F466521

General Info

Members Datasets Scaffolds Average Seq Length
586 297 520 182

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100100927|Ga0070682_1001009272
Length 202
Sequence MRIISGKYKGRRIFPPKNLPVRPTTDMSKEALFNVLNNHFSFDGLKVLDLFSGTGNISYEFASRGSAPITSIDGDFGCVKFIKQVSSEYDFDIAATKSDVYKFLENCKTSYDIIFADPPYGLDQAAFEKIVLTVFEKELLSEDGMMIIEHSKYTKMEHLSNFSFQKSYGGSFFSFFELHSTDDDEELEGDLPLKAAEEEDEG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
4 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
5 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
6 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
7 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
8 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
9 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
10 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
11 2738541283 Pedobacter sp. OK701 Isolate Unclassified
12 2738541284 Pedobacter sp. YR016 Isolate Unclassified
13 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
14 2738541302 Pedobacter sp. CF074 Isolate Unclassified
15 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
16 2738543023 Pedobacter sp. OK628 Isolate Unclassified
17 2739367651 Pedobacter sp. OK291 Isolate Unclassified
18 2739367656 Pedobacter sp. CF523 Isolate Unclassified
19 2739367663 Pedobacter sp. YR510 Isolate Unclassified
20 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
21 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
22 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
23 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
24 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
25 2818991437 Pedobacter terrae 518 Isolate Unclassified
26 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
27 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
28 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
29 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
30 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
31 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
32 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
33 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
34 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
35 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
36 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
37 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
38 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
39 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
40 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
41 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
42 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
43 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
44 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
45 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
46 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
47 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
48 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
49 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
50 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
51 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
52 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
53 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
54 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
55 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
56 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
57 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
58 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
59 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
60 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
61 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
62 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
63 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
64 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
65 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
66 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
