F466525

General Info

Members Datasets Scaffolds Average Seq Length
586 260 1172 209

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100000023|Ga0070708_10000002318
Length 218
Sequence MPVITISRMYGSGGSEVAERVAASLGWSLFDNAMIDAVAERSGLTVAEVSAQDERVPSMVERVAAALSLASPEMMPPVPSGPMETTEERIVAVTRRVIEEAIQIGPAVFVGRGAQCLLAERSDALHVFCFAPRSALRAYAMEKFNIGPAEAERCVADMNKQREQYVKRHWNRNWLAHENYHLCVNTAWLGLDGAAELVIEAARRQFAVAPHTWNKGTG

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
162 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
216 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
243 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
244 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
245 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
246 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
247 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
248 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
249 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.05
Rhizosphere 97.95
Stem 0
Stem Tuber 0
Unclassified 25.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100000023 3300005445 Bacteria 110968
2 JGI24738J21930_10043570 3300002075 Unclassified 912
3 Ga0065712_10083152 3300005290 Bacteria 2859
4 Ga0070658_10001374 3300005327 Bacteria 20809
5 Ga0070658_10148761 3300005327 Bacteria 1959
6 Ga0070676_10166014 3300005328 Unclassified 1424
7 Ga0070676_10292758 3300005328 Unclassified 1101
8 Ga0070683_100000429 3300005329 Bacteria 29152
9 Ga0070683_100003445 3300005329 Bacteria 12846
10 Ga0070683_100008205 3300005329 Bacteria 8871
11 Ga0070683_100027152 3300005329 Bacteria 5161
12 Ga0070683_100059523 3300005329 Bacteria 3549
13 Ga0070683_100078322 3300005329 Unclassified 3092
14 Ga0070683_100170376 3300005329 Bacteria 2067
15 Ga0070683_100182205 3300005329 Bacteria 1994
16 Ga0070683_100187258 3300005329 Bacteria 1965
17 Ga0070683_100306917 3300005329 Unclassified 1510
18 Ga0070683_100397286 3300005329 Unclassified 1314
19 Ga0070683_100437845 3300005329 Archaea 1247
20 Ga0070683_100563767 3300005329 Bacteria 1089
21 Ga0070690_100048231 3300005330 Bacteria 2711
22 Ga0070690_100144603 3300005330 Bacteria 1617
23 Ga0070690_100233775 3300005330 Unclassified 1294
24 Ga0070670_100031126 3300005331 Bacteria 4595
25 Ga0070670_100280016 3300005331 Archaea 1456
26 Ga0070670_100327484 3300005331 Bacteria 1343
27 Ga0070670_100497461 3300005331 Bacteria 1084
28 Ga0070670_100734123 3300005331 Unclassified 889
29 Ga0068869_100014227 3300005334 Bacteria 5311
30 Ga0068869_100126430 3300005334 Bacteria 1961
31 Ga0068869_100429124 3300005334 Bacteria 1092
32 Ga0070666_10405867 3300005335 Unclassified 980
33 Ga0070680_100000021 3300005336 Bacteria 81631
34 Ga0070680_100002481 3300005336 Bacteria 13670
35 Ga0070680_100138951 3300005336 Unclassified 2036
36 Ga0070680_100259225 3300005336 Unclassified 1471
37 Ga0070682_100003661 3300005337 Bacteria 8527
38 Ga0068868_100077912 3300005338 Unclassified 2653
39 Ga0068868_100110655 3300005338 Bacteria 2231
40 Ga0068868_100263652 3300005338 Unclassified 1454
41 Ga0070660_100015055 3300005339 Bacteria 5579
42 Ga0070660_100020838 3300005339 Bacteria 4825
43 Ga0070660_100117296 3300005339 Bacteria 2123
44 Ga0070689_100019456 3300005340 Bacteria 5022
45 Ga0070689_100082044 3300005340 Unclassified 2532
46 Ga0070689_100114734 3300005340 Bacteria 2146
47 Ga0070689_100206983 3300005340 Archaea 1604
48 Ga0070689_100532651 3300005340 Bacteria 1010
49 Ga0070687_100078823 3300005343 Bacteria 1791
50 Ga0070661_100033311 3300005344 Unclassified 3731
51 Ga0070661_100179622 3300005344 Unclassified 1610
52 Ga0070692_10014075 3300005345 Bacteria 3747
53 Ga0070668_100246329 3300005347 Unclassified 1482
54 Ga0070668_100312771 3300005347 Bacteria 1320
55 Ga0070668_100774723 3300005347 Bacteria 851
56 Ga0070669_100006004 3300005353 Bacteria 8759
57 Ga0070675_100007972 3300005354 Bacteria 8208
58 Ga0070675_100027083 3300005354 Bacteria 4604
59 Ga0070671_100050773 3300005355 Bacteria 3450
60 Ga0070671_100236071 3300005355 Unclassified 1552
61 Ga0070674_100485943 3300005356 Bacteria 1026
62 Ga0070673_100010926 3300005364 Bacteria 6174
63 Ga0070673_100048759 3300005364 Unclassified 3304
64 Ga0070673_100104407 3300005364 Bacteria 2340
65 Ga0070673_100210718 3300005364 Bacteria 1678
66 Ga0070688_100014620 3300005365 Bacteria 4450
67 Ga0070688_100066799 3300005365 Unclassified 2289
68 Ga0070688_100276246 3300005365 Unclassified 1205
69 Ga0070688_100523990 3300005365 Unclassified 897
70 Ga0070659_100002317 3300005366 Bacteria 13560
71 Ga0070659_100003724 3300005366 Bacteria 10875
72 Ga0070659_100019956 3300005366 Bacteria 5088
73 Ga0070659_100055442 3300005366 Bacteria 3124
74 Ga0070667_100097704 3300005367 Bacteria 2533
75 Ga0070667_100323996 3300005367 Bacteria 1391
76 Ga0070667_100452331 3300005367 Bacteria 1174
77 Ga0070709_10022013 3300005434 Bacteria 3723
78 Ga0070709_10066972 3300005434 Bacteria 2305
79 Ga0070713_100047973 3300005436 Bacteria 3514
80 Ga0070713_100114307 3300005436 Bacteria 2358
81 Ga0070713_100786315 3300005436 Unclassified 912
82 Ga0070701_10167586 3300005438 Unclassified 1277
83 Ga0070711_100203548 3300005439 Bacteria 1529
84 Ga0070711_100518045 3300005439 Bacteria 985
85 Ga0070694_100149517 3300005444 Bacteria 1704
86 Ga0070663_100131694 3300005455 Unclassified 1900
87 Ga0070662_100019801 3300005457 Bacteria 4575
88 Ga0070662_100023868 3300005457 Bacteria 4207
89 Ga0070662_100151519 3300005457 Bacteria 1806
90 Ga0070681_10001650 3300005458 Bacteria 19913
91 Ga0070681_10005096 3300005458 Bacteria 12677
92 Ga0070681_10026752 3300005458 Bacteria 5800
93 Ga0070681_10384652 3300005458 Bacteria 1314
94 Ga0068867_100345797 3300005459 Bacteria 1240
95 Ga0068867_101150919 3300005459 Unclassified 710
96 Ga0070685_10098201 3300005466 Unclassified 1784
97 Ga0070685_10486678 3300005466 Bacteria 871
98 Ga0070679_100000866 3300005530 Bacteria 26295
99 Ga0070679_100015528 3300005530 Bacteria 7317
100 Ga0070679_100023172 3300005530 Bacteria 6076
101 Ga0070679_100033634 3300005530 Bacteria 5076
102 Ga0070679_100034148 3300005530 Bacteria 5040
103 Ga0070679_100106812 3300005530 Bacteria 2785
104 Ga0070679_100246067 3300005530 Bacteria 1745
105 Ga0070684_100004192 3300005535 Bacteria 10922
106 Ga0070684_100010409 3300005535 Bacteria 7368
107 Ga0070684_100011064 3300005535 Bacteria 7177
108 Ga0070684_100043478 3300005535 Unclassified 3880
109 Ga0070684_100060557 3300005535 Bacteria 3312
110 Ga0070684_100160196 3300005535 Bacteria 2041
111 Ga0070684_100871339 3300005535 Bacteria 843
112 Ga0068853_100099206 3300005539 Bacteria 2573
113 Ga0068853_100163763 3300005539 Bacteria 2008
114 Ga0068853_100191299 3300005539 Unclassified 1859
115 Ga0068853_100553157 3300005539 Bacteria 1090
116 Ga0070672_100032699 3300005543 Bacteria 3929
117 Ga0070672_100414187 3300005543 Unclassified 1157
118 Ga0070686_100327655 3300005544 Bacteria 1144
119 Ga0070695_100257032 3300005545 Bacteria 1274
120 Ga0070696_100455731 3300005546 Bacteria 1010
121 Ga0070693_100002286 3300005547 Bacteria 8782
122 Ga0070693_100206099 3300005547 Bacteria 1280
123 Ga0070665_100218629 3300005548 Bacteria 1906
124 Ga0068855_100058123 3300005563 Bacteria 4531
125 Ga0068855_100064358 3300005563 Bacteria 4277
126 Ga0068855_100231731 3300005563 Bacteria 2067
127 Ga0070664_100007779 3300005564 Bacteria 8655
128 Ga0070664_100020896 3300005564 Bacteria 5394
129 Ga0070664_100074493 3300005564 Bacteria 2914
130 Ga0070664_100697343 3300005564 Unclassified 946
131 Ga0068857_100003542 3300005577 Bacteria 13052
132 Ga0068857_100035803 3300005577 Bacteria 4397
133 Ga0068857_100053694 3300005577 Bacteria 3574
134 Ga0068857_100886427 3300005577 Unclassified 855
135 Ga0068854_100709070 3300005578 Bacteria 869
136 Ga0068856_100002052 3300005614 Bacteria 20880
137 Ga0068856_100075475 3300005614 Unclassified 3339
138 Ga0068856_100085819 3300005614 Bacteria 3128
139 Ga0068856_100387074 3300005614 Unclassified 1418
140 Ga0068856_100790194 3300005614 Unclassified 969
141 Ga0070702_100007650 3300005615 Bacteria 5181
142 Ga0068852_100013616 3300005616 Bacteria 6228
143 Ga0068852_100029191 3300005616 Bacteria 4527
144 Ga0068852_100035127 3300005616 Unclassified 4177
145 Ga0068859_100010712 3300005617 Bacteria 9229
146 Ga0068859_100515468 3300005617 Bacteria 1291
147 Ga0068864_100018061 3300005618 Bacteria 5887
148 Ga0068864_100073878 3300005618 Bacteria 2974
149 Ga0068861_100070213 3300005719 Bacteria 2712
150 Ga0068870_10004146 3300005840 Bacteria 6211
151 Ga0068870_10171592 3300005840 Bacteria 1295
152 Ga0068863_100017061 3300005841 Bacteria 6964
153 Ga0068863_100496964 3300005841 Bacteria 1201
154 Ga0068858_100237734 3300005842 Unclassified 1728
155 Ga0068858_100328232 3300005842 Unclassified 1463
156 Ga0068858_100383312 3300005842 Bacteria 1349
157 Ga0068858_101034541 3300005842 Unclassified 805
158 Ga0068860_100024437 3300005843 Bacteria 5838
159 Ga0070712_100332847 3300006175 Bacteria 1238
160 Ga0070712_100537996 3300006175 Bacteria 983
161 Ga0097621_100331576 3300006237 Bacteria 1350
162 Ga0068871_100003795 3300006358 Bacteria 10411
163 Ga0068871_100107656 3300006358 Unclassified 2342
164 Ga0075430_100472887 3300006846 Bacteria 1034
165 Ga0075433_10635845 3300006852 Bacteria 936
166 Ga0075434_100056618 3300006871 Bacteria 3897
167 Ga0075434_101555157 3300006871 Bacteria 670
168 Ga0068865_100083963 3300006881 Bacteria 2294
169 Ga0068865_100405321 3300006881 Unclassified 1118
170 Ga0097620_100010712 3300006931 Bacteria 9229
171 Ga0097620_100515522 3300006931 Bacteria 1291
172 Ga0105240_10014816 3300009093 Bacteria 10626
173 Ga0105240_10983416 3300009093 Bacteria 903
174 Ga0111539_10153123 3300009094 Bacteria 2699
175 Ga0105245_10037351 3300009098 Bacteria 4318
176 Ga0105245_10057057 3300009098 Bacteria 3511
177 Ga0105245_10133294 3300009098 Unclassified 2332
178 Ga0105245_10158116 3300009098 Bacteria 2148
179 Ga0105245_10846992 3300009098 Bacteria 954
180 Ga0105243_10146282 3300009148 Unclassified 2022
181 Ga0105241_10018730 3300009174 Bacteria 5099
182 Ga0105241_10162864 3300009174 Bacteria 1835
183 Ga0105242_10057254 3300009176 Bacteria 3191
184 Ga0105242_11213263 3300009176 Unclassified 774
185 Ga0105248_10003991 3300009177 Bacteria 16313
186 Ga0105248_10041515 3300009177 Bacteria 5157
187 Ga0105248_10056911 3300009177 Bacteria 4387
188 Ga0105248_10075620 3300009177 Bacteria 3785
189 Ga0105248_10617573 3300009177 Unclassified 1223
190 Ga0105237_10290238 3300009545 Bacteria 1638
191 Ga0105237_10445973 3300009545 Unclassified 1300
192 Ga0105238_10069649 3300009551 Bacteria 3518
193 Ga0105238_10202151 3300009551 Bacteria 1963
194 Ga0105238_10370145 3300009551 Unclassified 1423
195 Ga0105238_10591299 3300009551 Unclassified 1117
196 Ga0105238_10750266 3300009551 Bacteria 990
197 Ga0105249_10123614 3300009553 Unclassified 2462
198 Ga0105249_10964646 3300009553 Unclassified 921
199 Ga0105246_10002895 3300011119 Bacteria 10386
200 Ga0105246_10753791 3300011119 Bacteria 859
201 Ga0157373_10070346 3300013100 Bacteria 2473
202 Ga0157373_10145961 3300013100 Unclassified 1664
203 Ga0157371_10018031 3300013102 Bacteria 5228
204 Ga0157371_10043561 3300013102 Bacteria 3196
205 Ga0157371_10442843 3300013102 Unclassified 954
206 Ga0157370_10002501 3300013104 Bacteria 22161
207 Ga0157370_10064099 3300013104 Unclassified 3479
208 Ga0157370_10280423 3300013104 Bacteria 1540
209 Ga0157370_10347956 3300013104 Bacteria 1366
210 Ga0157369_10026400 3300013105 Bacteria 6442
211 Ga0157369_10035166 3300013105 Bacteria 5495
212 Ga0157369_10066060 3300013105 Bacteria 3892
213 Ga0157369_10142746 3300013105 Bacteria 2533
214 Ga0157369_10440784 3300013105 Unclassified 1349
215 Ga0157378_10160316 3300013297 Bacteria 2103
216 Ga0157378_10368574 3300013297 Bacteria 1407
217 Ga0163162_10646108 3300013306 Bacteria 1182
218 Ga0163162_10708635 3300013306 Unclassified 1128
219 Ga0163162_11317024 3300013306 Bacteria 821
220 Ga0157372_10003954 3300013307 Bacteria 15914
221 Ga0157372_10015579 3300013307 Bacteria 8150
222 Ga0157372_10030696 3300013307 Bacteria 5881
223 Ga0157372_10056402 3300013307 Bacteria 4389
224 Ga0157372_10057204 3300013307 Bacteria 4359
225 Ga0157372_10057643 3300013307 Bacteria 4342
226 Ga0157372_10397829 3300013307 Unclassified 1605
227 Ga0157375_10023505 3300013308 Bacteria 5689
228 Ga0157375_10146712 3300013308 Bacteria 2490
229 Ga0157375_10301276 3300013308 Bacteria 1766
230 Ga0163163_10038263 3300014325 Bacteria 4674
231 Ga0182008_10210209 3300014497 Archaea 993
232 Ga0157377_10144013 3300014745 Bacteria 1467
233 Ga0157377_10176282 3300014745 Bacteria 1341
234 Ga0157376_10027890 3300014969 Bacteria 4482
235 Ga0157376_10360032 3300014969 Bacteria 1395
236 Ga0157376_10382716 3300014969 Bacteria 1356
237 Ga0206354_10647760 3300020081 Bacteria 1317
238 Ga0207697_10160106 3300025315 Unclassified 982
239 Ga0207699_10010833 3300025906 Bacteria 4590
240 Ga0207699_10546209 3300025906 Unclassified 840
241 Ga0207645_10026425 3300025907 Bacteria 3752
242 Ga0207645_10037234 3300025907 Bacteria 3122
243 Ga0207643_10003284 3300025908 Bacteria 8732
244 Ga0207705_10000670 3300025909 Bacteria 28487
245 Ga0207705_10003061 3300025909 Bacteria 12752
246 Ga0207705_10029615 3300025909 Bacteria 3903
247 Ga0207705_10107337 3300025909 Bacteria 2060
248 Ga0207705_10162224 3300025909 Unclassified 1680
249 Ga0207654_10016668 3300025911 Bacteria 3829
250 Ga0207707_10001106 3300025912 Bacteria 25637
251 Ga0207707_10003856 3300025912 Bacteria 13291
252 Ga0207707_10057319 3300025912 Bacteria 3391
253 Ga0207707_10116545 3300025912 Bacteria 2334
254 Ga0207695_10022378 3300025913 Bacteria 7177
255 Ga0207660_10000141 3300025917 Bacteria 43491
256 Ga0207660_10024045 3300025917 Bacteria 4121
257 Ga0207660_10091039 3300025917 Unclassified 2261
258 Ga0207660_10092703 3300025917 Bacteria 2243
259 Ga0207662_10004172 3300025918 Bacteria 7569
260 Ga0207657_10001978 3300025919 Bacteria 22123
261 Ga0207657_10014269 3300025919 Bacteria 7767
262 Ga0207657_10066140 3300025919 Bacteria 3078
263 Ga0207657_10079609 3300025919 Bacteria 2757
264 Ga0207657_10214313 3300025919 Bacteria 1544
265 Ga0207649_10047251 3300025920 Unclassified 2648
266 Ga0207652_10001406 3300025921 Bacteria 21353
267 Ga0207652_10009561 3300025921 Bacteria 7798
268 Ga0207652_10012300 3300025921 Bacteria 6912
269 Ga0207652_10024028 3300025921 Bacteria 5056
270 Ga0207652_10068377 3300025921 Bacteria 3082
271 Ga0207652_10122308 3300025921 Bacteria 2316
272 Ga0207652_10310359 3300025921 Bacteria 1424
273 Ga0207646_10074381 3300025922 Bacteria 3035
274 Ga0207646_10684278 3300025922 Bacteria 918
275 Ga0207681_10010386 3300025923 Bacteria 5698
276 Ga0207681_10076131 3300025923 Bacteria 2356
277 Ga0207694_10026995 3300025924 Bacteria 4372
278 Ga0207694_10174877 3300025924 Bacteria 1740
279 Ga0207694_10484310 3300025924 Unclassified 1035
280 Ga0207650_10100804 3300025925 Unclassified 2222
281 Ga0207650_10233166 3300025925 Unclassified 1485
282 Ga0207650_10243648 3300025925 Bacteria 1453
283 Ga0207650_10263452 3300025925 Bacteria 1399
284 Ga0207650_10598746 3300025925 Archaea 927
285 Ga0207659_10003174 3300025926 Bacteria 9829
286 Ga0207659_10116031 3300025926 Unclassified 2043
287 Ga0207687_10045136 3300025927 Unclassified 3045
288 Ga0207687_10269335 3300025927 Bacteria 1361
289 Ga0207700_10049339 3300025928 Bacteria 3131
290 Ga0207700_10055995 3300025928 Bacteria 2966
291 Ga0207664_10004807 3300025929 Bacteria 9182
292 Ga0207664_10434326 3300025929 Unclassified 1171
293 Ga0207644_10297722 3300025931 Unclassified 1299
294 Ga0207644_10344069 3300025931 Unclassified 1210
295 Ga0207690_10021775 3300025932 Bacteria 3979
296 Ga0207690_10070373 3300025932 Bacteria 2410
297 Ga0207690_10230909 3300025932 Unclassified 1420
298 Ga0207706_10002611 3300025933 Bacteria 17546
299 Ga0207706_10175519 3300025933 Bacteria 1882
300 Ga0207706_10334280 3300025933 Unclassified 1318
301 Ga0207686_10065371 3300025934 Unclassified 2319
302 Ga0207686_10243657 3300025934 Unclassified 1310
303 Ga0207686_10759399 3300025934 Unclassified 775
304 Ga0207670_10399770 3300025936 Unclassified 1098
305 Ga0207670_10549657 3300025936 Bacteria 943
306 Ga0207669_10776938 3300025937 Bacteria 793
307 Ga0207665_10201783 3300025939 Bacteria 1449
308 Ga0207691_10033076 3300025940 Bacteria 4817
309 Ga0207691_10139252 3300025940 Bacteria 2139
310 Ga0207691_10297040 3300025940 Bacteria 1388
311 Ga0207711_10037887 3300025941 Unclassified 4098
312 Ga0207711_10367035 3300025941 Unclassified 1335
313 Ga0207711_10950633 3300025941 Unclassified 798
314 Ga0207689_10046742 3300025942 Unclassified 3576
315 Ga0207689_10078904 3300025942 Bacteria 2706
316 Ga0207689_10179325 3300025942 Bacteria 1747
317 Ga0207661_10000363 3300025944 Bacteria 29142
318 Ga0207661_10009404 3300025944 Bacteria 7008
319 Ga0207661_10011500 3300025944 Bacteria 6415
320 Ga0207661_10055418 3300025944 Bacteria 3180
321 Ga0207661_10069587 3300025944 Bacteria 2870
322 Ga0207661_10121915 3300025944 Unclassified 2220
323 Ga0207661_10243295 3300025944 Bacteria 1597
324 Ga0207661_10264018 3300025944 Unclassified 1534
325 Ga0207661_10466546 3300025944 Bacteria 1151
326 Ga0207679_10002053 3300025945 Bacteria 12503
327 Ga0207679_10031263 3300025945 Bacteria 3725
328 Ga0207679_10214573 3300025945 Bacteria 1616
329 Ga0207679_10526131 3300025945 Bacteria 1058
330 Ga0207667_10128851 3300025949 Bacteria 2606
331 Ga0207667_10295896 3300025949 Unclassified 1654
332 Ga0207667_10413757 3300025949 Bacteria 1372
333 Ga0207667_10455900 3300025949 Unclassified 1299
334 Ga0207667_10517844 3300025949 Unclassified 1208
335 Ga0207651_10127919 3300025960 Unclassified 1939
336 Ga0207651_10179013 3300025960 Bacteria 1680
337 Ga0207651_10437555 3300025960 Unclassified 1119
338 Ga0207651_10754526 3300025960 Bacteria 860
339 Ga0207712_10098017 3300025961 Bacteria 2173
340 Ga0207712_10773135 3300025961 Unclassified 843
341 Ga0207668_10213681 3300025972 Unclassified 1544
342 Ga0207658_10186533 3300025986 Bacteria 1721
343 Ga0207677_10208724 3300026023 Unclassified 1558
344 Ga0207703_10083256 3300026035 Bacteria 2672
345 Ga0207703_10321624 3300026035 Bacteria 1417
346 Ga0207703_10677563 3300026035 Bacteria 980
347 Ga0207639_10092636 3300026041 Bacteria 2422
348 Ga0207639_10131053 3300026041 Bacteria 2075
349 Ga0207678_10148938 3300026067 Bacteria 1998
350 Ga0207702_10214837 3300026078 Bacteria 1789
351 Ga0207702_10347560 3300026078 Unclassified 1418
352 Ga0207641_10058029 3300026088 Unclassified 3293
353 Ga0207648_10227626 3300026089 Unclassified 1658
354 Ga0207676_10005668 3300026095 Bacteria 8841
355 Ga0207676_10075853 3300026095 Bacteria 2714
356 Ga0207674_10001269 3300026116 Bacteria 32986
357 Ga0207674_10004648 3300026116 Bacteria 16486
358 Ga0207674_10015375 3300026116 Bacteria 8408
359 Ga0207674_10260130 3300026116 Bacteria 1683
360 Ga0207683_10235384 3300026121 Bacteria 1670
361 Ga0207683_10364516 3300026121 Unclassified 1327
362 Ga0207698_10026244 3300026142 Unclassified 4119
363 Ga0207698_10080161 3300026142 Unclassified 2629
364 Ga0207698_10185422 3300026142 Unclassified 1848
365 Ga0207698_10904514 3300026142 Unclassified 890
366 Ga0209982_1025024 3300027552 Unclassified 927
367 Ga0209966_1001178 3300027695 Bacteria 4667
368 Ga0209998_10000445 3300027717 Bacteria 11485
369 Ga0209974_10033586 3300027876 Bacteria 1703
370 Ga0207428_10407230 3300027907 Bacteria 995
371 Ga0268266_10109357 3300028379 Bacteria 2448
372 Ga0268266_11212091 3300028379 Bacteria 730
373 Ga0268264_10118540 3300028381 Unclassified 2329
374 Ga0307408_100250034 3300031548 Unclassified 1462
375 Ga0307408_100285533 3300031548 Bacteria 1376
376 Ga0307408_100315215 3300031548 Bacteria 1316
377 Ga0307405_10039542 3300031731 Bacteria 2851
378 Ga0307405_10287733 3300031731 Unclassified 1240
379 Ga0307413_10004673 3300031824 Bacteria 6000
380 Ga0307413_10034144 3300031824 Bacteria 2904
381 Ga0307410_10012151 3300031852 Bacteria 4962
382 Ga0307410_10027806 3300031852 Bacteria 3577
383 Ga0307410_10056447 3300031852 Unclassified 2670
384 Ga0307410_10067196 3300031852 Bacteria 2472
385 Ga0307410_10069327 3300031852 Bacteria 2439
386 Ga0307406_10049068 3300031901 Bacteria 2670
387 Ga0307406_10071041 3300031901 Bacteria 2281
388 Ga0307406_10417025 3300031901 Unclassified 1068
389 Ga0307406_10509109 3300031901 Bacteria 977
390 Ga0307406_10576842 3300031901 Unclassified 924
391 Ga0307407_10003358 3300031903 Bacteria 6547
392 Ga0307407_10042641 3300031903 Bacteria 2545
393 Ga0307407_10045875 3300031903 Bacteria 2472
394 Ga0307412_10377704 3300031911 Unclassified 1146
395 Ga0307409_100002889 3300031995 Bacteria 9107
396 Ga0307409_100430199 3300031995 Bacteria 1268
397 Ga0307409_100635413 3300031995 Unclassified 1059
398 Ga0307416_100067311 3300032002 Bacteria 2953
399 Ga0307416_100103317 3300032002 Bacteria 2488
400 Ga0307416_100217752 3300032002 Bacteria 1828
401 Ga0307416_100243898 3300032002 Bacteria 1743
402 Ga0307416_100406711 3300032002 Bacteria 1400
403 Ga0307414_10008574 3300032004 Bacteria 5809
404 Ga0307414_10425122 3300032004 Unclassified 1159
405 Ga0307414_10975360 3300032004 Bacteria 779
406 Ga0307411_10047928 3300032005 Bacteria 2765
407 Ga0307411_10420123 3300032005 Unclassified 1110
408 Ga0307411_10421441 3300032005 Bacteria 1109
409 Ga0307415_100001175 3300032126 Bacteria 12238
410 Ga0307415_100023181 3300032126 Bacteria 3848
411 Ga0307415_100190068 3300032126 Unclassified 1619
412 Ga0307415_100506111 3300032126 Bacteria 1057
413 Ga0307415_100803909 3300032126 Unclassified 859
414 Ga0373959_0065946 3300034820 Bacteria 810
415 Ga0373934_0009977 3300035086 Bacteria 3563
416 Ga0373923_0234400 3300035111 Unclassified 856
417 Ga0373954_0062432 3300035118 Bacteria 1760
418 Ga0373954_0094415 3300035118 Unclassified 1439
419 Ga0373956_0025215 3300035119 Bacteria 2568
420 Ga0373956_0053574 3300035119 Unclassified 1816
421 Ga0373957_0023425 3300035120 Bacteria 2208
422 Ga0373955_0014043 3300035172 Bacteria 3888
423 Ga0373924_0013275 3300035410 Bacteria 3093
424 Ga0373931_0078409 3300035691 Bacteria 1817
425 Ga0373935_0740048 3300035692 Bacteria 724
426 Ga0373927_0106175 3300035695 Bacteria 1828
427 Ga0373933_0004877 3300035724 Bacteria 7322
428 Ga0373947_0025409 3300035725 Bacteria 3455
429 Ga0373937_0006852 3300036401 Bacteria 9832
430 Ga0373925_0047067 3300037068 Bacteria 3209
431 Ga0373925_0632393 3300037068 Unclassified 882
432 Ga0451576_0217028 3300045051 Bacteria 1997
433 Ga0451576_0446543 3300045051 Bacteria 1357
434 Ga0466967_0056584 3300045976 Bacteria 3459
435 Ga0466967_0418036 3300045976 Bacteria 1306
436 Ga0466967_1028494 3300045976 Unclassified 820
437 Ga0495629_0010765 3300046459 Bacteria 6653
438 Ga0495629_0218800 3300046459 Unclassified 1314
439 Ga0495651_0096749 3300046462 Unclassified 2205
440 Ga0495651_0098975 3300046462 Bacteria 2175
441 Ga0495653_0036083 3300046463 Bacteria 3897
442 Ga0495580_0003742 3300046472 Bacteria 12880
443 Ga0495582_0210287 3300046473 Bacteria 1112
444 Ga0495582_0304000 3300046473 Unclassified 917
445 Ga0495582_0489843 3300046473 Unclassified 711
446 Ga0495639_0005908 3300046475 Bacteria 5266
447 Ga0495639_0337229 3300046475 Unclassified 756
448 Ga0495664_0067967 3300046477 Bacteria 2126
449 Ga0495594_0003626 3300046499 Bacteria 7941
450 Ga0495594_0003972 3300046499 Bacteria 7607
451 Ga0495594_0011231 3300046499 Bacteria 4652
452 Ga0495594_0015462 3300046499 Bacteria 4009
453 Ga0495594_0486002 3300046499 Unclassified 702
454 Ga0495608_0221634 3300046511 Unclassified 1186
455 Ga0495618_0124253 3300046514 Unclassified 1652
456 Ga0495628_0048377 3300046516 Bacteria 3371
457 Ga0495630_0029394 3300046517 Bacteria 4087
458 Ga0495630_0033414 3300046517 Bacteria 3837
459 Ga0495666_0278923 3300046526 Unclassified 758
460 Ga0495652_0000395 3300046529 Bacteria 51356
461 Ga0495652_0004855 3300046529 Bacteria 12770
462 Ga0495652_0117860 3300046529 Bacteria 2123
463 Ga0495665_0016781 3300046531 Unclassified 3942
464 Ga0495640_0404523 3300046533 Bacteria 838
465 Ga0495586_0016003 3300046535 Bacteria 3990
466 Ga0495586_0021164 3300046535 Bacteria 3465
467 Ga0495586_0036607 3300046535 Unclassified 2635
468 Ga0495586_0088111 3300046535 Bacteria 1712
469 Ga0495587_0001882 3300046536 Bacteria 13958
470 Ga0495587_0004959 3300046536 Bacteria 8723
471 Ga0495621_0005014 3300046539 Bacteria 3775
472 Ga0495645_0000230 3300046543 Bacteria 40449
473 Ga0495645_0124298 3300046543 Unclassified 1814
474 Ga0495645_0317214 3300046543 Bacteria 1013
475 Ga0495622_0283584 3300046557 Unclassified 724
476 Ga0495667_0000423 3300046559 Bacteria 27174
477 Ga0495667_0064624 3300046559 Unclassified 2393
478 Ga0495634_0159451 3300046642 Unclassified 1423
479 Ga0495659_0138083 3300046664 Unclassified 971
480 Ga0495657_0131345 3300046675 Bacteria 1568
481 Ga0495657_0231182 3300046675 Archaea 1118
482 Ga0495599_0027392 3300046678 Bacteria 3572
483 Ga0495599_0071073 3300046678 Bacteria 2172
484 Ga0495623_0031564 3300046679 Bacteria 3405
485 Ga0495623_0041644 3300046679 Bacteria 2928
486 Ga0495623_0177332 3300046679 Bacteria 1241
487 Ga0495646_0329697 3300046680 Unclassified 802
488 Ga0495658_0174988 3300046683 Bacteria 1330
489 Ga0495613_0014494 3300046689 Bacteria 5848
490 Ga0495613_0052140 3300046689 Bacteria 3014
491 Ga0495613_0163162 3300046689 Unclassified 1584
492 Ga0495600_0032981 3300046809 Bacteria 3361
493 Ga0495600_0098639 3300046809 Bacteria 1904
494 Ga0495581_0010067 3300047315 Bacteria 5468
495 Ga0495581_0062683 3300047315 Bacteria 2149
496 Ga0495581_0140023 3300047315 Bacteria 1411
497 Ga0495581_0154915 3300047315 Unclassified 1339
498 Ga0495581_0205323 3300047315 Bacteria 1152
499 Ga0495604_0125553 3300047317 Unclassified 1851
500 Ga0495674_0158302 3300047319 Bacteria 1896
501 Ga0495674_0250743 3300047319 Unclassified 1457
502 Ga0495672_0243283 3300047320 Bacteria 877
503 Ga0495680_0107664 3300047322 Bacteria 2070
504 Ga0495675_0002427 3300047444 Bacteria 11139
505 Ga0495675_0015531 3300047444 Bacteria 4815
506 Ga0495675_0102297 3300047444 Unclassified 1792
507 Ga0495675_0142402 3300047444 Unclassified 1485
508 Ga0495685_017974 3300047447 Unclassified 2423
509 Ga0495614_0174847 3300048089 Unclassified 964
510 Ga0496104_0418714 3300048907 Unclassified 1252
511 Ga0496106_0044929 3300048909 Bacteria 3317
512 Ga0496107_0195061 3300048910 Bacteria 1505
513 Ga0496108_0106084 3300048911 Bacteria 2399
514 Ga0496108_0561925 3300048911 Unclassified 995
515 Ga0496109_0064903 3300048912 Bacteria 3342
516 Ga0496111_0130039 3300048914 Bacteria 1863
517 Ga0496112_0001127 3300048915 Bacteria 19878
518 Ga0496112_0038641 3300048915 Bacteria 4661
519 Ga0496113_0008540 3300048916 Bacteria 6680
520 Ga0496115_0217035 3300048918 Bacteria 1579
521 Ga0496115_0455413 3300048918 Archaea 1033
522 Ga0501032_0127294 3300049569 Bacteria 1682
523 Ga0501033_0006687 3300049570 Bacteria 9009
524 Ga0501033_0209939 3300049570 Bacteria 1389
525 Ga0501034_0003244 3300049571 Bacteria 18603
526 Ga0501034_0112273 3300049571 Bacteria 2716
527 Ga0501034_0120042 3300049571 Bacteria 2615
528 Ga0501036_0049773 3300049572 Bacteria 3549
529 Ga0501036_0056181 3300049572 Bacteria 3335
530 Ga0501036_0307645 3300049572 Bacteria 1325
531 Ga0501037_0039227 3300049573 Bacteria 3488
532 Ga0501043_0061083 3300049579 Bacteria 2960
533 Ga0501047_0080294 3300049581 Bacteria 3135
534 Ga0501047_0148542 3300049581 Bacteria 2220
535 Ga0501047_0386117 3300049581 Bacteria 1234
536 Ga0501047_0778221 3300049581 Bacteria 772
537 Ga0501067_0000044 3300049583 Bacteria 74423
538 Ga0501067_0031156 3300049583 Bacteria 2959
539 Ga0501067_0073649 3300049583 Bacteria 1892
540 Ga0501068_0000908 3300049584 Bacteria 15488
541 Ga0501068_0036056 3300049584 Bacteria 2955
542 Ga0501069_0001029 3300049585 Bacteria 13327
543 Ga0501069_0012765 3300049585 Bacteria 4471
544 Ga0501069_0015388 3300049585 Bacteria 4099
545 Ga0501070_0001048 3300049586 Bacteria 24902
546 Ga0501070_0010508 3300049586 Bacteria 7825
547 Ga0501071_0000794 3300049587 Bacteria 16834
548 Ga0501071_0001269 3300049587 Bacteria 14325
549 Ga0501071_0318447 3300049587 Bacteria 1181
550 Ga0501072_0001312 3300049588 Bacteria 18637
551 Ga0501072_0040141 3300049588 Bacteria 3675
552 Ga0501073_0000776 3300049589 Bacteria 22713
553 Ga0501073_0015360 3300049589 Bacteria 5553
554 Ga0501073_0017380 3300049589 Bacteria 5210
555 Ga0501073_0322274 3300049589 Bacteria 1067
556 Ga0501074_0033216 3300049590 Bacteria 3738
557 Ga0501076_0085465 3300049592 Bacteria 2535
558 Ga0501198_019348 3300049649 Bacteria 1072
559 Ga0501199_012007 3300049650 Unclassified 942
560 Ga0501202_001630 3300049652 Bacteria 3630
561 Ga0501223_020878 3300049663 Unclassified 1282
562 Ga0501233_061105 3300049668 Bacteria 935
563 Ga0501251_028469 3300049681 Unclassified 784
564 Ga0501259_006622 3300049688 Bacteria 1845
565 Ga0501225_0004283 3300049705 Bacteria 4265
566 Ga0501080_0001929 3300049742 Bacteria 17903
567 Ga0501080_0005995 3300049742 Bacteria 10894
568 Ga0501080_0057725 3300049742 Bacteria 3613
569 Ga0501080_0263802 3300049742 Unclassified 1569
570 Ga0501081_0160823 3300049743 Bacteria 1618
571 Ga0501081_0983413 3300049743 Bacteria 637
572 Ga0501083_0017086 3300049744 Bacteria 5063
573 Ga0501083_0074830 3300049744 Bacteria 2249
574 Ga0501035_0118663 3300049822 Bacteria 2314
575 Ga0501035_0394679 3300049822 Bacteria 1152
576 nmdc:mga08y16_187646_c1 3300050511 Bacteria 2145
577 nmdc:mga08y16_268823_c1 3300050511 Bacteria 1760
578 nmdc:mga0n895_134783_c1 3300050512 Bacteria 2496
579 Ga0495601_0176325 3300053077 Bacteria 1397
580 Ga0495595_0071052 3300053084 Bacteria 1645
581 Ga0495595_0089136 3300053084 Unclassified 1478
582 Ga0495619_0109019 3300053085 Unclassified 1890
583 Ga0501084_0009557 3300054114 Bacteria 8027
584 Ga0501084_0137781 3300054114 Bacteria 2054
585 Ga0501082_0006301 3300060353 Bacteria 10290
586 Ga0501082_0021156 3300060353 Bacteria 5610
587 Ga0070708_100000023
588 JGI24738J21930_10043570
589 Ga0065712_10083152
590 Ga0070658_10001374
591 Ga0070658_10148761
592 Ga0070676_10166014
593 Ga0070676_10292758
594 Ga0070683_100000429
595 Ga0070683_100003445
596 Ga0070683_100008205
597 Ga0070683_100027152
598 Ga0070683_100059523
599 Ga0070683_100078322
600 Ga0070683_100170376
601 Ga0070683_100182205
602 Ga0070683_100187258
603 Ga0070683_100306917
604 Ga0070683_100397286
605 Ga0070683_100437845
606 Ga0070683_100563767
607 Ga0070690_100048231
608 Ga0070690_100144603
609 Ga0070690_100233775
610 Ga0070670_100031126
611 Ga0070670_100280016
612 Ga0070670_100327484
613 Ga0070670_100497461
614 Ga0070670_100734123
615 Ga0068869_100014227
616 Ga0068869_100126430
617 Ga0068869_100429124
618 Ga0070666_10405867
619 Ga0070680_100000021
620 Ga0070680_100002481
621 Ga0070680_100138951
622 Ga0070680_100259225
623 Ga0070682_100003661
624 Ga0068868_100077912
625 Ga0068868_100110655
626 Ga0068868_100263652
627 Ga0070660_100015055
628 Ga0070660_100020838
629 Ga0070660_100117296
630 Ga0070689_100019456
631 Ga0070689_100082044
632 Ga0070689_100114734
633 Ga0070689_100206983
634 Ga0070689_100532651
635 Ga0070687_100078823
636 Ga0070661_100033311
637 Ga0070661_100179622
638 Ga0070692_10014075
639 Ga0070668_100246329
640 Ga0070668_100312771
641 Ga0070668_100774723
642 Ga0070669_100006004
643 Ga0070675_100007972
644 Ga0070675_100027083
645 Ga0070671_100050773
646 Ga0070671_100236071
647 Ga0070674_100485943
648 Ga0070673_100010926
649 Ga0070673_100048759
650 Ga0070673_100104407
651 Ga0070673_100210718
652 Ga0070688_100014620
653 Ga0070688_100066799
654 Ga0070688_100276246
655 Ga0070688_100523990
656 Ga0070659_100002317
657 Ga0070659_100003724
658 Ga0070659_100019956
659 Ga0070659_100055442
660 Ga0070667_100097704
661 Ga0070667_100323996
662 Ga0070667_100452331
663 Ga0070709_10022013
664 Ga0070709_10066972
665 Ga0070713_100047973
666 Ga0070713_100114307
667 Ga0070713_100786315
668 Ga0070701_10167586
669 Ga0070711_100203548
670 Ga0070711_100518045
671 Ga0070694_100149517
672 Ga0070663_100131694
673 Ga0070662_100019801
674 Ga0070662_100023868
675 Ga0070662_100151519
676 Ga0070681_10001650
677 Ga0070681_10005096
678 Ga0070681_10026752
679 Ga0070681_10384652
680 Ga0068867_100345797
681 Ga0068867_101150919
682 Ga0070685_10098201
683 Ga0070685_10486678
684 Ga0070679_100000866
685 Ga0070679_100015528
686 Ga0070679_100023172
687 Ga0070679_100033634
688 Ga0070679_100034148
689 Ga0070679_100106812
690 Ga0070679_100246067
691 Ga0070684_100004192
692 Ga0070684_100010409
693 Ga0070684_100011064
694 Ga0070684_100043478
695 Ga0070684_100060557
696 Ga0070684_100160196
697 Ga0070684_100871339
698 Ga0068853_100099206
699 Ga0068853_100163763
700 Ga0068853_100191299
701 Ga0068853_100553157
702 Ga0070672_100032699
703 Ga0070672_100414187
704 Ga0070686_100327655
705 Ga0070695_100257032
706 Ga0070696_100455731
707 Ga0070693_100002286
708 Ga0070693_100206099
709 Ga0070665_100218629
710 Ga0068855_100058123
711 Ga0068855_100064358
712 Ga0068855_100231731
713 Ga0070664_100007779
714 Ga0070664_100020896
715 Ga0070664_100074493
716 Ga0070664_100697343
717 Ga0068857_100003542
718 Ga0068857_100035803
719 Ga0068857_100053694
720 Ga0068857_100886427
721 Ga0068854_100709070
722 Ga0068856_100002052
723 Ga0068856_100075475
724 Ga0068856_100085819
725 Ga0068856_100387074
726 Ga0068856_100790194
727 Ga0070702_100007650
728 Ga0068852_100013616
729 Ga0068852_100029191
730 Ga0068852_100035127
731 Ga0068859_100010712
732 Ga0068859_100515468
733 Ga0068864_100018061
734 Ga0068864_100073878
735 Ga0068861_100070213
736 Ga0068870_10004146
737 Ga0068870_10171592
738 Ga0068863_100017061
739 Ga0068863_100496964
740 Ga0068858_100237734
741 Ga0068858_100328232
742 Ga0068858_100383312
743 Ga0068858_101034541
744 Ga0068860_100024437
745 Ga0070712_100332847
746 Ga0070712_100537996
747 Ga0097621_100331576
748 Ga0068871_100003795
749 Ga0068871_100107656
750 Ga0075430_100472887
751 Ga0075433_10635845
752 Ga0075434_100056618
753 Ga0075434_101555157
754 Ga0068865_100083963
755 Ga0068865_100405321
756 Ga0097620_100010712
757 Ga0097620_100515522
758 Ga0105240_10014816
759 Ga0105240_10983416
760 Ga0111539_10153123
761 Ga0105245_10037351
762 Ga0105245_10057057
763 Ga0105245_10133294
764 Ga0105245_10158116
765 Ga0105245_10846992
766 Ga0105243_10146282
767 Ga0105241_10018730
768 Ga0105241_10162864
769 Ga0105242_10057254
770 Ga0105242_11213263
771 Ga0105248_10003991
772 Ga0105248_10041515
773 Ga0105248_10056911
774 Ga0105248_10075620
775 Ga0105248_10617573
776 Ga0105237_10290238
777 Ga0105237_10445973
778 Ga0105238_10069649
779 Ga0105238_10202151
780 Ga0105238_10370145
781 Ga0105238_10591299
782 Ga0105238_10750266
783 Ga0105249_10123614
784 Ga0105249_10964646
785 Ga0105246_10002895
786 Ga0105246_10753791
787 Ga0157373_10070346
788 Ga0157373_10145961
789 Ga0157371_10018031
790 Ga0157371_10043561
791 Ga0157371_10442843
792 Ga0157370_10002501
793 Ga0157370_10064099
794 Ga0157370_10280423
795 Ga0157370_10347956
796 Ga0157369_10026400
797 Ga0157369_10035166
798 Ga0157369_10066060
799 Ga0157369_10142746
800 Ga0157369_10440784
801 Ga0157378_10160316
802 Ga0157378_10368574
803 Ga0163162_10646108
804 Ga0163162_10708635
805 Ga0163162_11317024
806 Ga0157372_10003954
807 Ga0157372_10015579
808 Ga0157372_10030696
809 Ga0157372_10056402
810 Ga0157372_10057204
811 Ga0157372_10057643
812 Ga0157372_10397829
813 Ga0157375_10023505
814 Ga0157375_10146712
815 Ga0157375_10301276
816 Ga0163163_10038263
817 Ga0182008_10210209
818 Ga0157377_10144013
819 Ga0157377_10176282
820 Ga0157376_10027890
821 Ga0157376_10360032
822 Ga0157376_10382716
823 Ga0206354_10647760
824 Ga0207697_10160106
825 Ga0207699_10010833
826 Ga0207699_10546209
827 Ga0207645_10026425
828 Ga0207645_10037234
829 Ga0207643_10003284
830 Ga0207705_10000670
831 Ga0207705_10003061
832 Ga0207705_10029615
833 Ga0207705_10107337
834 Ga0207705_10162224
835 Ga0207654_10016668
836 Ga0207707_10001106
837 Ga0207707_10003856
838 Ga0207707_10057319
839 Ga0207707_10116545
840 Ga0207695_10022378
841 Ga0207660_10000141
842 Ga0207660_10024045
843 Ga0207660_10091039
844 Ga0207660_10092703
845 Ga0207662_10004172
846 Ga0207657_10001978
847 Ga0207657_10014269
848 Ga0207657_10066140
849 Ga0207657_10079609
850 Ga0207657_10214313
851 Ga0207649_10047251
852 Ga0207652_10001406
853 Ga0207652_10009561
854 Ga0207652_10012300
855 Ga0207652_10024028
856 Ga0207652_10068377
857 Ga0207652_10122308
858 Ga0207652_10310359
859 Ga0207646_10074381
860 Ga0207646_10684278
861 Ga0207681_10010386
862 Ga0207681_10076131
863 Ga0207694_10026995
864 Ga0207694_10174877
865 Ga0207694_10484310
866 Ga0207650_10100804
867 Ga0207650_10233166
868 Ga0207650_10243648
869 Ga0207650_10263452
870 Ga0207650_10598746
871 Ga0207659_10003174
872 Ga0207659_10116031
873 Ga0207687_10045136
874 Ga0207687_10269335
875 Ga0207700_10049339
876 Ga0207700_10055995
877 Ga0207664_10004807
878 Ga0207664_10434326
879 Ga0207644_10297722
880 Ga0207644_10344069
881 Ga0207690_10021775
882 Ga0207690_10070373
883 Ga0207690_10230909
884 Ga0207706_10002611
885 Ga0207706_10175519
886 Ga0207706_10334280
887 Ga0207686_10065371
888 Ga0207686_10243657
889 Ga0207686_10759399
890 Ga0207670_10399770
891 Ga0207670_10549657
892 Ga0207669_10776938
893 Ga0207665_10201783
894 Ga0207691_10033076
895 Ga0207691_10139252
896 Ga0207691_10297040
897 Ga0207711_10037887
898 Ga0207711_10367035
899 Ga0207711_10950633
900 Ga0207689_10046742
901 Ga0207689_10078904
902 Ga0207689_10179325
903 Ga0207661_10000363
904 Ga0207661_10009404
905 Ga0207661_10011500
906 Ga0207661_10055418
907 Ga0207661_10069587
908 Ga0207661_10121915
909 Ga0207661_10243295
910 Ga0207661_10264018
911 Ga0207661_10466546
912 Ga0207679_10002053
913 Ga0207679_10031263
914 Ga0207679_10214573
915 Ga0207679_10526131
916 Ga0207667_10128851
917 Ga0207667_10295896
918 Ga0207667_10413757
919 Ga0207667_10455900
920 Ga0207667_10517844
921 Ga0207651_10127919
922 Ga0207651_10179013
923 Ga0207651_10437555
924 Ga0207651_10754526
925 Ga0207712_10098017
926 Ga0207712_10773135
927 Ga0207668_10213681
928 Ga0207658_10186533
929 Ga0207677_10208724
930 Ga0207703_10083256
931 Ga0207703_10321624
932 Ga0207703_10677563
933 Ga0207639_10092636
934 Ga0207639_10131053
935 Ga0207678_10148938
936 Ga0207702_10214837
937 Ga0207702_10347560
938 Ga0207641_10058029
939 Ga0207648_10227626
940 Ga0207676_10005668
941 Ga0207676_10075853
942 Ga0207674_10001269
943 Ga0207674_10004648
944 Ga0207674_10015375
945 Ga0207674_10260130
946 Ga0207683_10235384
947 Ga0207683_10364516
948 Ga0207698_10026244
949 Ga0207698_10080161
950 Ga0207698_10185422
951 Ga0207698_10904514
952 Ga0209982_1025024
953 Ga0209966_1001178
954 Ga0209998_10000445
955 Ga0209974_10033586
956 Ga0207428_10407230
957 Ga0268266_10109357
958 Ga0268266_11212091
959 Ga0268264_10118540
960 Ga0307408_100250034
961 Ga0307408_100285533
962 Ga0307408_100315215
963 Ga0307405_10039542
964 Ga0307405_10287733
965 Ga0307413_10004673
966 Ga0307413_10034144
967 Ga0307410_10012151
968 Ga0307410_10027806
969 Ga0307410_10056447
970 Ga0307410_10067196
971 Ga0307410_10069327
972 Ga0307406_10049068
973 Ga0307406_10071041
974 Ga0307406_10417025
975 Ga0307406_10509109
976 Ga0307406_10576842
977 Ga0307407_10003358
978 Ga0307407_10042641
979 Ga0307407_10045875
980 Ga0307412_10377704
981 Ga0307409_100002889
982 Ga0307409_100430199
983 Ga0307409_100635413
984 Ga0307416_100067311
985 Ga0307416_100103317
986 Ga0307416_100217752
987 Ga0307416_100243898
988 Ga0307416_100406711
989 Ga0307414_10008574
990 Ga0307414_10425122
991 Ga0307414_10975360
992 Ga0307411_10047928
993 Ga0307411_10420123
994 Ga0307411_10421441
995 Ga0307415_100001175
996 Ga0307415_100023181
997 Ga0307415_100190068
998 Ga0307415_100506111
999 Ga0307415_100803909
1000 Ga0373959_0065946
1001 Ga0373934_0009977
1002 Ga0373923_0234400
1003 Ga0373954_0062432
1004 Ga0373954_0094415
1005 Ga0373956_0025215
1006 Ga0373956_0053574
1007 Ga0373957_0023425
1008 Ga0373955_0014043
1009 Ga0373924_0013275
1010 Ga0373931_0078409
1011 Ga0373935_0740048
1012 Ga0373927_0106175
1013 Ga0373933_0004877
1014 Ga0373947_0025409
1015 Ga0373937_0006852
1016 Ga0373925_0047067
1017 Ga0373925_0632393
1018 Ga0451576_0217028
1019 Ga0451576_0446543
1020 Ga0466967_0056584
1021 Ga0466967_0418036
1022 Ga0466967_1028494
1023 Ga0495629_0010765
1024 Ga0495629_0218800
1025 Ga0495651_0096749
1026 Ga0495651_0098975
1027 Ga0495653_0036083
1028 Ga0495580_0003742
1029 Ga0495582_0210287
1030 Ga0495582_0304000
1031 Ga0495582_0489843
1032 Ga0495639_0005908
1033 Ga0495639_0337229
1034 Ga0495664_0067967
1035 Ga0495594_0003626
1036 Ga0495594_0003972
1037 Ga0495594_0011231
1038 Ga0495594_0015462
1039 Ga0495594_0486002
1040 Ga0495608_0221634
1041 Ga0495618_0124253
1042 Ga0495628_0048377
1043 Ga0495630_0029394
1044 Ga0495630_0033414
1045 Ga0495666_0278923
1046 Ga0495652_0000395
1047 Ga0495652_0004855
1048 Ga0495652_0117860
1049 Ga0495665_0016781
1050 Ga0495640_0404523
1051 Ga0495586_0016003
1052 Ga0495586_0021164
1053 Ga0495586_0036607
1054 Ga0495586_0088111
1055 Ga0495587_0001882
1056 Ga0495587_0004959
1057 Ga0495621_0005014
1058 Ga0495645_0000230
1059 Ga0495645_0124298
1060 Ga0495645_0317214
1061 Ga0495622_0283584
1062 Ga0495667_0000423
1063 Ga0495667_0064624
1064 Ga0495634_0159451
1065 Ga0495659_0138083
1066 Ga0495657_0131345
1067 Ga0495657_0231182
1068 Ga0495599_0027392
1069 Ga0495599_0071073
1070 Ga0495623_0031564
1071 Ga0495623_0041644
1072 Ga0495623_0177332
1073 Ga0495646_0329697
1074 Ga0495658_0174988
1075 Ga0495613_0014494
1076 Ga0495613_0052140
1077 Ga0495613_0163162
1078 Ga0495600_0032981
1079 Ga0495600_0098639
1080 Ga0495581_0010067
1081 Ga0495581_0062683
1082 Ga0495581_0140023
1083 Ga0495581_0154915
1084 Ga0495581_0205323
1085 Ga0495604_0125553
1086 Ga0495674_0158302
1087 Ga0495674_0250743
1088 Ga0495672_0243283
1089 Ga0495680_0107664
1090 Ga0495675_0002427
1091 Ga0495675_0015531
1092 Ga0495675_0102297
1093 Ga0495675_0142402
1094 Ga0495685_017974
1095 Ga0495614_0174847
1096 Ga0496104_0418714
1097 Ga0496106_0044929
1098 Ga0496107_0195061
1099 Ga0496108_0106084
1100 Ga0496108_0561925
1101 Ga0496109_0064903
1102 Ga0496111_0130039
1103 Ga0496112_0001127
1104 Ga0496112_0038641
1105 Ga0496113_0008540
1106 Ga0496115_0217035
1107 Ga0496115_0455413
1108 Ga0501032_0127294
1109 Ga0501033_0006687
1110 Ga0501033_0209939
1111 Ga0501034_0003244
1112 Ga0501034_0112273
1113 Ga0501034_0120042
1114 Ga0501036_0049773
1115 Ga0501036_0056181
1116 Ga0501036_0307645
1117 Ga0501037_0039227
1118 Ga0501043_0061083
1119 Ga0501047_0080294
1120 Ga0501047_0148542
1121 Ga0501047_0386117
1122 Ga0501047_0778221
1123 Ga0501067_0000044
1124 Ga0501067_0031156
1125 Ga0501067_0073649
1126 Ga0501068_0000908
1127 Ga0501068_0036056
1128 Ga0501069_0001029
1129 Ga0501069_0012765
1130 Ga0501069_0015388
1131 Ga0501070_0001048
1132 Ga0501070_0010508
1133 Ga0501071_0000794
1134 Ga0501071_0001269
1135 Ga0501071_0318447
1136 Ga0501072_0001312
1137 Ga0501072_0040141
1138 Ga0501073_0000776
1139 Ga0501073_0015360
1140 Ga0501073_0017380
1141 Ga0501073_0322274
1142 Ga0501074_0033216
1143 Ga0501076_0085465
1144 Ga0501198_019348
1145 Ga0501199_012007
1146 Ga0501202_001630
1147 Ga0501223_020878
1148 Ga0501233_061105
1149 Ga0501251_028469
1150 Ga0501259_006622
1151 Ga0501225_0004283
1152 Ga0501080_0001929
1153 Ga0501080_0005995
1154 Ga0501080_0057725
1155 Ga0501080_0263802
1156 Ga0501081_0160823
1157 Ga0501081_0983413
1158 Ga0501083_0017086
1159 Ga0501083_0074830
1160 Ga0501035_0118663
1161 Ga0501035_0394679
1162 nmdc:mga08y16_187646_c1
1163 nmdc:mga08y16_268823_c1
1164 nmdc:mga0n895_134783_c1
1165 Ga0495601_0176325
1166 Ga0495595_0071052
1167 Ga0495595_0089136
1168 Ga0495619_0109019
1169 Ga0501084_0009557
1170 Ga0501084_0137781
1171 Ga0501082_0006301
1172 Ga0501082_0021156

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13189

Cytidylate_kin2

Cytidylate kinase-like family

3

187

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hdt-assembly1.cif.gz_B crystal structure of putative kinase from clostridium symbiosum atcc 14940 0.8696 3 200
3fdi-assembly1.cif.gz_A crystal structure of uncharacterized protein from eubacterium ventriosum atcc 27560. 0.8315 1 201
3fdi-assembly1.cif.gz_A crystal structure of uncharacterized protein from eubacterium ventriosum atcc 27560. 0.8268 1 201
3hdt-assembly1.cif.gz_B crystal structure of putative kinase from clostridium symbiosum atcc 14940 0.8261 3 200
8flj-assembly1.cif.gz_E cas1-cas2/3 integrase and ihf bound to crispr leader, repeat and foreign dna 0.8135 132 168
ID Description Score Start End Superfamily
3hdtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8541 3 200 3.40.50.300
af_Q9VEJ7_13_73_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8383 131 164 1.10.10.10
1ihfA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.8274 132 168 4.10.520.10
3hdtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8155 3 200 3.40.50.300
3fdiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7871 1 201 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A354I760-F1-model_v4 Cytidylate kinase family protein 0.8759 1 200 GO:0016020
AF-A0A1Y3ZZ52-F1-model_v4 Cytidylate kinase 0.8661 3 200
AF-A0A7V4MTX3-F1-model_v4 Cytidylate kinase-like family protein 0.8628 1 201 GO:0016301
AF-A0A3C0TQM8-F1-model_v4 BON domain-containing protein 0.857 2 199
AF-A0A842NQR4-F1-model_v4 Cytidylate kinase family protein 0.8553 1 198 GO:0016301

Map