F466532

General Info

Members Datasets Scaffolds Average Seq Length
586 272 1172 302

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100061618|Ga0070665_1000616182
Length 305
Sequence MKASSILETIGNTPHIRVNRLFGDAEVWIKSERTNPGGSIKDRIALAMIEAAEASGDLKPGGTIIEPTSGNTGVGLAMVAAVKGYRLILVMPESMSVERRRLMLAYGASFDLTPREKGMKGAIERALELVDQTPNSWMPQQFENPANIDVHVRTTAQEIAADFADAPIDVLITGVGTGGHITGVAQVLKQLWPQLKVYAVEPTLSHVISGGQPGPHPIQGIGAGFIPANLHTQLLDGVIQVDPADAKDYARRAASEEGVLVGISSGATLAAIAQKLKELPAGSRVLGFNYDTGERYLSVPDFLPE

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
156 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
164 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
171 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
172 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
186 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
187 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
188 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
199 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
200 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
201 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
202 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
203 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
211 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
212 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
213 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
243 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
244 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
254 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
255 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
256 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 2547132374 Acidovorax radicis N35 Isolate Unclassified
259 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
260 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
261 2643221570 Acidovorax sp. Root568 Isolate Unclassified
262 2643221585 Pelomonas sp. Root662 Isolate Unclassified
263 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
264 2643221652 Acidovorax sp. Root402 Isolate Unclassified
265 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
266 2643221656 Pelomonas sp. Root405 Isolate Unclassified
267 2643221717 Acidovorax sp. Root267 Isolate Unclassified
268 2721755523 Delftia sp. HK171 Isolate Unclassified
269 2738541337 Pelomonas sp. BT06 Isolate Unclassified
270 2738543012 Acidovorax sp. CF301 Isolate Unclassified
271 2816332133 Acidovorax radicis 2721A Isolate Unclassified
272 2839138175 Delftia acidovorans B15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 0
Isolates 2.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.39
Nodule 0.34
Rhizoplane 4.61
Rhizosphere 85.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100061618 3300005548 Bacteria 3761
2 SwRhRL2b_contig_1290167 2162886007 Bacteria 2108
3 JGI24744J21845_10025542 3300002077 Bacteria 1151
4 Ga0065704_10004249 3300005289 Bacteria 9032
5 Ga0065712_10196714 3300005290 Bacteria 1125
6 Ga0070658_10011079 3300005327 Bacteria 7229
7 Ga0070658_10226082 3300005327 Bacteria 1584
8 Ga0070676_10053682 3300005328 Bacteria 2375
9 Ga0070676_10080888 3300005328 Bacteria 1971
10 Ga0070676_10140985 3300005328 Bacteria 1534
11 Ga0070683_100015058 3300005329 Bacteria 6785
12 Ga0070683_100173049 3300005329 Bacteria 2049
13 Ga0070690_100000651 3300005330 Bacteria 17695
14 Ga0070690_100070631 3300005330 Bacteria 2268
15 Ga0070690_100097736 3300005330 Bacteria 1943
16 Ga0070690_100169986 3300005330 Bacteria 1499
17 Ga0070670_100034239 3300005331 Bacteria 4371
18 Ga0070670_100060997 3300005331 Bacteria 3238
19 Ga0070670_100080639 3300005331 Bacteria 2796
20 Ga0070670_100093079 3300005331 Bacteria 2592
21 Ga0070677_10009793 3300005333 Bacteria 3260
22 Ga0070677_10083012 3300005333 Bacteria 1375
23 Ga0068869_100001401 3300005334 Bacteria 14244
24 Ga0068869_100005873 3300005334 Bacteria 7751
25 Ga0068869_100039477 3300005334 Bacteria 3370
26 Ga0068869_100044338 3300005334 Bacteria 3198
27 Ga0070680_100036578 3300005336 Bacteria 3966
28 Ga0070682_100078844 3300005337 Bacteria 2126
29 Ga0068868_100000439 3300005338 Bacteria 27952
30 Ga0068868_100006871 3300005338 Bacteria 8081
31 Ga0068868_100027204 3300005338 Bacteria 4362
32 Ga0068868_100030921 3300005338 Bacteria 4108
33 Ga0068868_100109092 3300005338 Bacteria 2247
34 Ga0068868_100163336 3300005338 Bacteria 1841
35 Ga0070660_100171670 3300005339 Bacteria 1752
36 Ga0070689_100001789 3300005340 Bacteria 13808
37 Ga0070689_100022218 3300005340 Bacteria 4735
38 Ga0070689_100066063 3300005340 Bacteria 2818
39 Ga0070689_100135304 3300005340 Bacteria 1979
40 Ga0070691_10006175 3300005341 Bacteria 5467
41 Ga0070687_100039502 3300005343 Bacteria 2372
42 Ga0070687_100089292 3300005343 Bacteria 1701
43 Ga0070687_100092633 3300005343 Bacteria 1675
44 Ga0070661_100005385 3300005344 Bacteria 8821
45 Ga0070661_100061902 3300005344 Bacteria 2747
46 Ga0070661_100087494 3300005344 Bacteria 2304
47 Ga0070669_100022578 3300005353 Bacteria 4499
48 Ga0070675_100001927 3300005354 Bacteria 15350
49 Ga0070675_100002165 3300005354 Bacteria 14527
50 Ga0070675_100003623 3300005354 Bacteria 11751
51 Ga0070675_100020207 3300005354 Bacteria 5314
52 Ga0070675_100046382 3300005354 Bacteria 3558
53 Ga0070671_100031280 3300005355 Bacteria 4395
54 Ga0070671_100039634 3300005355 Bacteria 3910
55 Ga0070671_100041682 3300005355 Bacteria 3815
56 Ga0070671_100098487 3300005355 Bacteria 2453
57 Ga0070674_100014881 3300005356 Bacteria 4843
58 Ga0070674_100037159 3300005356 Bacteria 3274
59 Ga0070674_100040856 3300005356 Bacteria 3139
60 Ga0070674_100159859 3300005356 Bacteria 1708
61 Ga0070673_100013975 3300005364 Bacteria 5575
62 Ga0070688_100011889 3300005365 Bacteria 4858
63 Ga0070659_100022263 3300005366 Bacteria 4836
64 Ga0070659_100068909 3300005366 Bacteria 2807
65 Ga0070659_100236894 3300005366 Bacteria 1509
66 Ga0070667_100000219 3300005367 Bacteria 66264
67 Ga0070667_100100758 3300005367 Bacteria 2495
68 Ga0070701_10001211 3300005438 Bacteria 9467
69 Ga0070701_10169471 3300005438 Bacteria 1270
70 Ga0070705_100031828 3300005440 Bacteria 2925
71 Ga0070700_100000784 3300005441 Bacteria 15661
72 Ga0070700_100003161 3300005441 Bacteria 8463
73 Ga0070694_100040337 3300005444 Bacteria 3112
74 Ga0070708_100160181 3300005445 Bacteria 2097
75 Ga0070663_100000127 3300005455 Bacteria 35963
76 Ga0070663_100038045 3300005455 Bacteria 3353
77 Ga0070663_100198683 3300005455 Bacteria 1564
78 Ga0070678_100016474 3300005456 Bacteria 4730
79 Ga0070678_100021761 3300005456 Bacteria 4235
80 Ga0070678_100175889 3300005456 Bacteria 1748
81 Ga0070678_100196870 3300005456 Bacteria 1660
82 Ga0070662_100054794 3300005457 Bacteria 2890
83 Ga0070662_100062034 3300005457 Bacteria 2730
84 Ga0068867_100000191 3300005459 Bacteria 40494
85 Ga0068867_100002519 3300005459 Bacteria 12885
86 Ga0068867_100086035 3300005459 Bacteria 2377
87 Ga0068867_100114357 3300005459 Bacteria 2077
88 Ga0070685_10017750 3300005466 Bacteria 3814
89 Ga0070685_10024345 3300005466 Bacteria 3324
90 Ga0070684_100034577 3300005535 Bacteria 4321
91 Ga0070684_100172039 3300005535 Bacteria 1967
92 Ga0068853_100009633 3300005539 Bacteria 7785
93 Ga0068853_100038715 3300005539 Bacteria 4062
94 Ga0070672_100000455 3300005543 Bacteria 23832
95 Ga0070672_100002919 3300005543 Bacteria 10995
96 Ga0070672_100005115 3300005543 Bacteria 8652
97 Ga0070672_100103955 3300005543 Bacteria 2307
98 Ga0070686_100000103 3300005544 Bacteria 58400
99 Ga0070695_100019666 3300005545 Bacteria 4115
100 Ga0070693_100015766 3300005547 Bacteria 3898
101 Ga0070665_100011648 3300005548 Bacteria 8888
102 Ga0070704_100024201 3300005549 Bacteria 3981
103 Ga0068855_100041737 3300005563 Bacteria 5436
104 Ga0068855_100168578 3300005563 Bacteria 2480
105 Ga0070664_100026911 3300005564 Bacteria 4776
106 Ga0070664_100095623 3300005564 Bacteria 2577
107 Ga0070664_100161563 3300005564 Bacteria 1982
108 Ga0068854_100095494 3300005578 Bacteria 2219
109 Ga0068854_100153274 3300005578 Bacteria 1779
110 Ga0068854_100296856 3300005578 Bacteria 1306
111 Ga0068856_100014048 3300005614 Bacteria 7742
112 Ga0068856_100267596 3300005614 Bacteria 1725
113 Ga0068856_100289712 3300005614 Bacteria 1654
114 Ga0070702_100000081 3300005615 Bacteria 27675
115 Ga0070702_100116519 3300005615 Bacteria 1665
116 Ga0068852_100010121 3300005616 Bacteria 7023
117 Ga0068852_100014760 3300005616 Bacteria 6030
118 Ga0068852_100048149 3300005616 Bacteria 3641
119 Ga0068852_100205635 3300005616 Bacteria 1865
120 Ga0068852_100381004 3300005616 Bacteria 1384
121 Ga0068859_100000560 3300005617 Bacteria 36894
122 Ga0068859_100034614 3300005617 Bacteria 5069
123 Ga0068859_100042950 3300005617 Bacteria 4542
124 Ga0068864_100000895 3300005618 Bacteria 25086
125 Ga0068864_100017183 3300005618 Bacteria 6033
126 Ga0068864_100017870 3300005618 Bacteria 5916
127 Ga0068864_100021458 3300005618 Bacteria 5411
128 Ga0068864_100021750 3300005618 Bacteria 5372
129 Ga0068864_100025048 3300005618 Bacteria 5022
130 Ga0068864_100027849 3300005618 Bacteria 4776
131 Ga0068864_100045997 3300005618 Bacteria 3744
132 Ga0068866_10000201 3300005718 Bacteria 28091
133 Ga0068866_10005486 3300005718 Bacteria 5238
134 Ga0068866_10015962 3300005718 Bacteria 3347
135 Ga0068866_10151419 3300005718 Bacteria 1344
136 Ga0068861_100002141 3300005719 Bacteria 12777
137 Ga0068861_100032122 3300005719 Bacteria 3862
138 Ga0068861_100087488 3300005719 Bacteria 2452
139 Ga0068861_100175058 3300005719 Bacteria 1781
140 Ga0068861_100245673 3300005719 Bacteria 1524
141 Ga0068851_10013154 3300005834 Bacteria 3914
142 Ga0068851_10082939 3300005834 Bacteria 1676
143 Ga0068851_10138061 3300005834 Bacteria 1323
144 Ga0068870_10002727 3300005840 Bacteria 7411
145 Ga0068870_10019703 3300005840 Bacteria 3276
146 Ga0068863_100030122 3300005841 Bacteria 5183
147 Ga0068863_100070339 3300005841 Bacteria 3309
148 Ga0068863_100094258 3300005841 Bacteria 2841
149 Ga0068863_100231486 3300005841 Bacteria 1782
150 Ga0068858_100000455 3300005842 Bacteria 42847
151 Ga0068858_100000721 3300005842 Bacteria 34455
152 Ga0068858_100009127 3300005842 Bacteria 9482
153 Ga0068858_100039426 3300005842 Bacteria 4380
154 Ga0068858_100101201 3300005842 Bacteria 2687
155 Ga0068858_100216887 3300005842 Bacteria 1811
156 Ga0068860_100000590 3300005843 Bacteria 43453
157 Ga0068860_100001308 3300005843 Bacteria 27073
158 Ga0068860_100007722 3300005843 Bacteria 10754
159 Ga0068860_100147216 3300005843 Bacteria 2266
160 Ga0068860_100338034 3300005843 Bacteria 1480
161 Ga0068862_100003224 3300005844 Bacteria 14128
162 Ga0068862_100026724 3300005844 Bacteria 4852
163 Ga0068862_100095149 3300005844 Bacteria 2598
164 Ga0068862_100154745 3300005844 Bacteria 2043
165 Ga0068862_100158895 3300005844 Bacteria 2016
166 Ga0068862_100188914 3300005844 Bacteria 1852
167 Ga0075365_10009503 3300006038 Bacteria 5595
168 Ga0075363_100206622 3300006048 Bacteria 1123
169 Ga0075362_10189052 3300006177 Bacteria 1000
170 Ga0075366_10006850 3300006195 Bacteria 6270
171 Ga0075366_10019096 3300006195 Bacteria 3961
172 Ga0075366_10032281 3300006195 Bacteria 3082
173 Ga0075366_10075243 3300006195 Bacteria 2014
174 Ga0097621_100007342 3300006237 Bacteria 7880
175 Ga0097621_100029482 3300006237 Bacteria 4334
176 Ga0097621_100037662 3300006237 Bacteria 3878
177 Ga0097621_100158999 3300006237 Bacteria 1941
178 Ga0097621_100172735 3300006237 Bacteria 1864
179 Ga0068871_100003664 3300006358 Bacteria 10561
180 Ga0068871_100005099 3300006358 Bacteria 9177
181 Ga0068871_100026970 3300006358 Bacteria 4488
182 Ga0068871_100033926 3300006358 Bacteria 4045
183 Ga0068871_100322945 3300006358 Bacteria 1360
184 Ga0075430_100109317 3300006846 Bacteria 2306
185 Ga0075429_100001832 3300006880 Bacteria 17596
186 Ga0068865_100000113 3300006881 Bacteria 41428
187 Ga0068865_100005106 3300006881 Bacteria 7943
188 Ga0068865_100009533 3300006881 Bacteria 6024
189 Ga0068865_100039020 3300006881 Bacteria 3219
190 Ga0097620_100000560 3300006931 Bacteria 36894
191 Ga0097620_100034614 3300006931 Bacteria 5069
192 Ga0097620_100042953 3300006931 Bacteria 4542
193 Ga0079104_1000037 3300006946 Bacteria 189207
194 Ga0105250_10005204 3300009092 Bacteria 5865
195 Ga0105240_10006593 3300009093 Bacteria 17041
196 Ga0105240_10412254 3300009093 Bacteria 1519
197 Ga0111539_10150637 3300009094 Bacteria 2723
198 Ga0111539_10156092 3300009094 Bacteria 2670
199 Ga0105245_10000681 3300009098 Bacteria 30711
200 Ga0105245_10119619 3300009098 Bacteria 2459
201 Ga0114129_11057768 3300009147 Bacteria 1018
202 Ga0105243_10001082 3300009148 Bacteria 24928
203 Ga0105243_10087298 3300009148 Bacteria 2560
204 Ga0105242_10000201 3300009176 Bacteria 46357
205 Ga0105242_10059715 3300009176 Bacteria 3130
206 Ga0105248_10000507 3300009177 Bacteria 44310
207 Ga0105248_10006243 3300009177 Bacteria 13064
208 Ga0105248_10015929 3300009177 Bacteria 8280
209 Ga0105237_10000293 3300009545 Bacteria 69295
210 Ga0105237_10060968 3300009545 Bacteria 3773
211 Ga0105238_10002472 3300009551 Bacteria 18494
212 Ga0105238_10056225 3300009551 Bacteria 3948
213 Ga0105238_10546103 3300009551 Bacteria 1163
214 Ga0105249_10155467 3300009553 Bacteria 2205
215 Ga0105239_10002229 3300010375 Bacteria 24806
216 Ga0105239_10041884 3300010375 Bacteria 5018
217 Ga0105246_10137644 3300011119 Bacteria 1832
218 Ga0157369_10045523 3300013105 Bacteria 4771
219 Ga0157374_10007912 3300013296 Bacteria 9076
220 Ga0157374_10044586 3300013296 Bacteria 4099
221 Ga0157378_10000357 3300013297 Bacteria 44996
222 Ga0157378_10004481 3300013297 Bacteria 12262
223 Ga0157378_10091957 3300013297 Bacteria 2760
224 Ga0157378_10185707 3300013297 Bacteria 1958
225 Ga0163162_10010609 3300013306 Bacteria 8958
226 Ga0163162_10032428 3300013306 Bacteria 5190
227 Ga0163162_10050559 3300013306 Bacteria 4168
228 Ga0157372_10060660 3300013307 Bacteria 4232
229 Ga0157375_10036214 3300013308 Bacteria 4719
230 Ga0157375_10068089 3300013308 Bacteria 3560
231 Ga0157375_10072962 3300013308 Bacteria 3450
232 Ga0157375_10090867 3300013308 Bacteria 3113
233 Ga0157375_10107087 3300013308 Bacteria 2889
234 Ga0157375_10161038 3300013308 Bacteria 2386
235 Ga0163163_10010737 3300014325 Bacteria 8260
236 Ga0163163_10100097 3300014325 Bacteria 2921
237 Ga0157380_10051588 3300014326 Bacteria 3254
238 Ga0157377_10000851 3300014745 Bacteria 12687
239 Ga0157377_10021594 3300014745 Bacteria 3388
240 Ga0157377_10170982 3300014745 Bacteria 1359
241 Ga0157379_10007924 3300014968 Bacteria 9208
242 Ga0157379_10016573 3300014968 Bacteria 6480
243 Ga0157379_10054497 3300014968 Bacteria 3573
244 Ga0157379_10086058 3300014968 Bacteria 2818
245 Ga0157379_10135800 3300014968 Bacteria 2216
246 Ga0157379_10145880 3300014968 Bacteria 2134
247 Ga0157379_10307026 3300014968 Bacteria 1447
248 Ga0157376_10006028 3300014969 Bacteria 8522
249 Ga0157376_10037673 3300014969 Bacteria 3929
250 Ga0157376_10070159 3300014969 Bacteria 2973
251 Ga0157376_10249327 3300014969 Bacteria 1657
252 Ga0157376_10366103 3300014969 Bacteria 1384
253 Ga0163161_10006861 3300017792 Bacteria 7880
254 Ga0163161_10114971 3300017792 Bacteria 2016
255 Ga0163161_10257488 3300017792 Bacteria 1362
256 Ga0213872_10000007 3300021361 Bacteria 228206
257 Ga0213872_10001260 3300021361 Bacteria 17048
258 Ga0207673_1003014 3300025290 Bacteria 1953
259 Ga0207673_1006090 3300025290 Bacteria 1486
260 Ga0209257_1040921 3300025304 Bacteria 1379
261 Ga0207697_10004453 3300025315 Bacteria 6692
262 Ga0207697_10013322 3300025315 Bacteria 3432
263 Ga0207656_10017279 3300025321 Bacteria 2823
264 Ga0207696_1006923 3300025711 Bacteria 4499
265 Ga0207682_10000900 3300025893 Bacteria 13769
266 Ga0207682_10003046 3300025893 Bacteria 7359
267 Ga0207682_10101817 3300025893 Bacteria 1256
268 Ga0207642_10028252 3300025899 Bacteria 2307
269 Ga0207688_10012874 3300025901 Bacteria 4548
270 Ga0207688_10019227 3300025901 Bacteria 3719
271 Ga0207680_10001992 3300025903 Bacteria 9567
272 Ga0207680_10014983 3300025903 Bacteria 4034
273 Ga0207645_10086051 3300025907 Bacteria 2019
274 Ga0207645_10099664 3300025907 Bacteria 1873
275 Ga0207643_10002587 3300025908 Bacteria 9787
276 Ga0207643_10005660 3300025908 Bacteria 6683
277 Ga0207643_10037001 3300025908 Bacteria 2738
278 Ga0207705_10013870 3300025909 Bacteria 5810
279 Ga0207705_10120299 3300025909 Bacteria 1948
280 Ga0207654_10252630 3300025911 Bacteria 1182
281 Ga0207695_10028942 3300025913 Bacteria 6132
282 Ga0207671_10012562 3300025914 Bacteria 6801
283 Ga0207660_10230092 3300025917 Bacteria 1457
284 Ga0207662_10057699 3300025918 Bacteria 2321
285 Ga0207662_10101705 3300025918 Bacteria 1781
286 Ga0207662_10188706 3300025918 Bacteria 1329
287 Ga0207657_10011645 3300025919 Bacteria 8720
288 Ga0207657_10097491 3300025919 Bacteria 2444
289 Ga0207657_10115989 3300025919 Bacteria 2207
290 Ga0207649_10030192 3300025920 Bacteria 3207
291 Ga0207649_10328739 3300025920 Bacteria 1125
292 Ga0207681_10002665 3300025923 Bacteria 11317
293 Ga0207681_10038936 3300025923 Bacteria 3153
294 Ga0207694_10028093 3300025924 Bacteria 4288
295 Ga0207694_10066315 3300025924 Bacteria 2816
296 Ga0207650_10001429 3300025925 Bacteria 17220
297 Ga0207650_10056101 3300025925 Bacteria 2926
298 Ga0207659_10006606 3300025926 Bacteria 7122
299 Ga0207659_10042734 3300025926 Bacteria 3179
300 Ga0207659_10069001 3300025926 Bacteria 2573
301 Ga0207659_10154317 3300025926 Bacteria 1796
302 Ga0207687_10005916 3300025927 Bacteria 8094
303 Ga0207687_10065856 3300025927 Bacteria 2574
304 Ga0207644_10012310 3300025931 Bacteria 5680
305 Ga0207644_10036291 3300025931 Bacteria 3460
306 Ga0207644_10107729 3300025931 Bacteria 2102
307 Ga0207644_10155410 3300025931 Bacteria 1773
308 Ga0207690_10242182 3300025932 Bacteria 1390
309 Ga0207706_10001422 3300025933 Bacteria 23958
310 Ga0207706_10009838 3300025933 Bacteria 8770
311 Ga0207686_10000084 3300025934 Bacteria 79402
312 Ga0207709_10001923 3300025935 Bacteria 13649
313 Ga0207709_10004553 3300025935 Bacteria 7988
314 Ga0207709_10142260 3300025935 Bacteria 1650
315 Ga0207709_10177420 3300025935 Bacteria 1501
316 Ga0207670_10109945 3300025936 Bacteria 1984
317 Ga0207669_10029240 3300025937 Bacteria 3044
318 Ga0207669_10095679 3300025937 Bacteria 1947
319 Ga0207669_10155549 3300025937 Bacteria 1607
320 Ga0207669_10162953 3300025937 Bacteria 1577
321 Ga0207669_10337619 3300025937 Bacteria 1159
322 Ga0207704_10000166 3300025938 Bacteria 34959
323 Ga0207704_10028245 3300025938 Bacteria 3109
324 Ga0207704_10028911 3300025938 Bacteria 3083
325 Ga0207704_10058630 3300025938 Bacteria 2372
326 Ga0207704_10079332 3300025938 Bacteria 2115
327 Ga0207704_10143360 3300025938 Bacteria 1675
328 Ga0207691_10000973 3300025940 Bacteria 28494
329 Ga0207691_10001288 3300025940 Bacteria 25003
330 Ga0207691_10016296 3300025940 Bacteria 7057
331 Ga0207691_10016383 3300025940 Bacteria 7035
332 Ga0207691_10086415 3300025940 Bacteria 2814
333 Ga0207691_10097893 3300025940 Bacteria 2621
334 Ga0207691_10316187 3300025940 Bacteria 1339
335 Ga0207711_10014573 3300025941 Bacteria 6532
336 Ga0207711_10038891 3300025941 Bacteria 4045
337 Ga0207711_10067741 3300025941 Bacteria 3091
338 Ga0207689_10000272 3300025942 Bacteria 46619
339 Ga0207689_10000937 3300025942 Bacteria 28023
340 Ga0207689_10001248 3300025942 Bacteria 24503
341 Ga0207689_10079500 3300025942 Bacteria 2695
342 Ga0207661_10029460 3300025944 Bacteria 4216
343 Ga0207661_10211006 3300025944 Bacteria 1711
344 Ga0207679_10015894 3300025945 Bacteria 4988
345 Ga0207679_10104017 3300025945 Bacteria 2227
346 Ga0207679_10185065 3300025945 Bacteria 1726
347 Ga0207667_10041872 3300025949 Bacteria 4870
348 Ga0207667_10113456 3300025949 Bacteria 2794
349 Ga0207667_10563682 3300025949 Bacteria 1151
350 Ga0207651_10003511 3300025960 Bacteria 7704
351 Ga0207651_10037473 3300025960 Bacteria 3177
352 Ga0207712_10104175 3300025961 Bacteria 2115
353 Ga0207712_10153420 3300025961 Bacteria 1781
354 Ga0207668_10000968 3300025972 Bacteria 17241
355 Ga0207668_10133598 3300025972 Bacteria 1898
356 Ga0207640_10006595 3300025981 Bacteria 6374
357 Ga0207640_10021609 3300025981 Bacteria 3839
358 Ga0207658_10001919 3300025986 Bacteria 15520
359 Ga0207658_10006686 3300025986 Bacteria 7860
360 Ga0207658_10091873 3300025986 Bacteria 2356
361 Ga0207677_10033837 3300026023 Bacteria 3302
362 Ga0207677_10088568 3300026023 Bacteria 2245
363 Ga0207677_10314858 3300026023 Bacteria 1298
364 Ga0207703_10000375 3300026035 Bacteria 47699
365 Ga0207703_10015188 3300026035 Bacteria 6008
366 Ga0207703_10019666 3300026035 Bacteria 5277
367 Ga0207703_10026050 3300026035 Bacteria 4602
368 Ga0207703_10070368 3300026035 Bacteria 2888
369 Ga0207703_10314429 3300026035 Bacteria 1432
370 Ga0207639_10091865 3300026041 Bacteria 2431
371 Ga0207639_10252212 3300026041 Bacteria 1539
372 Ga0207639_10352528 3300026041 Bacteria 1315
373 Ga0207678_10000711 3300026067 Bacteria 30413
374 Ga0207678_10003317 3300026067 Bacteria 14517
375 Ga0207678_10009807 3300026067 Bacteria 8420
376 Ga0207678_10317485 3300026067 Bacteria 1340
377 Ga0207678_10338962 3300026067 Bacteria 1295
378 Ga0207678_10528250 3300026067 Bacteria 1030
379 Ga0207708_10000134 3300026075 Bacteria 58313
380 Ga0207708_10000749 3300026075 Bacteria 24378
381 Ga0207708_10010230 3300026075 Bacteria 6965
382 Ga0207702_10010113 3300026078 Bacteria 7906
383 Ga0207702_10089243 3300026078 Bacteria 2696
384 Ga0207641_10019018 3300026088 Bacteria 5634
385 Ga0207641_10510520 3300026088 Bacteria 1168
386 Ga0207648_10000433 3300026089 Bacteria 46203
387 Ga0207648_10000842 3300026089 Bacteria 34576
388 Ga0207648_10002680 3300026089 Bacteria 18942
389 Ga0207648_10005765 3300026089 Bacteria 12408
390 Ga0207648_10011252 3300026089 Bacteria 8436
391 Ga0207648_10051060 3300026089 Bacteria 3614
392 Ga0207676_10010703 3300026095 Bacteria 6541
393 Ga0207676_10010902 3300026095 Bacteria 6484
394 Ga0207676_10024579 3300026095 Bacteria 4459
395 Ga0207676_10048959 3300026095 Bacteria 3284
396 Ga0207676_10051785 3300026095 Bacteria 3206
397 Ga0207676_10062591 3300026095 Bacteria 2952
398 Ga0207676_10517730 3300026095 Bacteria 1135
399 Ga0207674_10026211 3300026116 Bacteria 6199
400 Ga0207674_10328098 3300026116 Bacteria 1480
401 Ga0207675_100000490 3300026118 Bacteria 38407
402 Ga0207675_100001900 3300026118 Bacteria 20834
403 Ga0207675_100002302 3300026118 Bacteria 18970
404 Ga0207675_100026407 3300026118 Bacteria 5406
405 Ga0207683_10005797 3300026121 Bacteria 10593
406 Ga0207683_10011107 3300026121 Bacteria 7676
407 Ga0207683_10012464 3300026121 Bacteria 7255
408 Ga0207683_10083065 3300026121 Bacteria 2846
409 Ga0207683_10166311 3300026121 Bacteria 1996
410 Ga0207698_10002753 3300026142 Bacteria 10485
411 Ga0207698_10037986 3300026142 Bacteria 3553
412 Ga0207698_10247142 3300026142 Bacteria 1630
413 Ga0209281_1000002 3300027111 Bacteria 1924012
414 Ga0209983_1018933 3300027665 Bacteria 1431
415 Ga0207428_10177992 3300027907 Bacteria 1608
416 Ga0268266_10164311 3300028379 Bacteria 2010
417 Ga0268266_10429243 3300028379 Bacteria 1253
418 Ga0268265_10005950 3300028380 Bacteria 8303
419 Ga0268265_10010067 3300028380 Bacteria 6382
420 Ga0268265_10010172 3300028380 Bacteria 6350
421 Ga0268265_10135597 3300028380 Bacteria 2053
422 Ga0268264_10000991 3300028381 Bacteria 28937
423 Ga0268264_10004638 3300028381 Bacteria 11677
424 Ga0268264_10016497 3300028381 Bacteria 6048
425 Ga0307517_10000228 3300028786 Bacteria 94852
426 Ga0307517_10194207 3300028786 Bacteria 1282
427 Ga0307517_10197632 3300028786 Bacteria 1263
428 Ga0307515_10027638 3300028794 Bacteria 9685
429 Ga0307515_10304248 3300028794 Bacteria 1276
430 Ga0307512_10071922 3300030522 Bacteria 2563
431 Ga0265328_10020656 3300031239 Bacteria 2518
432 Ga0265331_10001779 3300031250 Bacteria 15399
433 Ga0265327_10000491 3300031251 Bacteria 69450
434 Ga0307509_10004172 3300031507 Bacteria 21115
435 Ga0307509_10007733 3300031507 Bacteria 13939
436 Ga0307509_10017238 3300031507 Bacteria 8319
437 Ga0307509_10062175 3300031507 Bacteria 3938
438 Ga0307509_10143518 3300031507 Bacteria 2318
439 Ga0307408_100004119 3300031548 Bacteria 9908
440 Ga0307408_100113242 3300031548 Bacteria 2088
441 Ga0307508_10000273 3300031616 Bacteria 63550
442 Ga0307514_10000355 3300031649 Bacteria 106758
443 Ga0307514_10094482 3300031649 Bacteria 2167
444 Ga0316579_10001716 3300031691 Bacteria 8053
445 Ga0316578_10014936 3300031728 Bacteria 4163
446 Ga0307516_10004597 3300031730 Bacteria 16937
447 Ga0307516_10171053 3300031730 Bacteria 1913
448 Ga0307405_10005079 3300031731 Bacteria 6300
449 Ga0307413_10103521 3300031824 Bacteria 1887
450 Ga0307518_10030185 3300031838 Bacteria 3925
451 Ga0307410_10008485 3300031852 Bacteria 5699
452 Ga0307406_10003644 3300031901 Bacteria 8388
453 Ga0307406_10127200 3300031901 Bacteria 1782
454 Ga0307406_10194433 3300031901 Bacteria 1488
455 Ga0307412_10005312 3300031911 Bacteria 7231
456 Ga0307412_10152284 3300031911 Bacteria 1708
457 Ga0307412_10172533 3300031911 Bacteria 1618
458 Ga0307416_100174538 3300032002 Bacteria 2006
459 Ga0307416_100326714 3300032002 Bacteria 1539
460 Ga0307414_10019323 3300032004 Bacteria 4219
461 Ga0307414_10137120 3300032004 Bacteria 1910
462 Ga0307411_10001450 3300032005 Bacteria 9703
463 Ga0307415_100006924 3300032126 Bacteria 6157
464 Ga0307510_10000967 3300033180 Bacteria 30417
465 Ga0307510_10032606 3300033180 Bacteria 5866
466 Ga0307510_10140259 3300033180 Bacteria 2062
467 Ga0373959_0013134 3300034820 Bacteria 1490
468 Ga0373944_0003244 3300035089 Bacteria 4183
469 Ga0373939_0000041 3300035114 Bacteria 45477
470 Ga0373960_0000135 3300035121 Bacteria 12101
471 Ga0373943_0130977 3300035170 Bacteria 1342
472 Ga0373931_0000097 3300035691 Bacteria 40104
473 Ga0373931_0000882 3300035691 Bacteria 12672
474 Ga0373931_0056926 3300035691 Bacteria 2096
475 Ga0373927_0089373 3300035695 Bacteria 2000
476 Ga0373927_0119654 3300035695 Bacteria 1719
477 Ga0373937_0186202 3300036401 Bacteria 1950
478 Ga0316582_0011481 3300036647 Bacteria 4899
479 Ga0373925_0015343 3300037068 Bacteria 5542
480 Ga0373925_0027068 3300037068 Bacteria 4199
481 Ga0373925_0073937 3300037068 Bacteria 2581
482 Ga0373925_0157574 3300037068 Bacteria 1786
483 Ga0395905_0001659 3300037471 Bacteria 26289
484 Ga0395905_0002961 3300037471 Bacteria 18458
485 Ga0395905_0053160 3300037471 Bacteria 3791
486 Ga0395905_0242920 3300037471 Bacteria 1682
487 Ga0436360_0026854 3300039438 Bacteria 1920
488 Ga0436360_0702683 3300039438 Bacteria 9964
489 Ga0436361_0021397 3300039447 Bacteria 46447
490 Ga0436361_0163583 3300039447 Bacteria 173204
491 Ga0436361_0480355 3300039447 Bacteria 4166
492 Ga0436361_0515416 3300039447 Bacteria 1512
493 Ga0436361_0694318 3300039447 Bacteria 14752
494 Ga0451791_0028897 3300041451 Bacteria 1027
495 Ga0451800_1657359 3300041459 Bacteria 1336
496 Ga0450920_021836 3300042122 Bacteria 1238
497 Ga0439434_0053546 3300042435 Bacteria 1254
498 Ga0450918_000419 3300042531 Bacteria 9209
499 Ga0450893_0009516 3300042532 Bacteria 1588
500 Ga0451577_0003355 3300042876 Bacteria 17937
501 Ga0451577_0011238 3300042876 Bacteria 8485
502 Ga0453684_0098650 3300044712 Bacteria 3580
503 Ga0453684_0105932 3300044712 Bacteria 3428
504 Ga0466968_0029228 3300044735 Bacteria 2278
505 Ga0451576_0045812 3300045051 Bacteria 4604
506 Ga0466958_0034970 3300045836 Bacteria 3000
507 Ga0495592_0000307 3300046454 Bacteria 41229
508 Ga0495590_0001456 3300046457 Bacteria 10206
509 Ga0495650_0005020 3300046471 Bacteria 8792
510 Ga0495597_0000054 3300046542 Bacteria 95390
511 Ga0495633_0001764 3300046558 Bacteria 16041
512 Ga0495625_0082794 3300046660 Bacteria 2231
513 Ga0495647_0048038 3300046681 Bacteria 1649
514 Ga0495614_0018660 3300048089 Bacteria 3004
515 Ga0496100_0119952 3300048903 Bacteria 1838
516 Ga0496101_0035120 3300048904 Bacteria 3545
517 Ga0496101_0138814 3300048904 Bacteria 1851
518 Ga0496102_0012909 3300048905 Bacteria 7233
519 Ga0496102_0352231 3300048905 Bacteria 1386
520 Ga0496104_0077458 3300048907 Bacteria 3168
521 Ga0496104_0362256 3300048907 Bacteria 1362
522 Ga0496105_0031152 3300048908 Bacteria 4372
523 Ga0496105_0220206 3300048908 Bacteria 1545
524 Ga0496106_0023412 3300048909 Bacteria 4588
525 Ga0496106_0063643 3300048909 Bacteria 2804
526 Ga0496107_0073536 3300048910 Bacteria 2486
527 Ga0496107_0241731 3300048910 Bacteria 1343
528 Ga0496108_0096804 3300048911 Bacteria 2514
529 Ga0496109_0027726 3300048912 Bacteria 5060
530 Ga0496109_0084402 3300048912 Bacteria 2930
531 Ga0496110_0058616 3300048913 Bacteria 3391
532 Ga0496110_0110927 3300048913 Bacteria 2465
533 Ga0496111_0111703 3300048914 Bacteria 2013
534 Ga0496112_0110815 3300048915 Bacteria 2715
535 Ga0496112_0394269 3300048915 Bacteria 1324
536 Ga0496114_0035179 3300048917 Bacteria 4135
537 Ga0496114_0172549 3300048917 Bacteria 1885
538 Ga0496114_0466587 3300048917 Bacteria 1117
539 Ga0496115_0038526 3300048918 Bacteria 3793
540 Ga0496118_0180449 3300048921 Bacteria 1276
541 Ga0496121_0001278 3300048924 Bacteria 43341
542 Ga0496121_0040004 3300048924 Bacteria 4120
543 Ga0496124_0000126 3300048927 Bacteria 159539
544 Ga0496124_0074561 3300048927 Bacteria 2804
545 Ga0496125_0003500 3300048928 Bacteria 18970
546 Ga0496125_0107227 3300048928 Bacteria 2036
547 Ga0496126_0029704 3300048929 Bacteria 5189
548 Ga0501292_006324 3300049515 Bacteria 1679
549 Ga0501034_0306624 3300049571 Bacteria 1523
550 Ga0501043_0000012 3300049579 Bacteria 188907
551 Ga0501046_0000030 3300049580 Bacteria 187803
552 Ga0501047_0000049 3300049581 Bacteria 162513
553 Ga0501048_0000082 3300049582 Bacteria 49693
554 Ga0501198_000029 3300049649 Bacteria 61627
555 Ga0501211_001400 3300049658 Bacteria 2581
556 Ga0501222_000001 3300049662 Bacteria 307689
557 Ga0501083_0010638 3300049744 Bacteria 6476
558 Ga0501267_000300 3300049764 Bacteria 3641
559 Ga0501044_0180647 3300049823 Bacteria 2077
560 Ga0501045_0003743 3300049824 Bacteria 10463
561 nmdc:mga0k408_158154_c1 3300050493 Bacteria 1350
562 nmdc:mga0k408_42918_c1 3300050493 Bacteria 2605
563 nmdc:mga0k408_50179_c1 3300050493 Bacteria 2415
564 nmdc:mga09592_1124_c1 3300050508 Bacteria 21276
565 nmdc:mga0qj67_290918_c1 3300050509 Bacteria 1324
566 nmdc:mga08y16_41344_c1 3300050511 Bacteria 4829
567 Ga0500644_0003021 3300053088 Bacteria 4172
568 Ga0500559_0000636 3300053136 Bacteria 23688
569 Ga0500622_0105998 3300053156 Bacteria 1378
570 Ga0590071_028275 3300059421 Bacteria 1332
571 Ga0590075_006183 3300059424 Bacteria 2838
572 2548499252 2547132374 Bacteria 5530232
573 2587758242 2585428062 Bacteria 6842168
574 2643743256 2643221544 Bacteria 5886209
575 2643866089 2643221570 Bacteria 5103772
576 2643932722 2643221585 Bacteria 5812563
577 2644245216 2643221644 Bacteria 6865017
578 2644292903 2643221652 Bacteria 5140275
579 2644305704 2643221654 Bacteria 5273570
580 2644313972 2643221656 Bacteria 5809961
581 2644647916 2643221717 Bacteria 5676132
582 2722885718 2721755523 Bacteria 6430384
583 2739056124 2738541337 Bacteria 6183410
584 2739241971 2738543012 Bacteria 7115078
585 2816470727 2816332133 Bacteria 7249298
586 2839143944 2839138175 Bacteria 6549354
587 Ga0070665_100061618
588 SwRhRL2b_contig_1290167
589 JGI24744J21845_10025542
590 Ga0065704_10004249
591 Ga0065712_10196714
592 Ga0070658_10011079
593 Ga0070658_10226082
594 Ga0070676_10053682
595 Ga0070676_10080888
596 Ga0070676_10140985
597 Ga0070683_100015058
598 Ga0070683_100173049
599 Ga0070690_100000651
600 Ga0070690_100070631
601 Ga0070690_100097736
602 Ga0070690_100169986
603 Ga0070670_100034239
604 Ga0070670_100060997
605 Ga0070670_100080639
606 Ga0070670_100093079
607 Ga0070677_10009793
608 Ga0070677_10083012
609 Ga0068869_100001401
610 Ga0068869_100005873
611 Ga0068869_100039477
612 Ga0068869_100044338
613 Ga0070680_100036578
614 Ga0070682_100078844
615 Ga0068868_100000439
616 Ga0068868_100006871
617 Ga0068868_100027204
618 Ga0068868_100030921
619 Ga0068868_100109092
620 Ga0068868_100163336
621 Ga0070660_100171670
622 Ga0070689_100001789
623 Ga0070689_100022218
624 Ga0070689_100066063
625 Ga0070689_100135304
626 Ga0070691_10006175
627 Ga0070687_100039502
628 Ga0070687_100089292
629 Ga0070687_100092633
630 Ga0070661_100005385
631 Ga0070661_100061902
632 Ga0070661_100087494
633 Ga0070669_100022578
634 Ga0070675_100001927
635 Ga0070675_100002165
636 Ga0070675_100003623
637 Ga0070675_100020207
638 Ga0070675_100046382
639 Ga0070671_100031280
640 Ga0070671_100039634
641 Ga0070671_100041682
642 Ga0070671_100098487
643 Ga0070674_100014881
644 Ga0070674_100037159
645 Ga0070674_100040856
646 Ga0070674_100159859
647 Ga0070673_100013975
648 Ga0070688_100011889
649 Ga0070659_100022263
650 Ga0070659_100068909
651 Ga0070659_100236894
652 Ga0070667_100000219
653 Ga0070667_100100758
654 Ga0070701_10001211
655 Ga0070701_10169471
656 Ga0070705_100031828
657 Ga0070700_100000784
658 Ga0070700_100003161
659 Ga0070694_100040337
660 Ga0070708_100160181
661 Ga0070663_100000127
662 Ga0070663_100038045
663 Ga0070663_100198683
664 Ga0070678_100016474
665 Ga0070678_100021761
666 Ga0070678_100175889
667 Ga0070678_100196870
668 Ga0070662_100054794
669 Ga0070662_100062034
670 Ga0068867_100000191
671 Ga0068867_100002519
672 Ga0068867_100086035
673 Ga0068867_100114357
674 Ga0070685_10017750
675 Ga0070685_10024345
676 Ga0070684_100034577
677 Ga0070684_100172039
678 Ga0068853_100009633
679 Ga0068853_100038715
680 Ga0070672_100000455
681 Ga0070672_100002919
682 Ga0070672_100005115
683 Ga0070672_100103955
684 Ga0070686_100000103
685 Ga0070695_100019666
686 Ga0070693_100015766
687 Ga0070665_100011648
688 Ga0070704_100024201
689 Ga0068855_100041737
690 Ga0068855_100168578
691 Ga0070664_100026911
692 Ga0070664_100095623
693 Ga0070664_100161563
694 Ga0068854_100095494
695 Ga0068854_100153274
696 Ga0068854_100296856
697 Ga0068856_100014048
698 Ga0068856_100267596
699 Ga0068856_100289712
700 Ga0070702_100000081
701 Ga0070702_100116519
702 Ga0068852_100010121
703 Ga0068852_100014760
704 Ga0068852_100048149
705 Ga0068852_100205635
706 Ga0068852_100381004
707 Ga0068859_100000560
708 Ga0068859_100034614
709 Ga0068859_100042950
710 Ga0068864_100000895
711 Ga0068864_100017183
712 Ga0068864_100017870
713 Ga0068864_100021458
714 Ga0068864_100021750
715 Ga0068864_100025048
716 Ga0068864_100027849
717 Ga0068864_100045997
718 Ga0068866_10000201
719 Ga0068866_10005486
720 Ga0068866_10015962
721 Ga0068866_10151419
722 Ga0068861_100002141
723 Ga0068861_100032122
724 Ga0068861_100087488
725 Ga0068861_100175058
726 Ga0068861_100245673
727 Ga0068851_10013154
728 Ga0068851_10082939
729 Ga0068851_10138061
730 Ga0068870_10002727
731 Ga0068870_10019703
732 Ga0068863_100030122
733 Ga0068863_100070339
734 Ga0068863_100094258
735 Ga0068863_100231486
736 Ga0068858_100000455
737 Ga0068858_100000721
738 Ga0068858_100009127
739 Ga0068858_100039426
740 Ga0068858_100101201
741 Ga0068858_100216887
742 Ga0068860_100000590
743 Ga0068860_100001308
744 Ga0068860_100007722
745 Ga0068860_100147216
746 Ga0068860_100338034
747 Ga0068862_100003224
748 Ga0068862_100026724
749 Ga0068862_100095149
750 Ga0068862_100154745
751 Ga0068862_100158895
752 Ga0068862_100188914
753 Ga0075365_10009503
754 Ga0075363_100206622
755 Ga0075362_10189052
756 Ga0075366_10006850
757 Ga0075366_10019096
758 Ga0075366_10032281
759 Ga0075366_10075243
760 Ga0097621_100007342
761 Ga0097621_100029482
762 Ga0097621_100037662
763 Ga0097621_100158999
764 Ga0097621_100172735
765 Ga0068871_100003664
766 Ga0068871_100005099
767 Ga0068871_100026970
768 Ga0068871_100033926
769 Ga0068871_100322945
770 Ga0075430_100109317
771 Ga0075429_100001832
772 Ga0068865_100000113
773 Ga0068865_100005106
774 Ga0068865_100009533
775 Ga0068865_100039020
776 Ga0097620_100000560
777 Ga0097620_100034614
778 Ga0097620_100042953
779 Ga0079104_1000037
780 Ga0105250_10005204
781 Ga0105240_10006593
782 Ga0105240_10412254
783 Ga0111539_10150637
784 Ga0111539_10156092
785 Ga0105245_10000681
786 Ga0105245_10119619
787 Ga0114129_11057768
788 Ga0105243_10001082
789 Ga0105243_10087298
790 Ga0105242_10000201
791 Ga0105242_10059715
792 Ga0105248_10000507
793 Ga0105248_10006243
794 Ga0105248_10015929
795 Ga0105237_10000293
796 Ga0105237_10060968
797 Ga0105238_10002472
798 Ga0105238_10056225
799 Ga0105238_10546103
800 Ga0105249_10155467
801 Ga0105239_10002229
802 Ga0105239_10041884
803 Ga0105246_10137644
804 Ga0157369_10045523
805 Ga0157374_10007912
806 Ga0157374_10044586
807 Ga0157378_10000357
808 Ga0157378_10004481
809 Ga0157378_10091957
810 Ga0157378_10185707
811 Ga0163162_10010609
812 Ga0163162_10032428
813 Ga0163162_10050559
814 Ga0157372_10060660
815 Ga0157375_10036214
816 Ga0157375_10068089
817 Ga0157375_10072962
818 Ga0157375_10090867
819 Ga0157375_10107087
820 Ga0157375_10161038
821 Ga0163163_10010737
822 Ga0163163_10100097
823 Ga0157380_10051588
824 Ga0157377_10000851
825 Ga0157377_10021594
826 Ga0157377_10170982
827 Ga0157379_10007924
828 Ga0157379_10016573
829 Ga0157379_10054497
830 Ga0157379_10086058
831 Ga0157379_10135800
832 Ga0157379_10145880
833 Ga0157379_10307026
834 Ga0157376_10006028
835 Ga0157376_10037673
836 Ga0157376_10070159
837 Ga0157376_10249327
838 Ga0157376_10366103
839 Ga0163161_10006861
840 Ga0163161_10114971
841 Ga0163161_10257488
842 Ga0213872_10000007
843 Ga0213872_10001260
844 Ga0207673_1003014
845 Ga0207673_1006090
846 Ga0209257_1040921
847 Ga0207697_10004453
848 Ga0207697_10013322
849 Ga0207656_10017279
850 Ga0207696_1006923
851 Ga0207682_10000900
852 Ga0207682_10003046
853 Ga0207682_10101817
854 Ga0207642_10028252
855 Ga0207688_10012874
856 Ga0207688_10019227
857 Ga0207680_10001992
858 Ga0207680_10014983
859 Ga0207645_10086051
860 Ga0207645_10099664
861 Ga0207643_10002587
862 Ga0207643_10005660
863 Ga0207643_10037001
864 Ga0207705_10013870
865 Ga0207705_10120299
866 Ga0207654_10252630
867 Ga0207695_10028942
868 Ga0207671_10012562
869 Ga0207660_10230092
870 Ga0207662_10057699
871 Ga0207662_10101705
872 Ga0207662_10188706
873 Ga0207657_10011645
874 Ga0207657_10097491
875 Ga0207657_10115989
876 Ga0207649_10030192
877 Ga0207649_10328739
878 Ga0207681_10002665
879 Ga0207681_10038936
880 Ga0207694_10028093
881 Ga0207694_10066315
882 Ga0207650_10001429
883 Ga0207650_10056101
884 Ga0207659_10006606
885 Ga0207659_10042734
886 Ga0207659_10069001
887 Ga0207659_10154317
888 Ga0207687_10005916
889 Ga0207687_10065856
890 Ga0207644_10012310
891 Ga0207644_10036291
892 Ga0207644_10107729
893 Ga0207644_10155410
894 Ga0207690_10242182
895 Ga0207706_10001422
896 Ga0207706_10009838
897 Ga0207686_10000084
898 Ga0207709_10001923
899 Ga0207709_10004553
900 Ga0207709_10142260
901 Ga0207709_10177420
902 Ga0207670_10109945
903 Ga0207669_10029240
904 Ga0207669_10095679
905 Ga0207669_10155549
906 Ga0207669_10162953
907 Ga0207669_10337619
908 Ga0207704_10000166
909 Ga0207704_10028245
910 Ga0207704_10028911
911 Ga0207704_10058630
912 Ga0207704_10079332
913 Ga0207704_10143360
914 Ga0207691_10000973
915 Ga0207691_10001288
916 Ga0207691_10016296
917 Ga0207691_10016383
918 Ga0207691_10086415
919 Ga0207691_10097893
920 Ga0207691_10316187
921 Ga0207711_10014573
922 Ga0207711_10038891
923 Ga0207711_10067741
924 Ga0207689_10000272
925 Ga0207689_10000937
926 Ga0207689_10001248
927 Ga0207689_10079500
928 Ga0207661_10029460
929 Ga0207661_10211006
930 Ga0207679_10015894
931 Ga0207679_10104017
932 Ga0207679_10185065
933 Ga0207667_10041872
934 Ga0207667_10113456
935 Ga0207667_10563682
936 Ga0207651_10003511
937 Ga0207651_10037473
938 Ga0207712_10104175
939 Ga0207712_10153420
940 Ga0207668_10000968
941 Ga0207668_10133598
942 Ga0207640_10006595
943 Ga0207640_10021609
944 Ga0207658_10001919
945 Ga0207658_10006686
946 Ga0207658_10091873
947 Ga0207677_10033837
948 Ga0207677_10088568
949 Ga0207677_10314858
950 Ga0207703_10000375
951 Ga0207703_10015188
952 Ga0207703_10019666
953 Ga0207703_10026050
954 Ga0207703_10070368
955 Ga0207703_10314429
956 Ga0207639_10091865
957 Ga0207639_10252212
958 Ga0207639_10352528
959 Ga0207678_10000711
960 Ga0207678_10003317
961 Ga0207678_10009807
962 Ga0207678_10317485
963 Ga0207678_10338962
964 Ga0207678_10528250
965 Ga0207708_10000134
966 Ga0207708_10000749
967 Ga0207708_10010230
968 Ga0207702_10010113
969 Ga0207702_10089243
970 Ga0207641_10019018
971 Ga0207641_10510520
972 Ga0207648_10000433
973 Ga0207648_10000842
974 Ga0207648_10002680
975 Ga0207648_10005765
976 Ga0207648_10011252
977 Ga0207648_10051060
978 Ga0207676_10010703
979 Ga0207676_10010902
980 Ga0207676_10024579
981 Ga0207676_10048959
982 Ga0207676_10051785
983 Ga0207676_10062591
984 Ga0207676_10517730
985 Ga0207674_10026211
986 Ga0207674_10328098
987 Ga0207675_100000490
988 Ga0207675_100001900
989 Ga0207675_100002302
990 Ga0207675_100026407
991 Ga0207683_10005797
992 Ga0207683_10011107
993 Ga0207683_10012464
994 Ga0207683_10083065
995 Ga0207683_10166311
996 Ga0207698_10002753
997 Ga0207698_10037986
998 Ga0207698_10247142
999 Ga0209281_1000002
1000 Ga0209983_1018933
1001 Ga0207428_10177992
1002 Ga0268266_10164311
1003 Ga0268266_10429243
1004 Ga0268265_10005950
1005 Ga0268265_10010067
1006 Ga0268265_10010172
1007 Ga0268265_10135597
1008 Ga0268264_10000991
1009 Ga0268264_10004638
1010 Ga0268264_10016497
1011 Ga0307517_10000228
1012 Ga0307517_10194207
1013 Ga0307517_10197632
1014 Ga0307515_10027638
1015 Ga0307515_10304248
1016 Ga0307512_10071922
1017 Ga0265328_10020656
1018 Ga0265331_10001779
1019 Ga0265327_10000491
1020 Ga0307509_10004172
1021 Ga0307509_10007733
1022 Ga0307509_10017238
1023 Ga0307509_10062175
1024 Ga0307509_10143518
1025 Ga0307408_100004119
1026 Ga0307408_100113242
1027 Ga0307508_10000273
1028 Ga0307514_10000355
1029 Ga0307514_10094482
1030 Ga0316579_10001716
1031 Ga0316578_10014936
1032 Ga0307516_10004597
1033 Ga0307516_10171053
1034 Ga0307405_10005079
1035 Ga0307413_10103521
1036 Ga0307518_10030185
1037 Ga0307410_10008485
1038 Ga0307406_10003644
1039 Ga0307406_10127200
1040 Ga0307406_10194433
1041 Ga0307412_10005312
1042 Ga0307412_10152284
1043 Ga0307412_10172533
1044 Ga0307416_100174538
1045 Ga0307416_100326714
1046 Ga0307414_10019323
1047 Ga0307414_10137120
1048 Ga0307411_10001450
1049 Ga0307415_100006924
1050 Ga0307510_10000967
1051 Ga0307510_10032606
1052 Ga0307510_10140259
1053 Ga0373959_0013134
1054 Ga0373944_0003244
1055 Ga0373939_0000041
1056 Ga0373960_0000135
1057 Ga0373943_0130977
1058 Ga0373931_0000097
1059 Ga0373931_0000882
1060 Ga0373931_0056926
1061 Ga0373927_0089373
1062 Ga0373927_0119654
1063 Ga0373937_0186202
1064 Ga0316582_0011481
1065 Ga0373925_0015343
1066 Ga0373925_0027068
1067 Ga0373925_0073937
1068 Ga0373925_0157574
1069 Ga0395905_0001659
1070 Ga0395905_0002961
1071 Ga0395905_0053160
1072 Ga0395905_0242920
1073 Ga0436360_0026854
1074 Ga0436360_0702683
1075 Ga0436361_0021397
1076 Ga0436361_0163583
1077 Ga0436361_0480355
1078 Ga0436361_0515416
1079 Ga0436361_0694318
1080 Ga0451791_0028897
1081 Ga0451800_1657359
1082 Ga0450920_021836
1083 Ga0439434_0053546
1084 Ga0450918_000419
1085 Ga0450893_0009516
1086 Ga0451577_0003355
1087 Ga0451577_0011238
1088 Ga0453684_0098650
1089 Ga0453684_0105932
1090 Ga0466968_0029228
1091 Ga0451576_0045812
1092 Ga0466958_0034970
1093 Ga0495592_0000307
1094 Ga0495590_0001456
1095 Ga0495650_0005020
1096 Ga0495597_0000054
1097 Ga0495633_0001764
1098 Ga0495625_0082794
1099 Ga0495647_0048038
1100 Ga0495614_0018660
1101 Ga0496100_0119952
1102 Ga0496101_0035120
1103 Ga0496101_0138814
1104 Ga0496102_0012909
1105 Ga0496102_0352231
1106 Ga0496104_0077458
1107 Ga0496104_0362256
1108 Ga0496105_0031152
1109 Ga0496105_0220206
1110 Ga0496106_0023412
1111 Ga0496106_0063643
1112 Ga0496107_0073536
1113 Ga0496107_0241731
1114 Ga0496108_0096804
1115 Ga0496109_0027726
1116 Ga0496109_0084402
1117 Ga0496110_0058616
1118 Ga0496110_0110927
1119 Ga0496111_0111703
1120 Ga0496112_0110815
1121 Ga0496112_0394269
1122 Ga0496114_0035179
1123 Ga0496114_0172549
1124 Ga0496114_0466587
1125 Ga0496115_0038526
1126 Ga0496118_0180449
1127 Ga0496121_0001278
1128 Ga0496121_0040004
1129 Ga0496124_0000126
1130 Ga0496124_0074561
1131 Ga0496125_0003500
1132 Ga0496125_0107227
1133 Ga0496126_0029704
1134 Ga0501292_006324
1135 Ga0501034_0306624
1136 Ga0501043_0000012
1137 Ga0501046_0000030
1138 Ga0501047_0000049
1139 Ga0501048_0000082
1140 Ga0501198_000029
1141 Ga0501211_001400
1142 Ga0501222_000001
1143 Ga0501083_0010638
1144 Ga0501267_000300
1145 Ga0501044_0180647
1146 Ga0501045_0003743
1147 nmdc:mga0k408_158154_c1
1148 nmdc:mga0k408_42918_c1
1149 nmdc:mga0k408_50179_c1
1150 nmdc:mga09592_1124_c1
1151 nmdc:mga0qj67_290918_c1
1152 nmdc:mga08y16_41344_c1
1153 Ga0500644_0003021
1154 Ga0500559_0000636
1155 Ga0500622_0105998
1156 Ga0590071_028275
1157 Ga0590075_006183
1158 2548499252
1159 2587758242
1160 2643743256
1161 2643866089
1162 2643932722
1163 2644245216
1164 2644292903
1165 2644305704
1166 2644313972
1167 2644647916
1168 2722885718
1169 2739056124
1170 2739241971
1171 2816470727
1172 2839143944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

6

290

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3x43-assembly2.cif.gz_H crystal structure of o-ureido-l-serine synthase 0.9587 1 298
3x44-assembly1.cif.gz_A crystal structure of o-ureido-l-serine-bound k43a mutant of o-ureido-l-serine synthase 0.957 1 299
1o58-assembly1.cif.gz_D crystal structure of o-acetylserine sulfhydrylase (tm0665) from thermotoga maritima at 1.80 a resolution 0.9564 6 299
3fca-assembly1.cif.gz_A genetic incorporation of a metal-ion chelating amino acid into proteins as biophysical probe 0.9542 5 299
1o58-assembly1.cif.gz_B crystal structure of o-acetylserine sulfhydrylase (tm0665) from thermotoga maritima at 1.80 a resolution 0.9525 6 299
ID Description Score Start End Superfamily
af_Q2G0V4_40_140_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9667 43 143 3.40.50.1100
5b1iC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9605 42 139 3.40.50.1100
af_K7L749_14_232_2.10.25.10 Mainly Beta;Ribbon;Laminin;Laminin 0.958 10 233 2.10.25.10
3dkiB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9547 42 151 3.40.50.1100
1j6nA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9532 156 299 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A7Y4J7I4-F1-model_v4 deleted 0.9897 41 183
AF-A0A257NPR7-F1-model_v4 Cysteine synthase (EC 2.5.1.47) 0.9834 1 305 GO:0004124
GO:0006535
AF-A0A3M6QIX4-F1-model_v4 Cysteine synthase (EC 2.5.1.47) 0.9822 1 305 GO:0004124
GO:0006535
AF-A0A7Y0NM23-F1-model_v4 deleted 0.9819 1 303
AF-A0A259KJR6-F1-model_v4 Cysteine synthase (EC 2.5.1.47) 0.9818 1 305 GO:0004124
GO:0006535

Map