67 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
68 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
69 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
70 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
71 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
72 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
73 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
74 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
75 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
76 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
77 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
78 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
79 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
80 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
81 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
82 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
83 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
84 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
85 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
86 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
87 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
88 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
89 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
90 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
91 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
92 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
93 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
94 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
95 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
96 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
97 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
98 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
99 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
100 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
101 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
102 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
109 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
110 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
132 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
133 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
138 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
139 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
140 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
141 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
142 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
173 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
181 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
182 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
183 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
188 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
201 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
202 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
203 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
204 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
211 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
212 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
213 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
214 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
215 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
222 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
223 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
228 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
229 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
230 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
231 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
232 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
233 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
234 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
237 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
238 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
239 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
240 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
243 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
244 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
251 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
252 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
253 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
254 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
260 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
268 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
269 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
270 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
271 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
272 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
273 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
277 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
278 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
279 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
280 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
281 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
282 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
283 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
284 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
285 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
286 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
287 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
288 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
289 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
290 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
291 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
292 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
293 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
294 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
295 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
296 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
297 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.74
Metatranscriptomes 0
Isolates 11.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.04
Nodule 0.85
Rhizoplane 1.02
Rhizosphere 76.11
Stem 0
Stem Tuber 0
Unclassified 12.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1994321 2162886007 Bacteria 2405
2 SwRhRL2b_contig_2896220 2162886007 Bacteria 1878
3 SwRhRL2b_contig_475676 2162886007 Bacteria 8397
4 JGI24740J21852_10026945 3300001979 Bacteria 1918
5 JGI24739J22299_10021822 3300001989 Bacteria 2275
6 JGI24739J22299_10082971 3300001989 Bacteria 982
7 JGI24737J22298_10002356 3300001990 Bacteria 6734
8 JGI24737J22298_10014539 3300001990 Bacteria 2554
9 JGI24743J22301_10047552 3300001991 Bacteria 870
10 JGI24735J21928_10000050 3300002067 Bacteria 50872
11 JGI25162J39368_1000011 3300002737 Bacteria 379156
12 JGI25162J39368_1000516 3300002737 Bacteria 28941
13 JGI25157J39369_1002605 3300002741 Bacteria 4289
14 JGI25164J39214_1002379 3300002772 Bacteria 2933
15 JGI25152J39213_1000476 3300002773 Bacteria 23167
16 JGI25150J39212_1000002 3300002774 Bacteria 537631
17 JGI25151J46595_10000003 3300003187 Bacteria 715330
18 JGI25165J46597_1000420 3300003214 Bacteria 43968
19 JGI25165J46597_1012298 3300003214 Bacteria 1200
20 JGI25153J46596_10000003 3300003215 Bacteria 553253
21 rootH1_10040717 3300003316 Bacteria 6609
22 rootH1_10162791 3300003316 Bacteria 6133
23 rootH2_10002871 3300003320 Bacteria 62767
24 rootH2_10009001 3300003320 Bacteria 7701
25 rootH2_10050636 3300003320 Bacteria 12115
26 rootH2_10116182 3300003320 Bacteria 1075
27 rootL2_10055142 3300003322 Bacteria 1599
28 rootH1_10016880 3300003323 Bacteria 64867
29 rootH1_10019100 3300003323 Bacteria 5172
30 rootH1_10102135 3300003323 Bacteria 6055
31 rootH1_10164698 3300003323 Bacteria 1478
32 rootH1_10203603 3300003323 Bacteria 3487
33 rootH1_10218449 3300003323 Bacteria 9817
34 rootH1_10393646 3300003323 Bacteria 1710
35 Ga0055536_1000049 3300003781 Bacteria 113328
36 Ga0055530_10002714 3300003791 Bacteria 10996
37 Ga0065714_10002298 3300005288 Bacteria 48008
38 Ga0065714_10002621 3300005288 Bacteria 31326
39 Ga0065714_10007462 3300005288 Bacteria 3354
40 Ga0065714_10009665 3300005288 Bacteria 3454
41 Ga0065714_10021565 3300005288 Bacteria 2010
42 Ga0065714_10065634 3300005288 Bacteria 9088
43 Ga0065714_10071503 3300005288 Bacteria 3561
44 Ga0065714_10084878 3300005288 Bacteria 2175
45 Ga0065714_10121686 3300005288 Bacteria 1340
46 Ga0065714_10144305 3300005288 Bacteria 1149
47 Ga0065714_10149660 3300005288 Bacteria 1114
48 Ga0065714_10229307 3300005288 Bacteria 820
49 Ga0065704_10000205 3300005289 Bacteria 128899
50 Ga0065704_10001103 3300005289 Bacteria 14777
51 Ga0065704_10072486 3300005289 Bacteria 8442
52 Ga0065715_10230921 3300005293 Bacteria 1234
53 Ga0070658_10000047 3300005327 Bacteria 129483
54 Ga0070658_10134238 3300005327 Bacteria 2064
55 Ga0070658_10312656 3300005327 Bacteria 1340
56 Ga0070676_10001044 3300005328 Bacteria 13792
57 Ga0070683_100017009 3300005329 Bacteria 6418
58 Ga0070682_100100927 3300005337 Bacteria 1905
59 Ga0068868_101601470 3300005338 Bacteria 612
60 Ga0070660_100020897 3300005339 Bacteria 4819
61 Ga0070660_100134812 3300005339 Bacteria 1978
62 Ga0070660_100284506 3300005339 Bacteria 1353
63 Ga0070671_100011353 3300005355 Bacteria 7161
64 Ga0070673_100006628 3300005364 Bacteria 7544
65 Ga0070688_100526304 3300005365 Bacteria 895
66 Ga0070659_100001238 3300005366 Bacteria 18539
67 Ga0070659_100001469 3300005366 Bacteria 16968
68 Ga0070659_100013744 3300005366 Bacteria 6036
69 Ga0070678_100023213 3300005456 Bacteria 4129
70 Ga0070662_100000252 3300005457 Bacteria 31682
71 Ga0068867_100001529 3300005459 Bacteria 16051
72 Ga0070684_100130788 3300005535 Bacteria 2264
73 Ga0068853_100147195 3300005539 Bacteria 2117
74 Ga0068853_100350492 3300005539 Bacteria 1373
75 Ga0070665_100000104 3300005548 Bacteria 158048
76 Ga0070665_100220035 3300005548 Bacteria 1899
77 Ga0068855_100000048 3300005563 Bacteria 145334
78 Ga0068855_100001222 3300005563 Bacteria 31872
79 Ga0068855_100025513 3300005563 Bacteria 7070
80 Ga0068855_100047574 3300005563 Bacteria 5067
81 Ga0068855_100056124 3300005563 Bacteria 4623
82 Ga0068855_100097760 3300005563 Bacteria 3382
83 Ga0068855_100672322 3300005563 Bacteria 1110
84 Ga0068857_100061221 3300005577 Bacteria 3344
85 Ga0068857_100327186 3300005577 Bacteria 1416
86 Ga0068857_100633352 3300005577 Bacteria 1012
87 Ga0068857_101076202 3300005577 Bacteria 776
88 Ga0068856_100004452 3300005614 Bacteria 13956
89 Ga0068856_100126211 3300005614 Bacteria 2562
90 Ga0068856_100161081 3300005614 Unclassified 2254
91 Ga0068856_100390907 3300005614 Bacteria 1410
92 Ga0068856_100544127 3300005614 Bacteria 1182
93 Ga0068852_100448800 3300005616 Bacteria 1276
94 Ga0068851_10424688 3300005834 Bacteria 785
95 Ga0070717_11385065 3300006028 Bacteria 639
96 Ga0075366_10005129 3300006195 Bacteria 7086
97 Ga0075366_10049384 3300006195 Bacteria 2497
98 Ga0075366_10748565 3300006195 Unclassified 607
99 Ga0097621_100001962 3300006237 Bacteria 14033
100 Ga0099824_1000378 3300006942 Bacteria 50161
101 Ga0079104_1000108 3300006946 Bacteria 122180
102 Ga0099826_10000322 3300006948 Bacteria 21747
103 Ga0105244_10000099 3300009036 Bacteria 90288
104 Ga0105244_10051568 3300009036 Bacteria 2096
105 Ga0105240_10000193 3300009093 Bacteria 124087
106 Ga0105240_10003500 3300009093 Bacteria 24345
107 Ga0105240_10036495 3300009093 Bacteria 6322
108 Ga0105240_10051774 3300009093 Bacteria 5165
109 Ga0105240_10067695 3300009093 Bacteria 4426
110 Ga0105240_10095167 3300009093 Bacteria 3632
111 Ga0105240_10258173 3300009093 Bacteria 2012
112 Ga0105240_10323754 3300009093 Bacteria 1756
113 Ga0105240_10676418 3300009093 Unclassified 1129
114 Ga0105240_11065332 3300009093 Bacteria 862
115 Ga0105243_10648231 3300009148 Bacteria 1023
116 Ga0105241_10000898 3300009174 Bacteria 22475
117 Ga0105241_10006942 3300009174 Bacteria 8336
118 Ga0105241_10098513 3300009174 Unclassified 2320
119 Ga0105241_10116979 3300009174 Bacteria 2142
120 Ga0105241_10358166 3300009174 Unclassified 1269
121 Ga0105241_10770142 3300009174 Bacteria 884
122 Ga0105242_10358106 3300009176 Bacteria 1350
123 Ga0105237_10000417 3300009545 Bacteria 60658
124 Ga0105237_10004270 3300009545 Bacteria 16609
125 Ga0105237_10022631 3300009545 Bacteria 6446
126 Ga0105237_10024656 3300009545 Bacteria 6152
127 Ga0105237_10031639 3300009545 Bacteria 5359
128 Ga0105237_10060104 3300009545 Bacteria 3802
129 Ga0105237_10124945 3300009545 Bacteria 2567
130 Ga0105237_10600872 3300009545 Unclassified 1107
131 Ga0105238_10156718 3300009551 Bacteria 2252
132 Ga0105238_10227582 3300009551 Unclassified 1841
133 Ga0105238_10446122 3300009551 Bacteria 1291
134 Ga0105239_10000005 3300010375 Bacteria 496066
135 Ga0105239_10000010 3300010375 Bacteria 341545
136 Ga0105239_10000482 3300010375 Bacteria 58131
137 Ga0105239_10006733 3300010375 Bacteria 13275
138 Ga0105239_10007450 3300010375 Bacteria 12560
139 Ga0105239_10010744 3300010375 Bacteria 10226
140 Ga0105239_10035975 3300010375 Bacteria 5436
141 Ga0105239_10073058 3300010375 Bacteria 3771
142 Ga0105239_10074992 3300010375 Bacteria 3719
143 Ga0105246_10096396 3300011119 Unclassified 2144
144 Ga0157373_10000001 3300013100 Bacteria 864756
145 Ga0157373_10000188 3300013100 Bacteria 50875
146 Ga0157373_10000974 3300013100 Bacteria 22189
147 Ga0157373_10006199 3300013100 Bacteria 8934
148 Ga0157373_10006545 3300013100 Bacteria 8692
149 Ga0157373_10013397 3300013100 Bacteria 6015
150 Ga0157373_10025041 3300013100 Bacteria 4320
151 Ga0157373_10087836 3300013100 Bacteria 2190
152 Ga0157373_10692949 3300013100 Bacteria 746
153 Ga0157371_10000119 3300013102 Bacteria 120350
154 Ga0157371_10001189 3300013102 Bacteria 27874
155 Ga0157371_10001476 3300013102 Bacteria 24383
156 Ga0157371_10002382 3300013102 Bacteria 17982
157 Ga0157371_10010487 3300013102 Bacteria 7211
158 Ga0157371_10040694 3300013102 Bacteria 3318
159 Ga0157371_10048158 3300013102 Bacteria 3030
160 Ga0157371_10055034 3300013102 Bacteria 2824
161 Ga0157370_10000026 3300013104 Bacteria 152092
162 Ga0157370_10002418 3300013104 Bacteria 22506
163 Ga0157370_10004633 3300013104 Bacteria 15727
164 Ga0157370_10008951 3300013104 Bacteria 10754
165 Ga0157370_10010332 3300013104 Bacteria 9849
166 Ga0157370_10014232 3300013104 Bacteria 8150
167 Ga0157370_10051173 3300013104 Bacteria 3946
168 Ga0157370_10056450 3300013104 Bacteria 3738
169 Ga0157370_10086945 3300013104 Bacteria 2936
170 Ga0157370_10091869 3300013104 Bacteria 2849
171 Ga0157370_10234844 3300013104 Bacteria 1697
172 Ga0157370_10260512 3300013104 Bacteria 1603
173 Ga0157370_10296713 3300013104 Bacteria 1492
174 Ga0157370_10378736 3300013104 Bacteria 1303
175 Ga0157370_11073849 3300013104 Bacteria 728
176 Ga0157369_10000015 3300013105 Bacteria 262917
177 Ga0157369_10000853 3300013105 Bacteria 38843
178 Ga0157369_10002378 3300013105 Bacteria 22612
179 Ga0157369_10046288 3300013105 Bacteria 4728
180 Ga0157369_10095996 3300013105 Bacteria 3163
181 Ga0157369_10234111 3300013105 Unclassified 1920
182 Ga0157369_10424963 3300013105 Bacteria 1378
183 Ga0157374_10000408 3300013296 Bacteria 38980
184 Ga0157374_10000618 3300013296 Bacteria 31268
185 Ga0157374_10008291 3300013296 Bacteria 8864
186 Ga0157374_10059021 3300013296 Bacteria 3586
187 Ga0157374_10250668 3300013296 Bacteria 1742
188 Ga0157378_10199245 3300013297 Bacteria 1893
189 Ga0157378_10243733 3300013297 Bacteria 1718
190 Ga0163162_10000034 3300013306 Bacteria 149611
191 Ga0163162_10000520 3300013306 Bacteria 35697
192 Ga0163162_10002037 3300013306 Bacteria 19017
193 Ga0163162_10018875 3300013306 Bacteria 6761
194 Ga0163162_10045474 3300013306 Bacteria 4398
195 Ga0163162_11178684 3300013306 Bacteria 869
196 Ga0157372_10000011 3300013307 Bacteria 277202
197 Ga0157372_10000458 3300013307 Bacteria 44772
198 Ga0157372_10000743 3300013307 Bacteria 35537
199 Ga0157372_10023113 3300013307 Bacteria 6737
200 Ga0157372_10074067 3300013307 Bacteria 3839
201 Ga0157375_10065996 3300013308 Bacteria 3610
202 Ga0157375_10115254 3300013308 Bacteria 2790
203 Ga0157375_10164366 3300013308 Bacteria 2363
204 Ga0157375_10225483 3300013308 Bacteria 2033
205 Ga0157375_10693755 3300013308 Unclassified 1172
206 Ga0182008_10000069 3300014497 Bacteria 82281
207 Ga0182008_10000247 3300014497 Bacteria 41952
208 Ga0182008_10001023 3300014497 Bacteria 19412
209 Ga0182008_10011758 3300014497 Bacteria 4645
210 Ga0182008_10043944 3300014497 Bacteria 2223
211 Ga0182008_10121860 3300014497 Unclassified 1296
212 Ga0157377_10002282 3300014745 Bacteria 8430
213 Ga0182006_1000091 3300015261 Bacteria 109227
214 Ga0182006_1000210 3300015261 Bacteria 57485
215 Ga0182006_1000352 3300015261 Bacteria 38650
216 Ga0182006_1009379 3300015261 Bacteria 4387
217 Ga0182006_1018008 3300015261 Bacteria 2991
218 Ga0182007_10000010 3300015262 Bacteria 286070
219 Ga0182007_10013273 3300015262 Bacteria 3147
220 Ga0182007_10060178 3300015262 Unclassified 1245
221 Ga0182007_10081480 3300015262 Unclassified 1062
222 Ga0183373_1005 3300015682 Bacteria 351562
223 Ga0163161_10000023 3300017792 Bacteria 205048
224 Ga0163161_10000046 3300017792 Bacteria 127211
225 Ga0163161_10000572 3300017792 Bacteria 29561
226 Ga0163161_10001264 3300017792 Bacteria 18909
227 Ga0163161_10001751 3300017792 Bacteria 15889
228 Ga0163161_10003880 3300017792 Bacteria 10485
229 Ga0163161_10019645 3300017792 Bacteria 4739
230 Ga0163161_10044315 3300017792 Bacteria 3204
231 Ga0163161_10533666 3300017792 Bacteria 960
232 Ga0213872_10021740 3300021361 Bacteria 2955
233 Ga0207427_100173 3300025231 Bacteria 70420
234 Ga0209437_100008 3300025233 Bacteria 921142
235 Ga0209437_100017 3300025233 Bacteria 694471
236 Ga0207425_1000004 3300025245 Bacteria 1092421
237 Ga0209026_1001114 3300025250 Bacteria 12764
238 Ga0209026_1001326 3300025250 Bacteria 11129
239 Ga0209026_1036216 3300025250 Bacteria 723
240 Ga0209129_1000005 3300025258 Bacteria 777812
241 Ga0209233_1000158 3300025261 Bacteria 162281
242 Ga0209233_1002917 3300025261 Bacteria 6111
243 Ga0209233_1011239 3300025261 Bacteria 2645
244 Ga0209455_1003455 3300025272 Bacteria 5586
245 Ga0209676_1000001 3300025292 Bacteria 1852142
246 Ga0209025_1000009 3300025294 Bacteria 1092561
247 Ga0209758_1000010 3300025297 Bacteria 1092782
248 Ga0209050_1000258 3300025298 Bacteria 113741
249 Ga0207655_1000239 3300025728 Bacteria 90288
250 Ga0207655_1081029 3300025728 Bacteria 1171
251 Ga0207647_10000514 3300025904 Bacteria 30831
252 Ga0207647_10009729 3300025904 Bacteria 6821
253 Ga0207647_10204955 3300025904 Bacteria 1140
254 Ga0207645_10000167 3300025907 Bacteria 52468
255 Ga0207705_10000052 3300025909 Bacteria 168319
256 Ga0207654_10010192 3300025911 Bacteria 4784
257 Ga0207654_10017804 3300025911 Bacteria 3721
258 Ga0207654_10022742 3300025911 Bacteria 3349
259 Ga0207654_10427108 3300025911 Bacteria 926
260 Ga0207707_10383124 3300025912 Bacteria 1209
261 Ga0207695_10000013 3300025913 Bacteria 821265
262 Ga0207695_10007902 3300025913 Bacteria 13423
263 Ga0207695_10048396 3300025913 Bacteria 4490
264 Ga0207695_10093694 3300025913 Bacteria 3012
265 Ga0207695_10211523 3300025913 Bacteria 1850
266 Ga0207695_10388550 3300025913 Bacteria 1280
267 Ga0207695_10810033 3300025913 Bacteria 817
268 Ga0207671_10009833 3300025914 Bacteria 7958
269 Ga0207671_10011935 3300025914 Bacteria 7025
270 Ga0207671_10022792 3300025914 Bacteria 4730
271 Ga0207671_10027072 3300025914 Bacteria 4289
272 Ga0207671_10049251 3300025914 Bacteria 3119
273 Ga0207671_10094594 3300025914 Bacteria 2255
274 Ga0207671_10196739 3300025914 Bacteria 1573
275 Ga0207671_10275509 3300025914 Bacteria 1326
276 Ga0207671_10437891 3300025914 Unclassified 1040
277 Ga0207660_10014064 3300025917 Bacteria 5253
278 Ga0207657_10026036 3300025919 Bacteria 5384
279 Ga0207657_10348612 3300025919 Bacteria 1168
280 Ga0207694_10335899 3300025924 Bacteria 1249
281 Ga0207690_10000943 3300025932 Bacteria 18615
282 Ga0207690_10013014 3300025932 Bacteria 4990
283 Ga0207690_10047335 3300025932 Bacteria 2853
