0884280 | Ga0395900_0884280_268_678 | 136 |
| 584 | 3300037471 | Ga0395905_0013092 | Ga0395905_0013092_6168_6578 | 136 |
| 585 | 3300042876 | Ga0451577_1007827 | Ga0451577_1007827_164_601 | 136 |
| 586 | 3300050511 | nmdc:mga08y16_65090_c1 | nmdc:mga08y16_65090_c1_1370_1810 | 136 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7sfr-assembly1.cif.gz_N | unmethylated mtb ribosome 50s with seq-9 | 0.973 | 14 | 116 |
| 5xym-assembly1.cif.gz_N | large subunit of mycobacterium smegmatis | 0.9681 | 13 | 116 |
| 4v4p-assembly1.cif.gz_A0 | crystal structure of 70s ribosome with thrs operator and trnas. | 0.9502 | 14 | 117 |
| 4v4p-assembly1.cif.gz_A0 | crystal structure of 70s ribosome with thrs operator and trnas. | 0.933 | 14 | 117 |
| 8cvm-assembly1.cif.gz_m | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9319 | 10 | 116 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vt2N01 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9679 | 14 | 115 | 3.90.1030.10 |
| 5v7qN00 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9637 | 13 | 116 | 3.90.1030.10 |
| 1vs8N01 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9623 | 14 | 115 | 3.90.1030.10 |
| 1vt2N01 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9498 | 14 | 115 | 3.90.1030.10 |
| 1vs8N01 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9443 | 14 | 115 | 3.90.1030.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A4VDG7-F1-model_v4 | 50S ribosomal protein L17 | 0.9828 | 22 | 116 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A1F9ENG3-F1-model_v4 | 50S ribosomal protein L17 | 0.9828 | 20 | 114 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A2E2TK58-F1-model_v4 | 50S ribosomal protein L17 | 0.9823 | 23 | 118 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A5Q4FRT6-F1-model_v4 | Large ribosomal subunit protein bL17 | 0.9806 | 14 | 116 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A6J5Z5J0-F1-model_v4 | Unannotated protein | 0.98 | 14 | 116 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar