F466525
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 586 | 260 | 1172 | 209 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100000023|Ga0070708_10000002318 |
| Length | 218 |
| Sequence | MPVITISRMYGSGGSEVAERVAASLGWSLFDNAMIDAVAERSGLTVAEVSAQDERVPSMVERVAAALSLASPEMMPPVPSGPMETTEERIVAVTRRVIEEAIQIGPAVFVGRGAQCLLAERSDALHVFCFAPRSALRAYAMEKFNIGPAEAERCVADMNKQREQYVKRHWNRNWLAHENYHLCVNTAWLGLDGAAELVIEAARRQFAVAPHTWNKGTG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 154 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 159 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 160 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 161 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 167 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 169 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 172 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 173 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 177 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 178 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 218 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 219 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 220 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 223 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 224 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 243 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 244 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 245 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 247 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 248 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 249 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 250 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.83 |
| Metatranscriptomes | 0.17 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.05 |
| Rhizosphere | 97.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 25.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070708_100000023 | 3300005445 | Bacteria | 110968 |
| 2 | JGI24738J21930_10043570 | 3300002075 | Unclassified | 912 |
| 3 | Ga0065712_10083152 | 3300005290 | Bacteria | 2859 |
| 4 | Ga0070658_10001374 | 3300005327 | Bacteria | 20809 |
| 5 | Ga0070658_10148761 | 3300005327 | Bacteria | 1959 |
| 6 | Ga0070676_10166014 | 3300005328 | Unclassified | 1424 |
| 7 | Ga0070676_10292758 | 3300005328 | Unclassified | 1101 |
| 8 | Ga0070683_100000429 | 3300005329 | Bacteria | 29152 |
| 9 | Ga0070683_100003445 | 3300005329 | Bacteria | 12846 |
| 10 | Ga0070683_100008205 | 3300005329 | Bacteria | 8871 |
| 11 | Ga0070683_100027152 | 3300005329 | Bacteria | 5161 |
| 12 | Ga0070683_100059523 | 3300005329 | Bacteria | 3549 |
| 13 | Ga0070683_100078322 | 3300005329 | Unclassified | 3092 |
| 14 | Ga0070683_100170376 | 3300005329 | Bacteria | 2067 |
| 15 | Ga0070683_100182205 | 3300005329 | Bacteria | 1994 |
| 16 | Ga0070683_100187258 | 3300005329 | Bacteria | 1965 |
| 17 | Ga0070683_100306917 | 3300005329 | Unclassified | 1510 |
| 18 | Ga0070683_100397286 | 3300005329 | Unclassified | 1314 |
| 19 | Ga0070683_100437845 | 3300005329 | Archaea | 1247 |
| 20 | Ga0070683_100563767 | 3300005329 | Bacteria | 1089 |
| 21 | Ga0070690_100048231 | 3300005330 | Bacteria | 2711 |
| 22 | Ga0070690_100144603 | 3300005330 | Bacteria | 1617 |
| 23 | Ga0070690_100233775 | 3300005330 | Unclassified | 1294 |
| 24 | Ga0070670_100031126 | 3300005331 | Bacteria | 4595 |
| 25 | Ga0070670_100280016 | 3300005331 | Archaea | 1456 |
| 26 | Ga0070670_100327484 | 3300005331 | Bacteria | 1343 |
| 27 | Ga0070670_100497461 | 3300005331 | Bacteria | 1084 |
| 28 | Ga0070670_100734123 | 3300005331 | Unclassified | 889 |
| 29 | Ga0068869_100014227 | 3300005334 | Bacteria | 5311 |
| 30 | Ga0068869_100126430 | 3300005334 | Bacteria | 1961 |
| 31 | Ga0068869_100429124 | 3300005334 | Bacteria | 1092 |
| 32 | Ga0070666_10405867 | 3300005335 | Unclassified | 980 |
| 33 | Ga0070680_100000021 | 3300005336 | Bacteria | 81631 |
| 34 | Ga0070680_100002481 | 3300005336 | Bacteria | 13670 |
| 35 | Ga0070680_100138951 | 3300005336 | Unclassified | 2036 |
| 36 | Ga0070680_100259225 | 3300005336 | Unclassified | 1471 |
| 37 | Ga0070682_100003661 | 3300005337 | Bacteria | 8527 |
| 38 | Ga0068868_100077912 | 3300005338 | Unclassified | 2653 |
| 39 | Ga0068868_100110655 | 3300005338 | Bacteria | 2231 |
| 40 | Ga0068868_100263652 | 3300005338 | Unclassified | 1454 |
| 41 | Ga0070660_100015055 | 3300005339 | Bacteria | 5579 |
| 42 | Ga0070660_100020838 | 3300005339 | Bacteria | 4825 |
| 43 | Ga0070660_100117296 | 3300005339 | Bacteria | 2123 |
| 44 | Ga0070689_100019456 | 3300005340 | Bacteria | 5022 |
| 45 | Ga0070689_100082044 | 3300005340 | Unclassified | 2532 |
| 46 | Ga0070689_100114734 | 3300005340 | Bacteria | 2146 |
| 47 | Ga0070689_100206983 | 3300005340 | Archaea | 1604 |
| 48 | Ga0070689_100532651 | 3300005340 | Bacteria | 1010 |
| 49 | Ga0070687_100078823 | 3300005343 | Bacteria | 1791 |
| 50 | Ga0070661_100033311 | 3300005344 | Unclassified | 3731 |
| 51 | Ga0070661_100179622 | 3300005344 | Unclassified | 1610 |
| 52 | Ga0070692_10014075 | 3300005345 | Bacteria | 3747 |
| 53 | Ga0070668_100246329 | 3300005347 | Unclassified | 1482 |
| 54 | Ga0070668_100312771 | 3300005347 | Bacteria | 1320 |
| 55 | Ga0070668_100774723 | 3300005347 | Bacteria | 851 |
| 56 | Ga0070669_100006004 | 3300005353 | Bacteria | 8759 |
| 57 | Ga0070675_100007972 | 3300005354 | Bacteria | 8208 |
| 58 | Ga0070675_100027083 | 3300005354 | Bacteria | 4604 |
| 59 | Ga0070671_100050773 | 3300005355 | Bacteria | 3450 |
| 60 | Ga0070671_100236071 | 3300005355 | Unclassified | 1552 |
| 61 | Ga0070674_100485943 | 3300005356 | Bacteria | 1026 |
| 62 | Ga0070673_100010926 | 3300005364 | Bacteria | 6174 |
| 63 | Ga0070673_100048759 | 3300005364 | Unclassified | 3304 |
| 64 | Ga0070673_100104407 | 3300005364 | Bacteria | 2340 |
| 65 | Ga0070673_100210718 | 3300005364 | Bacteria | 1678 |
| 66 | Ga0070688_100014620 | 3300005365 | Bacteria | 4450 |
| 67 | Ga0070688_100066799 | 3300005365 | Unclassified | 2289 |
| 68 | Ga0070688_100276246 | 3300005365 | Unclassified | 1205 |
| 69 | Ga0070688_100523990 | 3300005365 | Unclassified | 897 |
| 70 | Ga0070659_100002317 | 3300005366 | Bacteria | 13560 |
| 71 | Ga0070659_100003724 | 3300005366 | Bacteria | 10875 |
| 72 | Ga0070659_100019956 | 3300005366 | Bacteria | 5088 |
| 73 | Ga0070659_100055442 | 3300005366 | Bacteria | 3124 |
| 74 | Ga0070667_100097704 | 3300005367 | Bacteria | 2533 |
| 75 | Ga0070667_100323996 | 3300005367 | Bacteria | 1391 |
| 76 | Ga0070667_100452331 | 3300005367 | Bacteria | 1174 |
| 77 | Ga0070709_10022013 | 3300005434 | Bacteria | 3723 |
| 78 | Ga0070709_10066972 | 3300005434 | Bacteria | 2305 |
| 79 | Ga0070713_100047973 | 3300005436 | Bacteria | 3514 |
| 80 | Ga0070713_100114307 | 3300005436 | Bacteria | 2358 |
| 81 | Ga0070713_100786315 | 3300005436 | Unclassified | 912 |
| 82 | Ga0070701_10167586 | 3300005438 | Unclassified | 1277 |
| 83 | Ga0070711_100203548 | 3300005439 | Bacteria | 1529 |
| 84 | Ga0070711_100518045 | 3300005439 | Bacteria | 985 |
| 85 | Ga0070694_100149517 | 3300005444 | Bacteria | 1704 |
| 86 | Ga0070663_100131694 | 3300005455 | Unclassified | 1900 |
| 87 | Ga0070662_100019801 | 3300005457 | Bacteria | 4575 |
| 88 | Ga0070662_100023868 | 3300005457 | Bacteria | 4207 |
| 89 | Ga0070662_100151519 | 3300005457 | Bacteria | 1806 |
| 90 | Ga0070681_10001650 | 3300005458 | Bacteria | 19913 |
| 91 | Ga0070681_10005096 | 3300005458 | Bacteria | 12677 |
| 92 | Ga0070681_10026752 | 3300005458 | Bacteria | 5800 |
| 93 | Ga0070681_10384652 | 3300005458 | Bacteria | 1314 |
| 94 | Ga0068867_100345797 | 3300005459 | Bacteria | 1240 |
| 95 | Ga0068867_101150919 | 3300005459 | Unclassified | 710 |
| 96 | Ga0070685_10098201 | 3300005466 | Unclassified | 1784 |
| 97 | Ga0070685_10486678 | 3300005466 | Bacteria | 871 |
| 98 | Ga0070679_100000866 | 3300005530 | Bacteria | 26295 |
| 99 | Ga0070679_100015528 | 3300005530 | Bacteria | 7317 |
| 100 | Ga0070679_100023172 | 3300005530 | Bacteria | 6076 |
| 101 | Ga0070679_100033634 | 3300005530 | Bacteria | 5076 |
| 102 | Ga0070679_100034148 | 3300005530 | Bacteria | 5040 |
| 103 | Ga0070679_100106812 | 3300005530 | Bacteria | 2785 |
| 104 | Ga0070679_100246067 | 3300005530 | Bacteria | 1745 |
| 105 | Ga0070684_100004192 | 3300005535 | Bacteria | 10922 |
| 106 | Ga0070684_100010409 | 3300005535 | Bacteria | 7368 |
| 107 | Ga0070684_100011064 | 3300005535 | Bacteria | 7177 |
| 108 | Ga0070684_100043478 | 3300005535 | Unclassified | 3880 |
| 109 | Ga0070684_100060557 | 3300005535 | Bacteria | 3312 |
| 110 | Ga0070684_100160196 | 3300005535 | Bacteria | 2041 |
| 111 | Ga0070684_100871339 | 3300005535 | Bacteria | 843 |
| 112 | Ga0068853_100099206 | 3300005539 | Bacteria | 2573 |
| 113 | Ga0068853_100163763 | 3300005539 | Bacteria | 2008 |
| 114 | Ga0068853_100191299 | 3300005539 | Unclassified | 1859 |
| 115 | Ga0068853_100553157 | 3300005539 | Bacteria | 1090 |
| 116 | Ga0070672_100032699 | 3300005543 | Bacteria | 3929 |
| 117 | Ga0070672_100414187 | 3300005543 | Unclassified | 1157 |
| 118 | Ga0070686_100327655 | 3300005544 | Bacteria | 1144 |
| 119 | Ga0070695_100257032 | 3300005545 | Bacteria | 1274 |
| 120 | Ga0070696_100455731 | 3300005546 | Bacteria | 1010 |
| 121 | Ga0070693_100002286 | 3300005547 | Bacteria | 8782 |
| 122 | Ga0070693_100206099 | 3300005547 | Bacteria | 1280 |
| 123 | Ga0070665_100218629 | 3300005548 | Bacteria | 1906 |
| 124 | Ga0068855_100058123 | 3300005563 | Bacteria | 4531 |
| 125 | Ga0068855_100064358 | 3300005563 | Bacteria | 4277 |
| 126 | Ga0068855_100231731 | 3300005563 | Bacteria | 2067 |
| 127 | Ga0070664_100007779 | 3300005564 | Bacteria | 8655 |
| 128 | Ga0070664_100020896 | 3300005564 | Bacteria | 5394 |
| 129 | Ga0070664_100074493 | 3300005564 | Bacteria | 2914 |
| 130 | Ga0070664_100697343 | 3300005564 | Unclassified | 946 |
| 131 | Ga0068857_100003542 | 3300005577 | Bacteria | 13052 |
| 132 | Ga0068857_100035803 | 3300005577 | Bacteria | 4397 |
| 133 | Ga0068857_100053694 | 3300005577 | Bacteria | 3574 |
| 134 | Ga0068857_100886427 | 3300005577 | Unclassified | 855 |
| 135 | Ga0068854_100709070 | 3300005578 | Bacteria | 869 |
| 136 | Ga0068856_100002052 | 3300005614 | Bacteria | 20880 |
| 137 | Ga0068856_100075475 | 3300005614 | Unclassified | 3339 |
| 138 | Ga0068856_100085819 | 3300005614 | Bacteria | 3128 |
| 139 | Ga0068856_100387074 | 3300005614 | Unclassified | 1418 |
| 140 | Ga0068856_100790194 | 3300005614 | Unclassified | 969 |
| 141 | Ga0070702_100007650 | 3300005615 | Bacteria | 5181 |
| 142 | Ga0068852_100013616 | 3300005616 | Bacteria | 6228 |
| 143 | Ga0068852_100029191 | 3300005616 | Bacteria | 4527 |
| 144 | Ga0068852_100035127 | 3300005616 | Unclassified | 4177 |
| 145 | Ga0068859_100010712 | 3300005617 | Bacteria | 9229 |
| 146 | Ga0068859_100515468 | 3300005617 | Bacteria | 1291 |
| 147 | Ga0068864_100018061 | 3300005618 | Bacteria | 5887 |
| 148 | Ga0068864_100073878 | 3300005618 | Bacteria | 2974 |
| 149 | Ga0068861_100070213 | 3300005719 | Bacteria | 2712 |
| 150 | Ga0068870_10004146 | 3300005840 | Bacteria | 6211 |
| 151 | Ga0068870_10171592 | 3300005840 | Bacteria | 1295 |
| 152 | Ga0068863_100017061 | 3300005841 | Bacteria | 6964 |
| 153 | Ga0068863_100496964 | 3300005841 | Bacteria | 1201 |
| 154 | Ga0068858_100237734 | 3300005842 | Unclassified | 1728 |
| 155 | Ga0068858_100328232 | 3300005842 | Unclassified | 1463 |
| 156 | Ga0068858_100383312 | 3300005842 | Bacteria | 1349 |
| 157 | Ga0068858_101034541 | 3300005842 | Unclassified | 805 |
| 158 | Ga0068860_100024437 | 3300005843 | Bacteria | 5838 |
| 159 | Ga0070712_100332847 | 3300006175 | Bacteria | 1238 |
| 160 | Ga0070712_100537996 | 3300006175 | Bacteria | 983 |
| 161 | Ga0097621_100331576 | 3300006237 | Bacteria | 1350 |
| 162 | Ga0068871_100003795 | 3300006358 | Bacteria | 10411 |
| 163 | Ga0068871_100107656 | 3300006358 | Unclassified | 2342 |
| 164 | Ga0075430_100472887 | 3300006846 | Bacteria | 1034 |
| 165 | Ga0075433_10635845 | 3300006852 | Bacteria | 936 |
| 166 | Ga0075434_100056618 | 3300006871 | Bacteria | 3897 |
| 167 | Ga0075434_101555157 | 3300006871 | Bacteria | 670 |
| 168 | Ga0068865_100083963 | 3300006881 | Bacteria | 2294 |
| 169 | Ga0068865_100405321 | 3300006881 | Unclassified | 1118 |
| 170 | Ga0097620_100010712 | 3300006931 | Bacteria | 9229 |
| 171 | Ga0097620_100515522 | 3300006931 | Bacteria | 1291 |
| 172 | Ga0105240_10014816 | 3300009093 | Bacteria | 10626 |
| 173 | Ga0105240_10983416 | 3300009093 | Bacteria | 903 |
| 174 | Ga0111539_10153123 | 3300009094 | Bacteria | 2699 |
| 175 | Ga0105245_10037351 | 3300009098 | Bacteria | 4318 |
| 176 | Ga0105245_10057057 | 3300009098 | Bacteria | 3511 |
| 177 | Ga0105245_10133294 | 3300009098 | Unclassified | 2332 |
| 178 | Ga0105245_10158116 | 3300009098 | Bacteria | 2148 |
| 179 | Ga0105245_10846992 | 3300009098 | Bacteria | 954 |
| 180 | Ga0105243_10146282 | 3300009148 | Unclassified | 2022 |
| 181 | Ga0105241_10018730 | 3300009174 | Bacteria | 5099 |
| 182 | Ga0105241_10162864 | 3300009174 | Bacteria | 1835 |
| 183 | Ga0105242_10057254 | 3300009176 | Bacteria | 3191 |
| 184 | Ga0105242_11213263 | 3300009176 | Unclassified | 774 |
| 185 | Ga0105248_10003991 | 3300009177 | Bacteria | 16313 |
| 186 | Ga0105248_10041515 | 3300009177 | Bacteria | 5157 |
| 187 | Ga0105248_10056911 | 3300009177 | Bacteria | 4387 |
| 188 | Ga0105248_10075620 | 3300009177 | Bacteria | 3785 |
| 189 | Ga0105248_10617573 | 3300009177 | Unclassified | 1223 |
| 190 | Ga0105237_10290238 | 3300009545 | Bacteria | 1638 |
| 191 | Ga0105237_10445973 | 3300009545 | Unclassified | 1300 |
| 192 | Ga0105238_10069649 | 3300009551 | Bacteria | 3518 |
| 193 | Ga0105238_10202151 | 3300009551 | Bacteria | 1963 |
| 194 | Ga0105238_10370145 | 3300009551 | Unclassified | 1423 |
| 195 | Ga0105238_10591299 | 3300009551 | Unclassified | 1117 |
| 196 | Ga0105238_10750266 | 3300009551 | Bacteria | 990 |
| 197 | Ga0105249_10123614 | 3300009553 | Unclassified | 2462 |
| 198 | Ga0105249_10964646 | 3300009553 | Unclassified | 921 |
| 199 | Ga0105246_10002895 | 3300011119 | Bacteria | 10386 |
| 200 | Ga0105246_10753791 | 3300011119 | Bacteria | 859 |
| 201 | Ga0157373_10070346 | 3300013100 | Bacteria | 2473 |
| 202 | Ga0157373_10145961 | 3300013100 | Unclassified | 1664 |
| 203 | Ga0157371_10018031 | 3300013102 | Bacteria | 5228 |
| 204 | Ga0157371_10043561 | 3300013102 | Bacteria | 3196 |
| 205 | Ga0157371_10442843 | 3300013102 | Unclassified | 954 |
| 206 | Ga0157370_10002501 | 3300013104 | Bacteria | 22161 |
| 207 | Ga0157370_10064099 | 3300013104 | Unclassified | 3479 |
| 208 | Ga0157370_10280423 | 3300013104 | Bacteria | 1540 |
| 209 | Ga0157370_10347956 | 3300013104 | Bacteria | 1366 |
| 210 | Ga0157369_10026400 | 3300013105 | Bacteria | 6442 |
| 211 | Ga0157369_10035166 | 3300013105 | Bacteria | 5495 |
| 212 | Ga0157369_10066060 | 3300013105 | Bacteria | 3892 |
| 213 | Ga0157369_10142746 | 3300013105 | Bacteria | 2533 |
| 214 | Ga0157369_10440784 | 3300013105 | Unclassified | 1349 |
| 215 | Ga0157378_10160316 | 3300013297 | Bacteria | 2103 |
| 216 | Ga0157378_10368574 | 3300013297 | Bacteria | 1407 |
| 217 | Ga0163162_10646108 | 3300013306 | Bacteria | 1182 |
| 218 | Ga0163162_10708635 | 3300013306 | Unclassified | 1128 |
| 219 | Ga0163162_11317024 | 3300013306 | Bacteria | 821 |
| 220 | Ga0157372_10003954 | 3300013307 | Bacteria | 15914 |
| 221 | Ga0157372_10015579 | 3300013307 | Bacteria | 8150 |
| 222 | Ga0157372_10030696 | 3300013307 | Bacteria | 5881 |
| 223 | Ga0157372_10056402 | 3300013307 | Bacteria | 4389 |
| 224 | Ga0157372_10057204 | 3300013307 | Bacteria | 4359 |
| 225 | Ga0157372_10057643 | 3300013307 | Bacteria | 4342 |
| 226 | Ga0157372_10397829 | 3300013307 | Unclassified | 1605 |
| 227 | Ga0157375_10023505 | 3300013308 | Bacteria | 5689 |
| 228 | Ga0157375_10146712 | 3300013308 | Bacteria | 2490 |
| 229 | Ga0157375_10301276 | 3300013308 | Bacteria | 1766 |
| 230 | Ga0163163_10038263 | 3300014325 | Bacteria | 4674 |
| 231 | Ga0182008_10210209 | 3300014497 | Archaea | 993 |
| 232 | Ga0157377_10144013 | 3300014745 | Bacteria | 1467 |
| 233 | Ga0157377_10176282 | 3300014745 | Bacteria | 1341 |
| 234 | Ga0157376_10027890 | 3300014969 | Bacteria | 4482 |
| 235 | Ga0157376_10360032 | 3300014969 | Bacteria | 1395 |
| 236 | Ga0157376_10382716 | 3300014969 | Bacteria | 1356 |
| 237 | Ga0206354_10647760 | 3300020081 | Bacteria | 1317 |
| 238 | Ga0207697_10160106 | 3300025315 | Unclassified | 982 |
| 239 | Ga0207699_10010833 | 3300025906 | Bacteria | 4590 |
| 240 | Ga0207699_10546209 | 3300025906 | Unclassified | 840 |
| 241 | Ga0207645_10026425 | 3300025907 | Bacteria | 3752 |
| 242 | Ga0207645_10037234 | 3300025907 | Bacteria | 3122 |
| 243 | Ga0207643_10003284 | 3300025908 | Bacteria | 8732 |
| 244 | Ga0207705_10000670 | 3300025909 | Bacteria | 28487 |
| 245 | Ga0207705_10003061 | 3300025909 | Bacteria | 12752 |
| 246 | Ga0207705_10029615 | 3300025909 | Bacteria | 3903 |
| 247 | Ga0207705_10107337 | 3300025909 | Bacteria | 2060 |
| 248 | Ga0207705_10162224 | 3300025909 | Unclassified | 1680 |
| 249 | Ga0207654_10016668 | 3300025911 | Bacteria | 3829 |
| 250 | Ga0207707_10001106 | 3300025912 | Bacteria | 25637 |
| 251 | Ga0207707_10003856 | 3300025912 | Bacteria | 13291 |
| 252 | Ga0207707_10057319 | 3300025912 | Bacteria | 3391 |
| 253 | Ga0207707_10116545 | 3300025912 | Bacteria | 2334 |
| 254 | Ga0207695_10022378 | 3300025913 | Bacteria | 7177 |
| 255 | Ga0207660_10000141 | 3300025917 | Bacteria | 43491 |
| 256 | Ga0207660_10024045 | 3300025917 | Bacteria | 4121 |
| 257 | Ga0207660_10091039 | 3300025917 | Unclassified | 2261 |
| 258 | Ga0207660_10092703 | 3300025917 | Bacteria | 2243 |
| 259 | Ga0207662_10004172 | 3300025918 | Bacteria | 7569 |
| 260 | Ga0207657_10001978 | 3300025919 | Bacteria | 22123 |
| 261 | Ga0207657_10014269 | 3300025919 | Bacteria | 7767 |
| 262 | Ga0207657_10066140 | 3300025919 | Bacteria | 3078 |
| 263 | Ga0207657_10079609 | 3300025919 | Bacteria | 2757 |
| 264 | Ga0207657_10214313 | 3300025919 | Bacteria | 1544 |
| 265 | Ga0207649_10047251 | 3300025920 | Unclassified | 2648 |
| 266 | Ga0207652_10001406 | 3300025921 | Bacteria | 21353 |
| 267 | Ga0207652_10009561 | 3300025921 | Bacteria | 7798 |
| 268 | Ga0207652_10012300 | 3300025921 | Bacteria | 6912 |
| 269 | Ga0207652_10024028 | 3300025921 | Bacteria | 5056 |
| 270 | Ga0207652_10068377 | 3300025921 | Bacteria | 3082 |
| 271 | Ga0207652_10122308 | 3300025921 | Bacteria | 2316 |
| 272 | Ga0207652_10310359 | 3300025921 | Bacteria | 1424 |
| 273 | Ga0207646_10074381 | 3300025922 | Bacteria | 3035 |
| 274 | Ga0207646_10684278 | 3300025922 | Bacteria | 918 |
| 275 | Ga0207681_10010386 | 3300025923 | Bacteria | 5698 |
| 276 | Ga0207681_10076131 | 3300025923 | Bacteria | 2356 |
| 277 | Ga0207694_10026995 | 3300025924 | Bacteria | 4372 |
| 278 | Ga0207694_10174877 | 3300025924 | Bacteria | 1740 |
| 279 | Ga0207694_10484310 | 3300025924 | Unclassified | 1035 |
| 280 | Ga0207650_10100804 | 3300025925 | Unclassified | 2222 |
| 281 | Ga0207650_10233166 | 3300025925 | Unclassified | 1485 |
| 282 | Ga0207650_10243648 | 3300025925 | Bacteria | 1453 |
| 283 | Ga0207650_10263452 | 3300025925 | Bacteria | 1399 |
| 284 | Ga0207650_10598746 | 3300025925 | Archaea | 927 |
| 285 | Ga0207659_10003174 | 3300025926 | Bacteria | 9829 |
| 286 | Ga0207659_10116031 | 3300025926 | Unclassified | 2043 |
| 287 | Ga0207687_10045136 | 3300025927 | Unclassified | 3045 |
| 288 | Ga0207687_10269335 | 3300025927 | Bacteria | 1361 |
| 289 | Ga0207700_10049339 | 3300025928 | Bacteria | 3131 |
| 290 | Ga0207700_10055995 | 3300025928 | Bacteria | 2966 |
| 291 | Ga0207664_10004807 | 3300025929 | Bacteria | 9182 |
| 292 | Ga0207664_10434326 | 3300025929 | Unclassified | 1171 |
| 293 | Ga0207644_10297722 | 3300025931 | Unclassified | 1299 |
| 294 | Ga0207644_10344069 | 3300025931 | Unclassified | 1210 |
| 295 | Ga0207690_10021775 | 3300025932 | Bacteria | 3979 |
| 296 | Ga0207690_10070373 | 3300025932 | Bacteria | 2410 |
| 297 | Ga0207690_10230909 | 3300025932 | Unclassified | 1420 |
| 298 | Ga0207706_10002611 | 3300025933 | Bacteria | 17546 |
| 299 | Ga0207706_10175519 | 3300025933 | Bacteria | 1882 |
| 300 | Ga0207706_10334280 | 3300025933 | Unclassified | 1318 |
| 301 | Ga0207686_10065371 | 3300025934 | Unclassified | 2319 |
| 302 | Ga0207686_10243657 | 3300025934 | Unclassified | 1310 |
| 303 | Ga0207686_10759399 | 3300025934 | Unclassified | 775 |
| 304 | Ga0207670_10399770 | 3300025936 | Unclassified | 1098 |
| 305 | Ga0207670_10549657 | 3300025936 | Bacteria | 943 |
| 306 | Ga0207669_10776938 | 3300025937 | Bacteria | 793 |
| 307 | Ga0207665_10201783 | 3300025939 | Bacteria | 1449 |
| 308 | Ga0207691_10033076 | 3300025940 | Bacteria | 4817 |
| 309 | Ga0207691_10139252 | 3300025940 | Bacteria | 2139 |
| 310 | Ga0207691_10297040 | 3300025940 | Bacteria | 1388 |
| 311 | Ga0207711_10037887 | 3300025941 | Unclassified | 4098 |
| 312 | Ga0207711_10367035 | 3300025941 | Unclassified | 1335 |
| 313 | Ga0207711_10950633 | 3300025941 | Unclassified | 798 |
| 314 | Ga0207689_10046742 | 3300025942 | Unclassified | 3576 |
| 315 | Ga0207689_10078904 | 3300025942 | Bacteria | 2706 |
| 316 | Ga0207689_10179325 | 3300025942 | Bacteria | 1747 |
| 317 | Ga0207661_10000363 | 3300025944 | Bacteria | 29142 |
| 318 | Ga0207661_10009404 | 3300025944 | Bacteria | 7008 |
| 319 | Ga0207661_10011500 | 3300025944 | Bacteria | 6415 |
| 320 | Ga0207661_10055418 | 3300025944 | Bacteria | 3180 |
| 321 | Ga0207661_10069587 | 3300025944 | Bacteria | 2870 |
| 322 | Ga0207661_10121915 | 3300025944 | Unclassified | 2220 |
| 323 | Ga0207661_10243295 | 3300025944 | Bacteria | 1597 |
| 324 | Ga0207661_10264018 | 3300025944 | Unclassified | 1534 |
| 325 | Ga0207661_10466546 | 3300025944 | Bacteria | 1151 |
| 326 | Ga0207679_10002053 | 3300025945 | Bacteria | 12503 |
| 327 | Ga0207679_10031263 | 3300025945 | Bacteria | 3725 |
| 328 | Ga0207679_10214573 | 3300025945 | Bacteria | 1616 |
| 329 | Ga0207679_10526131 | 3300025945 | Bacteria | 1058 |
| 330 | Ga0207667_10128851 | 3300025949 | Bacteria | 2606 |
| 331 | Ga0207667_10295896 | 3300025949 | Unclassified | 1654 |
| 332 | Ga0207667_10413757 | 3300025949 | Bacteria | 1372 |
| 333 | Ga0207667_10455900 | 3300025949 | Unclassified | 1299 |
| 334 | Ga0207667_10517844 | 3300025949 | Unclassified | 1208 |
| 335 | Ga0207651_10127919 | 3300025960 | Unclassified | 1939 |
| 336 | Ga0207651_10179013 | 3300025960 | Bacteria | 1680 |
| 337 | Ga0207651_10437555 | 3300025960 | Unclassified | 1119 |
| 338 | Ga0207651_10754526 | 3300025960 | Bacteria | 860 |
| 339 | Ga0207712_10098017 | 3300025961 | Bacteria | 2173 |
| 340 | Ga0207712_10773135 | 3300025961 | Unclassified | 843 |
| 341 | Ga0207668_10213681 | 3300025972 | Unclassified | 1544 |
| 342 | Ga0207658_10186533 | 3300025986 | Bacteria | 1721 |
| 343 | Ga0207677_10208724 | 3300026023 | Unclassified | 1558 |
| 344 | Ga0207703_10083256 | 3300026035 | Bacteria | 2672 |
| 345 | Ga0207703_10321624 | 3300026035 | Bacteria | 1417 |
| 346 | Ga0207703_10677563 | 3300026035 | Bacteria | 980 |
| 347 | Ga0207639_10092636 | 3300026041 | Bacteria | 2422 |
| 348 | Ga0207639_10131053 | 3300026041 | Bacteria | 2075 |
| 349 | Ga0207678_10148938 | 3300026067 | Bacteria | 1998 |
| 350 | Ga0207702_10214837 | 3300026078 | Bacteria | 1789 |
| 351 | Ga0207702_10347560 | 3300026078 | Unclassified | 1418 |
| 352 | Ga0207641_10058029 | 3300026088 | Unclassified | 3293 |
| 353 | Ga0207648_10227626 | 3300026089 | Unclassified | 1658 |
| 354 | Ga0207676_10005668 | 3300026095 | Bacteria | 8841 |
| 355 | Ga0207676_10075853 | 3300026095 | Bacteria | 2714 |
| 356 | Ga0207674_10001269 | 3300026116 | Bacteria | 32986 |
| 357 | Ga0207674_10004648 | 3300026116 | Bacteria | 16486 |
| 358 | Ga0207674_10015375 | 3300026116 | Bacteria | 8408 |
| 359 | Ga0207674_10260130 | 3300026116 | Bacteria | 1683 |
| 360 | Ga0207683_10235384 | 3300026121 | Bacteria | 1670 |
| 361 | Ga0207683_10364516 | 3300026121 | Unclassified | 1327 |
| 362 | Ga0207698_10026244 | 3300026142 | Unclassified | 4119 |
| 363 | Ga0207698_10080161 | 3300026142 | Unclassified | 2629 |
| 364 | Ga0207698_10185422 | 3300026142 | Unclassified | 1848 |
| 365 | Ga0207698_10904514 | 3300026142 | Unclassified | 890 |
| 366 | Ga0209982_1025024 | 3300027552 | Unclassified | 927 |
| 367 | Ga0209966_1001178 | 3300027695 | Bacteria | 4667 |
| 368 | Ga0209998_10000445 | 3300027717 | Bacteria | 11485 |
| 369 | Ga0209974_10033586 | 3300027876 | Bacteria | 1703 |
| 370 | Ga0207428_10407230 | 3300027907 | Bacteria | 995 |
| 371 | Ga0268266_10109357 | 3300028379 | Bacteria | 2448 |
| 372 | Ga0268266_11212091 | 3300028379 | Bacteria | 730 |
| 373 | Ga0268264_10118540 | 3300028381 | Unclassified | 2329 |
| 374 | Ga0307408_100250034 | 3300031548 | Unclassified | 1462 |
| 375 | Ga0307408_100285533 | 3300031548 | Bacteria | 1376 |
| 376 | Ga0307408_100315215 | 3300031548 | Bacteria | 1316 |
| 377 | Ga0307405_10039542 | 3300031731 | Bacteria | 2851 |
| 378 | Ga0307405_10287733 | 3300031731 | Unclassified | 1240 |
| 379 | Ga0307413_10004673 | 3300031824 | Bacteria | 6000 |
| 380 | Ga0307413_10034144 | 3300031824 | Bacteria | 2904 |
| 381 | Ga0307410_10012151 | 3300031852 | Bacteria | 4962 |
| 382 | Ga0307410_10027806 | 3300031852 | Bacteria | 3577 |
| 383 | Ga0307410_10056447 | 3300031852 | Unclassified | 2670 |
| 384 | Ga0307410_10067196 | 3300031852 | Bacteria | 2472 |
| 385 | Ga0307410_10069327 | 3300031852 | Bacteria | 2439 |
| 386 | Ga0307406_10049068 | 3300031901 | Bacteria | 2670 |
| 387 | Ga0307406_10071041 | 3300031901 | Bacteria | 2281 |
| 388 | Ga0307406_10417025 | 3300031901 | Unclassified | 1068 |
| 389 | Ga0307406_10509109 | 3300031901 | Bacteria | 977 |
| 390 | Ga0307406_10576842 | 3300031901 | Unclassified | 924 |
| 391 | Ga0307407_10003358 | 3300031903 | Bacteria | 6547 |
| 392 | Ga0307407_10042641 | 3300031903 | Bacteria | 2545 |
| 393 | Ga0307407_10045875 | 3300031903 | Bacteria | 2472 |
| 394 | Ga0307412_10377704 | 3300031911 | Unclassified | 1146 |
| 395 | Ga0307409_100002889 | 3300031995 | Bacteria | 9107 |
| 396 | Ga0307409_100430199 | 3300031995 | Bacteria | 1268 |
| 397 | Ga0307409_100635413 | 3300031995 | Unclassified | 1059 |
| 398 | Ga0307416_100067311 | 3300032002 | Bacteria | 2953 |
| 399 | Ga0307416_100103317 | 3300032002 | Bacteria | 2488 |
| 400 | Ga0307416_100217752 | 3300032002 | Bacteria | 1828 |
| 401 | Ga0307416_100243898 | 3300032002 | Bacteria | 1743 |
| 402 | Ga0307416_100406711 | 3300032002 | Bacteria | 1400 |
| 403 | Ga0307414_10008574 | 3300032004 | Bacteria | 5809 |
| 404 | Ga0307414_10425122 | 3300032004 | Unclassified | 1159 |
| 405 | Ga0307414_10975360 | 3300032004 | Bacteria | 779 |
| 406 | Ga0307411_10047928 | 3300032005 | Bacteria | 2765 |
| 407 | Ga0307411_10420123 | 3300032005 | Unclassified | 1110 |
| 408 | Ga0307411_10421441 | 3300032005 | Bacteria | 1109 |
| 409 | Ga0307415_100001175 | 3300032126 | Bacteria | 12238 |
| 410 | Ga0307415_100023181 | 3300032126 | Bacteria | 3848 |
| 411 | Ga0307415_100190068 | 3300032126 | Unclassified | 1619 |
| 412 | Ga0307415_100506111 | 3300032126 | Bacteria | 1057 |
| 413 | Ga0307415_100803909 | 3300032126 | Unclassified | 859 |
| 414 | Ga0373959_0065946 | 3300034820 | Bacteria | 810 |
| 415 | Ga0373934_0009977 | 3300035086 | Bacteria | 3563 |
| 416 | Ga0373923_0234400 | 3300035111 | Unclassified | 856 |
| 417 | Ga0373954_0062432 | 3300035118 | Bacteria | 1760 |
| 418 | Ga0373954_0094415 | 3300035118 | Unclassified | 1439 |
| 419 | Ga0373956_0025215 | 3300035119 | Bacteria | 2568 |
| 420 | Ga0373956_0053574 | 3300035119 | Unclassified | 1816 |
| 421 | Ga0373957_0023425 | 3300035120 | Bacteria | 2208 |
| 422 | Ga0373955_0014043 | 3300035172 | Bacteria | 3888 |
| 423 | Ga0373924_0013275 | 3300035410 | Bacteria | 3093 |
| 424 | Ga0373931_0078409 | 3300035691 | Bacteria | 1817 |
| 425 | Ga0373935_0740048 | 3300035692 | Bacteria | 724 |
| 426 | Ga0373927_0106175 | 3300035695 | Bacteria | 1828 |
| 427 | Ga0373933_0004877 | 3300035724 | Bacteria | 7322 |
| 428 | Ga0373947_0025409 | 3300035725 | Bacteria | 3455 |
| 429 | Ga0373937_0006852 | 3300036401 | Bacteria | 9832 |
| 430 | Ga0373925_0047067 | 3300037068 | Bacteria | 3209 |
| 431 | Ga0373925_0632393 | 3300037068 | Unclassified | 882 |
| 432 | Ga0451576_0217028 | 3300045051 | Bacteria | 1997 |
| 433 | Ga0451576_0446543 | 3300045051 | Bacteria | 1357 |
| 434 | Ga0466967_0056584 | 3300045976 | Bacteria | 3459 |
| 435 | Ga0466967_0418036 | 3300045976 | Bacteria | 1306 |
| 436 | Ga0466967_1028494 | 3300045976 | Unclassified | 820 |
| 437 | Ga0495629_0010765 | 3300046459 | Bacteria | 6653 |
| 438 | Ga0495629_0218800 | 3300046459 | Unclassified | 1314 |
| 439 | Ga0495651_0096749 | 3300046462 | Unclassified | 2205 |
| 440 | Ga0495651_0098975 | 3300046462 | Bacteria | 2175 |
| 441 | Ga0495653_0036083 | 3300046463 | Bacteria | 3897 |
| 442 | Ga0495580_0003742 | 3300046472 | Bacteria | 12880 |
| 443 | Ga0495582_0210287 | 3300046473 | Bacteria | 1112 |
| 444 | Ga0495582_0304000 | 3300046473 | Unclassified | 917 |
| 445 | Ga0495582_0489843 | 3300046473 | Unclassified | 711 |
| 446 | Ga0495639_0005908 | 3300046475 | Bacteria | 5266 |
| 447 | Ga0495639_0337229 | 3300046475 | Unclassified | 756 |
| 448 | Ga0495664_0067967 | 3300046477 | Bacteria | 2126 |
| 449 | Ga0495594_0003626 | 3300046499 | Bacteria | 7941 |
| 450 | Ga0495594_0003972 | 3300046499 | Bacteria | 7607 |
| 451 | Ga0495594_0011231 | 3300046499 | Bacteria | 4652 |
| 452 | Ga0495594_0015462 | 3300046499 | Bacteria | 4009 |
| 453 | Ga0495594_0486002 | 3300046499 | Unclassified | 702 |
| 454 | Ga0495608_0221634 | 3300046511 | Unclassified | 1186 |
| 455 | Ga0495618_0124253 | 3300046514 | Unclassified | 1652 |
| 456 | Ga0495628_0048377 | 3300046516 | Bacteria | 3371 |
| 457 | Ga0495630_0029394 | 3300046517 | Bacteria | 4087 |
| 458 | Ga0495630_0033414 | 3300046517 | Bacteria | 3837 |
| 459 | Ga0495666_0278923 | 3300046526 | Unclassified | 758 |
| 460 | Ga0495652_0000395 | 3300046529 | Bacteria | 51356 |
| 461 | Ga0495652_0004855 | 3300046529 | Bacteria | 12770 |
| 462 | Ga0495652_0117860 | 3300046529 | Bacteria | 2123 |
| 463 | Ga0495665_0016781 | 3300046531 | Unclassified | 3942 |
| 464 | Ga0495640_0404523 | 3300046533 | Bacteria | 838 |
| 465 | Ga0495586_0016003 | 3300046535 | Bacteria | 3990 |
| 466 | Ga0495586_0021164 | 3300046535 | Bacteria | 3465 |
| 467 | Ga0495586_0036607 | 3300046535 | Unclassified | 2635 |
| 468 | Ga0495586_0088111 | 3300046535 | Bacteria | 1712 |
| 469 | Ga0495587_0001882 | 3300046536 | Bacteria | 13958 |
| 470 | Ga0495587_0004959 | 3300046536 | Bacteria | 8723 |
| 471 | Ga0495621_0005014 | 3300046539 | Bacteria | 3775 |
| 472 | Ga0495645_0000230 | 3300046543 | Bacteria | 40449 |
| 473 | Ga0495645_0124298 | 3300046543 | Unclassified | 1814 |
| 474 | Ga0495645_0317214 | 3300046543 | Bacteria | 1013 |
| 475 | Ga0495622_0283584 | 3300046557 | Unclassified | 724 |
| 476 | Ga0495667_0000423 | 3300046559 | Bacteria | 27174 |
| 477 | Ga0495667_0064624 | 3300046559 | Unclassified | 2393 |
| 478 | Ga0495634_0159451 | 3300046642 | Unclassified | 1423 |
| 479 | Ga0495659_0138083 | 3300046664 | Unclassified | 971 |
| 480 | Ga0495657_0131345 | 3300046675 | Bacteria | 1568 |
| 481 | Ga0495657_0231182 | 3300046675 | Archaea | 1118 |
| 482 | Ga0495599_0027392 | 3300046678 | Bacteria | 3572 |
| 483 | Ga0495599_0071073 | 3300046678 | Bacteria | 2172 |
| 484 | Ga0495623_0031564 | 3300046679 | Bacteria | 3405 |
| 485 | Ga0495623_0041644 | 3300046679 | Bacteria | 2928 |
| 486 | Ga0495623_0177332 | 3300046679 | Bacteria | 1241 |
| 487 | Ga0495646_0329697 | 3300046680 | Unclassified | 802 |
| 488 | Ga0495658_0174988 | 3300046683 | Bacteria | 1330 |
| 489 | Ga0495613_0014494 | 3300046689 | Bacteria | 5848 |
| 490 | Ga0495613_0052140 | 3300046689 | Bacteria | 3014 |
| 491 | Ga0495613_0163162 | 3300046689 | Unclassified | 1584 |
| 492 | Ga0495600_0032981 | 3300046809 | Bacteria | 3361 |
| 493 | Ga0495600_0098639 | 3300046809 | Bacteria | 1904 |
| 494 | Ga0495581_0010067 | 3300047315 | Bacteria | 5468 |
| 495 | Ga0495581_0062683 | 3300047315 | Bacteria | 2149 |
| 496 | Ga0495581_0140023 | 3300047315 | Bacteria | 1411 |
| 497 | Ga0495581_0154915 | 3300047315 | Unclassified | 1339 |
| 498 | Ga0495581_0205323 | 3300047315 | Bacteria | 1152 |
| 499 | Ga0495604_0125553 | 3300047317 | Unclassified | 1851 |
| 500 | Ga0495674_0158302 | 3300047319 | Bacteria | 1896 |
| 501 | Ga0495674_0250743 | 3300047319 | Unclassified | 1457 |
| 502 | Ga0495672_0243283 | 3300047320 | Bacteria | 877 |
| 503 | Ga0495680_0107664 | 3300047322 | Bacteria | 2070 |
| 504 | Ga0495675_0002427 | 3300047444 | Bacteria | 11139 |
| 505 | Ga0495675_0015531 | 3300047444 | Bacteria | 4815 |
| 506 | Ga0495675_0102297 | 3300047444 | Unclassified | 1792 |
| 507 | Ga0495675_0142402 | 3300047444 | Unclassified | 1485 |
| 508 | Ga0495685_017974 | 3300047447 | Unclassified | 2423 |
| 509 | Ga0495614_0174847 | 3300048089 | Unclassified | 964 |
| 510 | Ga0496104_0418714 | 3300048907 | Unclassified | 1252 |
| 511 | Ga0496106_0044929 | 3300048909 | Bacteria | 3317 |
| 512 | Ga0496107_0195061 | 3300048910 | Bacteria | 1505 |
| 513 | Ga0496108_0106084 | 3300048911 | Bacteria | 2399 |
| 514 | Ga0496108_0561925 | 3300048911 | Unclassified | 995 |
| 515 | Ga0496109_0064903 | 3300048912 | Bacteria | 3342 |
| 516 | Ga0496111_0130039 | 3300048914 | Bacteria | 1863 |
| 517 | Ga0496112_0001127 | 3300048915 | Bacteria | 19878 |
| 518 | Ga0496112_0038641 | 3300048915 | Bacteria | 4661 |
| 519 | Ga0496113_0008540 | 3300048916 | Bacteria | 6680 |
| 520 | Ga0496115_0217035 | 3300048918 | Bacteria | 1579 |
| 521 | Ga0496115_0455413 | 3300048918 | Archaea | 1033 |
| 522 | Ga0501032_0127294 | 3300049569 | Bacteria | 1682 |
| 523 | Ga0501033_0006687 | 3300049570 | Bacteria | 9009 |
| 524 | Ga0501033_0209939 | 3300049570 | Bacteria | 1389 |
| 525 | Ga0501034_0003244 | 3300049571 | Bacteria | 18603 |
| 526 | Ga0501034_0112273 | 3300049571 | Bacteria | 2716 |
| 527 | Ga0501034_0120042 | 3300049571 | Bacteria | 2615 |
| 528 | Ga0501036_0049773 | 3300049572 | Bacteria | 3549 |
| 529 | Ga0501036_0056181 | 3300049572 | Bacteria | 3335 |
| 530 | Ga0501036_0307645 | 3300049572 | Bacteria | 1325 |
| 531 | Ga0501037_0039227 | 3300049573 | Bacteria | 3488 |
| 532 | Ga0501043_0061083 | 3300049579 | Bacteria | 2960 |
| 533 | Ga0501047_0080294 | 3300049581 | Bacteria | 3135 |
| 534 | Ga0501047_0148542 | 3300049581 | Bacteria | 2220 |
| 535 | Ga0501047_0386117 | 3300049581 | Bacteria | 1234 |
| 536 | Ga0501047_0778221 | 3300049581 | Bacteria | 772 |
| 537 | Ga0501067_0000044 | 3300049583 | Bacteria | 74423 |
| 538 | Ga0501067_0031156 | 3300049583 | Bacteria | 2959 |
| 539 | Ga0501067_0073649 | 3300049583 | Bacteria | 1892 |
| 540 | Ga0501068_0000908 | 3300049584 | Bacteria | 15488 |
| 541 | Ga0501068_0036056 | 3300049584 | Bacteria | 2955 |
| 542 | Ga0501069_0001029 | 3300049585 | Bacteria | 13327 |
| 543 | Ga0501069_0012765 | 3300049585 | Bacteria | 4471 |
| 544 | Ga0501069_0015388 | 3300049585 | Bacteria | 4099 |
| 545 | Ga0501070_0001048 | 3300049586 | Bacteria | 24902 |
| 546 | Ga0501070_0010508 | 3300049586 | Bacteria | 7825 |
| 547 | Ga0501071_0000794 | 3300049587 | Bacteria | 16834 |
| 548 | Ga0501071_0001269 | 3300049587 | Bacteria | 14325 |
| 549 | Ga0501071_0318447 | 3300049587 | Bacteria | 1181 |
| 550 | Ga0501072_0001312 | 3300049588 | Bacteria | 18637 |
| 551 | Ga0501072_0040141 | 3300049588 | Bacteria | 3675 |
| 552 | Ga0501073_0000776 | 3300049589 | Bacteria | 22713 |
| 553 | Ga0501073_0015360 | 3300049589 | Bacteria | 5553 |
| 554 | Ga0501073_0017380 | 3300049589 | Bacteria | 5210 |
| 555 | Ga0501073_0322274 | 3300049589 | Bacteria | 1067 |
| 556 | Ga0501074_0033216 | 3300049590 | Bacteria | 3738 |
| 557 | Ga0501076_0085465 | 3300049592 | Bacteria | 2535 |
| 558 | Ga0501198_019348 | 3300049649 | Bacteria | 1072 |
| 559 | Ga0501199_012007 | 3300049650 | Unclassified | 942 |
| 560 | Ga0501202_001630 | 3300049652 | Bacteria | 3630 |
| 561 | Ga0501223_020878 | 3300049663 | Unclassified | 1282 |
| 562 | Ga0501233_061105 | 3300049668 | Bacteria | 935 |
| 563 | Ga0501251_028469 | 3300049681 | Unclassified | 784 |
| 564 | Ga0501259_006622 | 3300049688 | Bacteria | 1845 |
| 565 | Ga0501225_0004283 | 3300049705 | Bacteria | 4265 |
| 566 | Ga0501080_0001929 | 3300049742 | Bacteria | 17903 |
| 567 | Ga0501080_0005995 | 3300049742 | Bacteria | 10894 |
| 568 | Ga0501080_0057725 | 3300049742 | Bacteria | 3613 |
| 569 | Ga0501080_0263802 | 3300049742 | Unclassified | 1569 |
| 570 | Ga0501081_0160823 | 3300049743 | Bacteria | 1618 |
| 571 | Ga0501081_0983413 | 3300049743 | Bacteria | 637 |
| 572 | Ga0501083_0017086 | 3300049744 | Bacteria | 5063 |
| 573 | Ga0501083_0074830 | 3300049744 | Bacteria | 2249 |
| 574 | Ga0501035_0118663 | 3300049822 | Bacteria | 2314 |
| 575 | Ga0501035_0394679 | 3300049822 | Bacteria | 1152 |
| 576 | nmdc:mga08y16_187646_c1 | 3300050511 | Bacteria | 2145 |
| 577 | nmdc:mga08y16_268823_c1 | 3300050511 | Bacteria | 1760 |
| 578 | nmdc:mga0n895_134783_c1 | 3300050512 | Bacteria | 2496 |
| 579 | Ga0495601_0176325 | 3300053077 | Bacteria | 1397 |
| 580 | Ga0495595_0071052 | 3300053084 | Bacteria | 1645 |
| 581 | Ga0495595_0089136 | 3300053084 | Unclassified | 1478 |
| 582 | Ga0495619_0109019 | 3300053085 | Unclassified | 1890 |
| 583 | Ga0501084_0009557 | 3300054114 | Bacteria | 8027 |
| 584 | Ga0501084_0137781 | 3300054114 | Bacteria | 2054 |
| 585 | Ga0501082_0006301 | 3300060353 | Bacteria | 10290 |
| 586 | Ga0501082_0021156 | 3300060353 | Bacteria | 5610 |
| 587 | Ga0070708_100000023 | |||
| 588 | JGI24738J21930_10043570 | |||
| 589 | Ga0065712_10083152 | |||
| 590 | Ga0070658_10001374 | |||
| 591 | Ga0070658_10148761 | |||
| 592 | Ga0070676_10166014 | |||
| 593 | Ga0070676_10292758 | |||
| 594 | Ga0070683_100000429 | |||
| 595 | Ga0070683_100003445 | |||
| 596 | Ga0070683_100008205 | |||
| 597 | Ga0070683_100027152 | |||
| 598 | Ga0070683_100059523 | |||
| 599 | Ga0070683_100078322 | |||
| 600 | Ga0070683_100170376 | |||
| 601 | Ga0070683_100182205 | |||
| 602 | Ga0070683_100187258 | |||
| 603 | Ga0070683_100306917 | |||
| 604 | Ga0070683_100397286 | |||
| 605 | Ga0070683_100437845 | |||
| 606 | Ga0070683_100563767 | |||
| 607 | Ga0070690_100048231 | |||
| 608 | Ga0070690_100144603 | |||
| 609 | Ga0070690_100233775 | |||
| 610 | Ga0070670_100031126 | |||
| 611 | Ga0070670_100280016 | |||
| 612 | Ga0070670_100327484 | |||
| 613 | Ga0070670_100497461 | |||
| 614 | Ga0070670_100734123 | |||
| 615 | Ga0068869_100014227 | |||
| 616 | Ga0068869_100126430 | |||
| 617 | Ga0068869_100429124 | |||
| 618 | Ga0070666_10405867 | |||
| 619 | Ga0070680_100000021 | |||
| 620 | Ga0070680_100002481 | |||
| 621 | Ga0070680_100138951 | |||
| 622 | Ga0070680_100259225 | |||
| 623 | Ga0070682_100003661 | |||
| 624 | Ga0068868_100077912 | |||
| 625 | Ga0068868_100110655 | |||
| 626 | Ga0068868_100263652 | |||
| 627 | Ga0070660_100015055 | |||
| 628 | Ga0070660_100020838 | |||
| 629 | Ga0070660_100117296 | |||
| 630 | Ga0070689_100019456 | |||
| 631 | Ga0070689_100082044 | |||
| 632 | Ga0070689_100114734 | |||
| 633 | Ga0070689_100206983 | |||
| 634 | Ga0070689_100532651 | |||
| 635 | Ga0070687_100078823 | |||
| 636 | Ga0070661_100033311 | |||
| 637 | Ga0070661_100179622 | |||
| 638 | Ga0070692_10014075 | |||
| 639 | Ga0070668_100246329 | |||
| 640 | Ga0070668_100312771 | |||
| 641 | Ga0070668_100774723 | |||
| 642 | Ga0070669_100006004 | |||
| 643 | Ga0070675_100007972 | |||
| 644 | Ga0070675_100027083 | |||
| 645 | Ga0070671_100050773 | |||
| 646 | Ga0070671_100236071 | |||
| 647 | Ga0070674_100485943 | |||
| 648 | Ga0070673_100010926 | |||
| 649 | Ga0070673_100048759 | |||
| 650 | Ga0070673_100104407 | |||
| 651 | Ga0070673_100210718 | |||
| 652 | Ga0070688_100014620 | |||
| 653 | Ga0070688_100066799 | |||
| 654 | Ga0070688_100276246 | |||
| 655 | Ga0070688_100523990 | |||
| 656 | Ga0070659_100002317 | |||
| 657 | Ga0070659_100003724 | |||
| 658 | Ga0070659_100019956 | |||
| 659 | Ga0070659_100055442 | |||
| 660 | Ga0070667_100097704 | |||
| 661 | Ga0070667_100323996 | |||
| 662 | Ga0070667_100452331 | |||
| 663 | Ga0070709_10022013 | |||
| 664 | Ga0070709_10066972 | |||
| 665 | Ga0070713_100047973 | |||
| 666 | Ga0070713_100114307 | |||
| 667 | Ga0070713_100786315 | |||
| 668 | Ga0070701_10167586 | |||
| 669 | Ga0070711_100203548 | |||
| 670 | Ga0070711_100518045 | |||
| 671 | Ga0070694_100149517 | |||
| 672 | Ga0070663_100131694 | |||
| 673 | Ga0070662_100019801 | |||
| 674 | Ga0070662_100023868 | |||
| 675 | Ga0070662_100151519 | |||
| 676 | Ga0070681_10001650 | |||
| 677 | Ga0070681_10005096 | |||
| 678 | Ga0070681_10026752 | |||
| 679 | Ga0070681_10384652 | |||
| 680 | Ga0068867_100345797 | |||
| 681 | Ga0068867_101150919 | |||
| 682 | Ga0070685_10098201 | |||
| 683 | Ga0070685_10486678 | |||
| 684 | Ga0070679_100000866 | |||
| 685 | Ga0070679_100015528 | |||
| 686 | Ga0070679_100023172 | |||
| 687 | Ga0070679_100033634 | |||
| 688 | Ga0070679_100034148 | |||
| 689 | Ga0070679_100106812 | |||
| 690 | Ga0070679_100246067 | |||
| 691 | Ga0070684_100004192 | |||
| 692 | Ga0070684_100010409 | |||
| 693 | Ga0070684_100011064 | |||
| 694 | Ga0070684_100043478 | |||
| 695 | Ga0070684_100060557 | |||
| 696 | Ga0070684_100160196 | |||
| 697 | Ga0070684_100871339 | |||
| 698 | Ga0068853_100099206 | |||
| 699 | Ga0068853_100163763 | |||
| 700 | Ga0068853_100191299 | |||
| 701 | Ga0068853_100553157 | |||
| 702 | Ga0070672_100032699 | |||
| 703 | Ga0070672_100414187 | |||
| 704 | Ga0070686_100327655 | |||
| 705 | Ga0070695_100257032 | |||
| 706 | Ga0070696_100455731 | |||
| 707 | Ga0070693_100002286 | |||
| 708 | Ga0070693_100206099 | |||
| 709 | Ga0070665_100218629 | |||
| 710 | Ga0068855_100058123 | |||
| 711 | Ga0068855_100064358 | |||
| 712 | Ga0068855_100231731 | |||
| 713 | Ga0070664_100007779 | |||
| 714 | Ga0070664_100020896 | |||
| 715 | Ga0070664_100074493 | |||
| 716 | Ga0070664_100697343 | |||
| 717 | Ga0068857_100003542 | |||
| 718 | Ga0068857_100035803 | |||
| 719 | Ga0068857_100053694 | |||
| 720 | Ga0068857_100886427 | |||
| 721 | Ga0068854_100709070 | |||
| 722 | Ga0068856_100002052 | |||
| 723 | Ga0068856_100075475 | |||
| 724 | Ga0068856_100085819 | |||
| 725 | Ga0068856_100387074 | |||
| 726 | Ga0068856_100790194 | |||
| 727 | Ga0070702_100007650 | |||
| 728 | Ga0068852_100013616 | |||
| 729 | Ga0068852_100029191 | |||
| 730 | Ga0068852_100035127 | |||
| 731 | Ga0068859_100010712 | |||
| 732 | Ga0068859_100515468 | |||
| 733 | Ga0068864_100018061 | |||
| 734 | Ga0068864_100073878 | |||
| 735 | Ga0068861_100070213 | |||
| 736 | Ga0068870_10004146 | |||
| 737 | Ga0068870_10171592 | |||
| 738 | Ga0068863_100017061 | |||
| 739 | Ga0068863_100496964 | |||
| 740 | Ga0068858_100237734 | |||
| 741 | Ga0068858_100328232 | |||
| 742 | Ga0068858_100383312 | |||
| 743 | Ga0068858_101034541 | |||
| 744 | Ga0068860_100024437 | |||
| 745 | Ga0070712_100332847 | |||
| 746 | Ga0070712_100537996 | |||
| 747 | Ga0097621_100331576 | |||
| 748 | Ga0068871_100003795 | |||
| 749 | Ga0068871_100107656 | |||
| 750 | Ga0075430_100472887 | |||
| 751 | Ga0075433_10635845 | |||
| 752 | Ga0075434_100056618 | |||
| 753 | Ga0075434_101555157 | |||
| 754 | Ga0068865_100083963 | |||
| 755 | Ga0068865_100405321 | |||
| 756 | Ga0097620_100010712 | |||
| 757 | Ga0097620_100515522 | |||
| 758 | Ga0105240_10014816 | |||
| 759 | Ga0105240_10983416 | |||
| 760 | Ga0111539_10153123 | |||
| 761 | Ga0105245_10037351 | |||
| 762 | Ga0105245_10057057 | |||
| 763 | Ga0105245_10133294 | |||
| 764 | Ga0105245_10158116 | |||
| 765 | Ga0105245_10846992 | |||
| 766 | Ga0105243_10146282 | |||
| 767 | Ga0105241_10018730 | |||
| 768 | Ga0105241_10162864 | |||
| 769 | Ga0105242_10057254 | |||
| 770 | Ga0105242_11213263 | |||
| 771 | Ga0105248_10003991 | |||
| 772 | Ga0105248_10041515 | |||
| 773 | Ga0105248_10056911 | |||
| 774 | Ga0105248_10075620 | |||
| 775 | Ga0105248_10617573 | |||
| 776 | Ga0105237_10290238 | |||
| 777 | Ga0105237_10445973 | |||
| 778 | Ga0105238_10069649 | |||
| 779 | Ga0105238_10202151 | |||
| 780 | Ga0105238_10370145 | |||
| 781 | Ga0105238_10591299 | |||
| 782 | Ga0105238_10750266 | |||
| 783 | Ga0105249_10123614 | |||
| 784 | Ga0105249_10964646 | |||
| 785 | Ga0105246_10002895 | |||
| 786 | Ga0105246_10753791 | |||
| 787 | Ga0157373_10070346 | |||
| 788 | Ga0157373_10145961 | |||
| 789 | Ga0157371_10018031 | |||
| 790 | Ga0157371_10043561 | |||
| 791 | Ga0157371_10442843 | |||
| 792 | Ga0157370_10002501 | |||
| 793 | Ga0157370_10064099 | |||
| 794 | Ga0157370_10280423 | |||
| 795 | Ga0157370_10347956 | |||
| 796 | Ga0157369_10026400 | |||
| 797 | Ga0157369_10035166 | |||
| 798 | Ga0157369_10066060 | |||
| 799 | Ga0157369_10142746 | |||
| 800 | Ga0157369_10440784 | |||
| 801 | Ga0157378_10160316 | |||
| 802 | Ga0157378_10368574 | |||
| 803 | Ga0163162_10646108 | |||
| 804 | Ga0163162_10708635 | |||
| 805 | Ga0163162_11317024 | |||
| 806 | Ga0157372_10003954 | |||
| 807 | Ga0157372_10015579 | |||
| 808 | Ga0157372_10030696 | |||
| 809 | Ga0157372_10056402 | |||
| 810 | Ga0157372_10057204 | |||
| 811 | Ga0157372_10057643 | |||
| 812 | Ga0157372_10397829 | |||
| 813 | Ga0157375_10023505 | |||
| 814 | Ga0157375_10146712 | |||
| 815 | Ga0157375_10301276 | |||
| 816 | Ga0163163_10038263 | |||
| 817 | Ga0182008_10210209 | |||
| 818 | Ga0157377_10144013 | |||
| 819 | Ga0157377_10176282 | |||
| 820 | Ga0157376_10027890 | |||
| 821 | Ga0157376_10360032 | |||
| 822 | Ga0157376_10382716 | |||
| 823 | Ga0206354_10647760 | |||
| 824 | Ga0207697_10160106 | |||
| 825 | Ga0207699_10010833 | |||
| 826 | Ga0207699_10546209 | |||
| 827 | Ga0207645_10026425 | |||
| 828 | Ga0207645_10037234 | |||
| 829 | Ga0207643_10003284 | |||
| 830 | Ga0207705_10000670 | |||
| 831 | Ga0207705_10003061 | |||
| 832 | Ga0207705_10029615 | |||
| 833 | Ga0207705_10107337 | |||
| 834 | Ga0207705_10162224 | |||
| 835 | Ga0207654_10016668 | |||
| 836 | Ga0207707_10001106 | |||
| 837 | Ga0207707_10003856 | |||
| 838 | Ga0207707_10057319 | |||
| 839 | Ga0207707_10116545 | |||
| 840 | Ga0207695_10022378 | |||
| 841 | Ga0207660_10000141 | |||
| 842 | Ga0207660_10024045 | |||
| 843 | Ga0207660_10091039 | |||
| 844 | Ga0207660_10092703 | |||
| 845 | Ga0207662_10004172 | |||
| 846 | Ga0207657_10001978 | |||
| 847 | Ga0207657_10014269 | |||
| 848 | Ga0207657_10066140 | |||
| 849 | Ga0207657_10079609 | |||
| 850 | Ga0207657_10214313 | |||
| 851 | Ga0207649_10047251 | |||
| 852 | Ga0207652_10001406 | |||
| 853 | Ga0207652_10009561 | |||
| 854 | Ga0207652_10012300 | |||
| 855 | Ga0207652_10024028 | |||
| 856 | Ga0207652_10068377 | |||
| 857 | Ga0207652_10122308 | |||
| 858 | Ga0207652_10310359 | |||
| 859 | Ga0207646_10074381 | |||
| 860 | Ga0207646_10684278 | |||
| 861 | Ga0207681_10010386 | |||
| 862 | Ga0207681_10076131 | |||
| 863 | Ga0207694_10026995 | |||
| 864 | Ga0207694_10174877 | |||
| 865 | Ga0207694_10484310 | |||
| 866 | Ga0207650_10100804 | |||
| 867 | Ga0207650_10233166 | |||
| 868 | Ga0207650_10243648 | |||
| 869 | Ga0207650_10263452 | |||
| 870 | Ga0207650_10598746 | |||
| 871 | Ga0207659_10003174 | |||
| 872 | Ga0207659_10116031 | |||
| 873 | Ga0207687_10045136 | |||
| 874 | Ga0207687_10269335 | |||
| 875 | Ga0207700_10049339 | |||
| 876 | Ga0207700_10055995 | |||
| 877 | Ga0207664_10004807 | |||
| 878 | Ga0207664_10434326 | |||
| 879 | Ga0207644_10297722 | |||
| 880 | Ga0207644_10344069 | |||
| 881 | Ga0207690_10021775 | |||
| 882 | Ga0207690_10070373 | |||
| 883 | Ga0207690_10230909 | |||
| 884 | Ga0207706_10002611 | |||
| 885 | Ga0207706_10175519 | |||
| 886 | Ga0207706_10334280 | |||
| 887 | Ga0207686_10065371 | |||
| 888 | Ga0207686_10243657 | |||
| 889 | Ga0207686_10759399 | |||
| 890 | Ga0207670_10399770 | |||
| 891 | Ga0207670_10549657 | |||
| 892 | Ga0207669_10776938 | |||
| 893 | Ga0207665_10201783 | |||
| 894 | Ga0207691_10033076 | |||
| 895 | Ga0207691_10139252 | |||
| 896 | Ga0207691_10297040 | |||
| 897 | Ga0207711_10037887 | |||
| 898 | Ga0207711_10367035 | |||
| 899 | Ga0207711_10950633 | |||
| 900 | Ga0207689_10046742 | |||
| 901 | Ga0207689_10078904 | |||
| 902 | Ga0207689_10179325 | |||
| 903 | Ga0207661_10000363 | |||
| 904 | Ga0207661_10009404 | |||
| 905 | Ga0207661_10011500 | |||
| 906 | Ga0207661_10055418 | |||
| 907 | Ga0207661_10069587 | |||
| 908 | Ga0207661_10121915 | |||
| 909 | Ga0207661_10243295 | |||
| 910 | Ga0207661_10264018 | |||
| 911 | Ga0207661_10466546 | |||
| 912 | Ga0207679_10002053 | |||
| 913 | Ga0207679_10031263 | |||
| 914 | Ga0207679_10214573 | |||
| 915 | Ga0207679_10526131 | |||
| 916 | Ga0207667_10128851 | |||
| 917 | Ga0207667_10295896 | |||
| 918 | Ga0207667_10413757 | |||
| 919 | Ga0207667_10455900 | |||
| 920 | Ga0207667_10517844 | |||
| 921 | Ga0207651_10127919 | |||
| 922 | Ga0207651_10179013 | |||
| 923 | Ga0207651_10437555 | |||
| 924 | Ga0207651_10754526 | |||
| 925 | Ga0207712_10098017 | |||
| 926 | Ga0207712_10773135 | |||
| 927 | Ga0207668_10213681 | |||
| 928 | Ga0207658_10186533 | |||
| 929 | Ga0207677_10208724 | |||
| 930 | Ga0207703_10083256 | |||
| 931 | Ga0207703_10321624 | |||
| 932 | Ga0207703_10677563 | |||
| 933 | Ga0207639_10092636 | |||
| 934 | Ga0207639_10131053 | |||
| 935 | Ga0207678_10148938 | |||
| 936 | Ga0207702_10214837 | |||
| 937 | Ga0207702_10347560 | |||
| 938 | Ga0207641_10058029 | |||
| 939 | Ga0207648_10227626 | |||
| 940 | Ga0207676_10005668 | |||
| 941 | Ga0207676_10075853 | |||
| 942 | Ga0207674_10001269 | |||
| 943 | Ga0207674_10004648 | |||
| 944 | Ga0207674_10015375 | |||
| 945 | Ga0207674_10260130 | |||
| 946 | Ga0207683_10235384 | |||
| 947 | Ga0207683_10364516 | |||
| 948 | Ga0207698_10026244 | |||
| 949 | Ga0207698_10080161 | |||
| 950 | Ga0207698_10185422 | |||
| 951 | Ga0207698_10904514 | |||
| 952 | Ga0209982_1025024 | |||
| 953 | Ga0209966_1001178 | |||
| 954 | Ga0209998_10000445 | |||
| 955 | Ga0209974_10033586 | |||
| 956 | Ga0207428_10407230 | |||
| 957 | Ga0268266_10109357 | |||
| 958 | Ga0268266_11212091 | |||
| 959 | Ga0268264_10118540 | |||
| 960 | Ga0307408_100250034 | |||
| 961 | Ga0307408_100285533 | |||
| 962 | Ga0307408_100315215 | |||
| 963 | Ga0307405_10039542 | |||
| 964 | Ga0307405_10287733 | |||
| 965 | Ga0307413_10004673 | |||
| 966 | Ga0307413_10034144 | |||
| 967 | Ga0307410_10012151 | |||
| 968 | Ga0307410_10027806 | |||
| 969 | Ga0307410_10056447 | |||
| 970 | Ga0307410_10067196 | |||
| 971 | Ga0307410_10069327 | |||
| 972 | Ga0307406_10049068 | |||
| 973 | Ga0307406_10071041 | |||
| 974 | Ga0307406_10417025 | |||
| 975 | Ga0307406_10509109 | |||
| 976 | Ga0307406_10576842 | |||
| 977 | Ga0307407_10003358 | |||
| 978 | Ga0307407_10042641 | |||
| 979 | Ga0307407_10045875 | |||
| 980 | Ga0307412_10377704 | |||
| 981 | Ga0307409_100002889 | |||
| 982 | Ga0307409_100430199 | |||
| 983 | Ga0307409_100635413 | |||
| 984 | Ga0307416_100067311 | |||
| 985 | Ga0307416_100103317 | |||
| 986 | Ga0307416_100217752 | |||
| 987 | Ga0307416_100243898 | |||
| 988 | Ga0307416_100406711 | |||
| 989 | Ga0307414_10008574 | |||
| 990 | Ga0307414_10425122 | |||
| 991 | Ga0307414_10975360 | |||
| 992 | Ga0307411_10047928 | |||
| 993 | Ga0307411_10420123 | |||
| 994 | Ga0307411_10421441 | |||
| 995 | Ga0307415_100001175 | |||
| 996 | Ga0307415_100023181 | |||
| 997 | Ga0307415_100190068 | |||
| 998 | Ga0307415_100506111 | |||
| 999 | Ga0307415_100803909 | |||
| 1000 | Ga0373959_0065946 | |||
| 1001 | Ga0373934_0009977 | |||
| 1002 | Ga0373923_0234400 | |||
| 1003 | Ga0373954_0062432 | |||
| 1004 | Ga0373954_0094415 | |||
| 1005 | Ga0373956_0025215 | |||
| 1006 | Ga0373956_0053574 | |||
| 1007 | Ga0373957_0023425 | |||
| 1008 | Ga0373955_0014043 | |||
| 1009 | Ga0373924_0013275 | |||
| 1010 | Ga0373931_0078409 | |||
| 1011 | Ga0373935_0740048 | |||
| 1012 | Ga0373927_0106175 | |||
| 1013 | Ga0373933_0004877 | |||
| 1014 | Ga0373947_0025409 | |||
| 1015 | Ga0373937_0006852 | |||
| 1016 | Ga0373925_0047067 | |||
| 1017 | Ga0373925_0632393 | |||
| 1018 | Ga0451576_0217028 | |||
| 1019 | Ga0451576_0446543 | |||
| 1020 | Ga0466967_0056584 | |||
| 1021 | Ga0466967_0418036 | |||
| 1022 | Ga0466967_1028494 | |||
| 1023 | Ga0495629_0010765 | |||
| 1024 | Ga0495629_0218800 | |||
| 1025 | Ga0495651_0096749 | |||
| 1026 | Ga0495651_0098975 | |||
| 1027 | Ga0495653_0036083 | |||
| 1028 | Ga0495580_0003742 | |||
| 1029 | Ga0495582_0210287 | |||
| 1030 | Ga0495582_0304000 | |||
| 1031 | Ga0495582_0489843 | |||
| 1032 | Ga0495639_0005908 | |||
| 1033 | Ga0495639_0337229 | |||
| 1034 | Ga0495664_0067967 | |||
| 1035 | Ga0495594_0003626 | |||
| 1036 | Ga0495594_0003972 | |||
| 1037 | Ga0495594_0011231 | |||
| 1038 | Ga0495594_0015462 | |||
| 1039 | Ga0495594_0486002 | |||
| 1040 | Ga0495608_0221634 | |||
| 1041 | Ga0495618_0124253 | |||
| 1042 | Ga0495628_0048377 | |||
| 1043 | Ga0495630_0029394 | |||
| 1044 | Ga0495630_0033414 | |||
| 1045 | Ga0495666_0278923 | |||
| 1046 | Ga0495652_0000395 | |||
| 1047 | Ga0495652_0004855 | |||
| 1048 | Ga0495652_0117860 | |||
| 1049 | Ga0495665_0016781 | |||
| 1050 | Ga0495640_0404523 | |||
| 1051 | Ga0495586_0016003 | |||
| 1052 | Ga0495586_0021164 | |||
| 1053 | Ga0495586_0036607 | |||
| 1054 | Ga0495586_0088111 | |||
| 1055 | Ga0495587_0001882 | |||
| 1056 | Ga0495587_0004959 | |||
| 1057 | Ga0495621_0005014 | |||
| 1058 | Ga0495645_0000230 | |||
| 1059 | Ga0495645_0124298 | |||
| 1060 | Ga0495645_0317214 | |||
| 1061 | Ga0495622_0283584 | |||
| 1062 | Ga0495667_0000423 | |||
| 1063 | Ga0495667_0064624 | |||
| 1064 | Ga0495634_0159451 | |||
| 1065 | Ga0495659_0138083 | |||
| 1066 | Ga0495657_0131345 | |||
| 1067 | Ga0495657_0231182 | |||
| 1068 | Ga0495599_0027392 | |||
| 1069 | Ga0495599_0071073 | |||
| 1070 | Ga0495623_0031564 | |||
| 1071 | Ga0495623_0041644 | |||
| 1072 | Ga0495623_0177332 | |||
| 1073 | Ga0495646_0329697 | |||
| 1074 | Ga0495658_0174988 | |||
| 1075 | Ga0495613_0014494 | |||
| 1076 | Ga0495613_0052140 | |||
| 1077 | Ga0495613_0163162 | |||
| 1078 | Ga0495600_0032981 | |||
| 1079 | Ga0495600_0098639 | |||
| 1080 | Ga0495581_0010067 | |||
| 1081 | Ga0495581_0062683 | |||
| 1082 | Ga0495581_0140023 | |||
| 1083 | Ga0495581_0154915 | |||
| 1084 | Ga0495581_0205323 | |||
| 1085 | Ga0495604_0125553 | |||
| 1086 | Ga0495674_0158302 | |||
| 1087 | Ga0495674_0250743 | |||
| 1088 | Ga0495672_0243283 | |||
| 1089 | Ga0495680_0107664 | |||
| 1090 | Ga0495675_0002427 | |||
| 1091 | Ga0495675_0015531 | |||
| 1092 | Ga0495675_0102297 | |||
| 1093 | Ga0495675_0142402 | |||
| 1094 | Ga0495685_017974 | |||
| 1095 | Ga0495614_0174847 | |||
| 1096 | Ga0496104_0418714 | |||
| 1097 | Ga0496106_0044929 | |||
| 1098 | Ga0496107_0195061 | |||
| 1099 | Ga0496108_0106084 | |||
| 1100 | Ga0496108_0561925 | |||
| 1101 | Ga0496109_0064903 | |||
| 1102 | Ga0496111_0130039 | |||
| 1103 | Ga0496112_0001127 | |||
| 1104 | Ga0496112_0038641 | |||
| 1105 | Ga0496113_0008540 | |||
| 1106 | Ga0496115_0217035 | |||
| 1107 | Ga0496115_0455413 | |||
| 1108 | Ga0501032_0127294 | |||
| 1109 | Ga0501033_0006687 | |||
| 1110 | Ga0501033_0209939 | |||
| 1111 | Ga0501034_0003244 | |||
| 1112 | Ga0501034_0112273 | |||
| 1113 | Ga0501034_0120042 | |||
| 1114 | Ga0501036_0049773 | |||
| 1115 | Ga0501036_0056181 | |||
| 1116 | Ga0501036_0307645 | |||
| 1117 | Ga0501037_0039227 | |||
| 1118 | Ga0501043_0061083 | |||
| 1119 | Ga0501047_0080294 | |||
| 1120 | Ga0501047_0148542 | |||
| 1121 | Ga0501047_0386117 | |||
| 1122 | Ga0501047_0778221 | |||
| 1123 | Ga0501067_0000044 | |||
| 1124 | Ga0501067_0031156 | |||
| 1125 | Ga0501067_0073649 | |||
| 1126 | Ga0501068_0000908 | |||
| 1127 | Ga0501068_0036056 | |||
| 1128 | Ga0501069_0001029 | |||
| 1129 | Ga0501069_0012765 | |||
| 1130 | Ga0501069_0015388 | |||
| 1131 | Ga0501070_0001048 | |||
| 1132 | Ga0501070_0010508 | |||
| 1133 | Ga0501071_0000794 | |||
| 1134 | Ga0501071_0001269 | |||
| 1135 | Ga0501071_0318447 | |||
| 1136 | Ga0501072_0001312 | |||
| 1137 | Ga0501072_0040141 | |||
| 1138 | Ga0501073_0000776 | |||
| 1139 | Ga0501073_0015360 | |||
| 1140 | Ga0501073_0017380 | |||
| 1141 | Ga0501073_0322274 | |||
| 1142 | Ga0501074_0033216 | |||
| 1143 | Ga0501076_0085465 | |||
| 1144 | Ga0501198_019348 | |||
| 1145 | Ga0501199_012007 | |||
| 1146 | Ga0501202_001630 | |||
| 1147 | Ga0501223_020878 | |||
| 1148 | Ga0501233_061105 | |||
| 1149 | Ga0501251_028469 | |||
| 1150 | Ga0501259_006622 | |||
| 1151 | Ga0501225_0004283 | |||
| 1152 | Ga0501080_0001929 | |||
| 1153 | Ga0501080_0005995 | |||
| 1154 | Ga0501080_0057725 | |||
| 1155 | Ga0501080_0263802 | |||
| 1156 | Ga0501081_0160823 | |||
| 1157 | Ga0501081_0983413 | |||
| 1158 | Ga0501083_0017086 | |||
| 1159 | Ga0501083_0074830 | |||
| 1160 | Ga0501035_0118663 | |||
| 1161 | Ga0501035_0394679 | |||
| 1162 | nmdc:mga08y16_187646_c1 | |||
| 1163 | nmdc:mga08y16_268823_c1 | |||
| 1164 | nmdc:mga0n895_134783_c1 | |||
| 1165 | Ga0495601_0176325 | |||
| 1166 | Ga0495595_0071052 | |||
| 1167 | Ga0495595_0089136 | |||
| 1168 | Ga0495619_0109019 | |||
| 1169 | Ga0501084_0009557 | |||
| 1170 | Ga0501084_0137781 | |||
| 1171 | Ga0501082_0006301 | |||
| 1172 | Ga0501082_0021156 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hdt-assembly1.cif.gz_B | crystal structure of putative kinase from clostridium symbiosum atcc 14940 | 0.8696 | 3 | 200 |
| 3fdi-assembly1.cif.gz_A | crystal structure of uncharacterized protein from eubacterium ventriosum atcc 27560. | 0.8315 | 1 | 201 |
| 3fdi-assembly1.cif.gz_A | crystal structure of uncharacterized protein from eubacterium ventriosum atcc 27560. | 0.8268 | 1 | 201 |
| 3hdt-assembly1.cif.gz_B | crystal structure of putative kinase from clostridium symbiosum atcc 14940 | 0.8261 | 3 | 200 |
| 8flj-assembly1.cif.gz_E | cas1-cas2/3 integrase and ihf bound to crispr leader, repeat and foreign dna | 0.8135 | 132 | 168 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3hdtB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8541 | 3 | 200 | 3.40.50.300 |
| af_Q9VEJ7_13_73_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8383 | 131 | 164 | 1.10.10.10 |
| 1ihfA00 | Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins | 0.8274 | 132 | 168 | 4.10.520.10 |
| 3hdtB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8155 | 3 | 200 | 3.40.50.300 |
| 3fdiA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7871 | 1 | 201 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354I760-F1-model_v4 | Cytidylate kinase family protein | 0.8759 | 1 | 200 |
GO:0016020
|
| AF-A0A1Y3ZZ52-F1-model_v4 | Cytidylate kinase | 0.8661 | 3 | 200 |
|
| AF-A0A7V4MTX3-F1-model_v4 | Cytidylate kinase-like family protein | 0.8628 | 1 | 201 |
GO:0016301
|
| AF-A0A3C0TQM8-F1-model_v4 | BON domain-containing protein | 0.857 | 2 | 199 |
|
| AF-A0A842NQR4-F1-model_v4 | Cytidylate kinase family protein | 0.8553 | 1 | 198 |
GO:0016301
|