284 Ga0207706_10000844 3300025933 Bacteria 31664
285 Ga0207706_10623540 3300025933 Bacteria 925
286 Ga0207686_10015969 3300025934 Bacteria 4208
287 Ga0207709_10760726 3300025935 Bacteria 779
288 Ga0207704_10000062 3300025938 Bacteria 76334
289 Ga0207661_10041014 3300025944 Bacteria 3642
290 Ga0207667_10000023 3300025949 Bacteria 362527
291 Ga0207667_10000956 3300025949 Bacteria 36853
292 Ga0207667_10038291 3300025949 Bacteria 5123
293 Ga0207667_10039499 3300025949 Bacteria 5030
294 Ga0207667_10088364 3300025949 Bacteria 3206
295 Ga0207667_10199473 3300025949 Bacteria 2053
296 Ga0207677_10983154 3300026023 Bacteria 764
297 Ga0207639_10122002 3300026041 Bacteria 2143
298 Ga0207639_10309051 3300026041 Bacteria 1400
299 Ga0207702_10000196 3300026078 Bacteria 71703
300 Ga0207702_10017728 3300026078 Bacteria 5893
301 Ga0207702_10372474 3300026078 Bacteria 1371
302 Ga0207702_11573149 3300026078 Bacteria 651
303 Ga0207648_10000294 3300026089 Bacteria 54322
304 Ga0207674_10074451 3300026116 Bacteria 3407
305 Ga0207674_11042107 3300026116 Bacteria 787
306 Ga0207683_10031086 3300026121 Bacteria 4632
307 Ga0207698_10370252 3300026142 Bacteria 1360
308 Ga0209281_1000208 3300027111 Bacteria 132254
309 Ga0209995_1008821 3300027471 Bacteria 1629
310 Ga0210002_1008819 3300027617 Bacteria 1538
311 Ga0209282_1008636 3300027666 Bacteria 6432
312 Ga0268266_10000108 3300028379 Bacteria 171915
313 Ga0307517_10013924 3300028786 Bacteria 10867
314 Ga0307515_10002169 3300028794 Bacteria 43093
315 Ga0307515_10005018 3300028794 Bacteria 27006
316 Ga0307515_10018000 3300028794 Bacteria 12826
317 Ga0265338_10000426 3300028800 Bacteria 75561
318 Ga0265338_10018087 3300028800 Bacteria 7562
319 Ga0265338_10349436 3300028800 Bacteria 1064
320 Ga0316177_1174560 3300030731 Bacteria 5757
321 Ga0316176_1065149 3300030732 Bacteria 8417
322 Ga0316183_1026870 3300030742 Bacteria 28320
323 Ga0316181_1132579 3300030744 Bacteria 6848
324 Ga0316181_1146663 3300030744 Bacteria 1927
325 Ga0265327_10165183 3300031251 Bacteria 1020
326 Ga0307509_10086869 3300031507 Bacteria 3215
327 Ga0307408_100011490 3300031548 Bacteria 5850
328 Ga0307508_10382722 3300031616 Unclassified 998
329 Ga0316576_10112673 3300031727 Bacteria 2040
330 Ga0316576_10380793 3300031727 Unclassified 1047
331 Ga0307405_10000007 3300031731 Bacteria 348101
332 Ga0307405_10000124 3300031731 Bacteria 30625
333 Ga0316577_10201950 3300031733 Unclassified 1123
334 Ga0307413_10000047 3300031824 Bacteria 31403
335 Ga0307413_10220525 3300031824 Bacteria 1385
336 Ga0307413_10268435 3300031824 Bacteria 1276
337 Ga0307413_10447786 3300031824 Bacteria 1024
338 Ga0307410_10000498 3300031852 Bacteria 15986
339 Ga0307406_10000428 3300031901 Bacteria 24522
340 Ga0307407_10000024 3300031903 Bacteria 113716
341 Ga0307407_10099767 3300031903 Bacteria 1799
342 Ga0307412_10000004 3300031911 Bacteria 544053
343 Ga0307412_10058288 3300031911 Bacteria 2582
344 Ga0307412_10349977 3300031911 Bacteria 1186
345 Ga0307416_100000037 3300032002 Bacteria 137513
346 Ga0307416_100002685 3300032002 Bacteria 10299
347 Ga0307414_10000008 3300032004 Bacteria 375832
348 Ga0307414_10000477 3300032004 Bacteria 20980
349 Ga0307414_10001818 3300032004 Bacteria 11024
350 Ga0307414_10004346 3300032004 Bacteria 7693
351 Ga0307414_10007084 3300032004 Bacteria 6289
352 Ga0307414_10013073 3300032004 Unclassified 4932
353 Ga0307414_10023212 3300032004 Bacteria 3930
354 Ga0307414_10030748 3300032004 Bacteria 3512
355 Ga0307414_10062991 3300032004 Bacteria 2634
356 Ga0307414_10171439 3300032004 Bacteria 1735
357 Ga0307414_10293573 3300032004 Bacteria 1371
358 Ga0307414_10521648 3300032004 Bacteria 1054
359 Ga0307411_10000018 3300032005 Bacteria 87365
360 Ga0307411_10174124 3300032005 Bacteria 1626
361 Ga0307411_10757409 3300032005 Bacteria 851
362 Ga0307415_101583748 3300032126 Bacteria 629
363 Ga0307507_10001977 3300033179 Bacteria 44460
364 Ga0307510_10090109 3300033180 Bacteria 2915
365 Ga0307510_10150937 3300033180 Bacteria 1942
366 Ga0316574_0155368 3300035398 Bacteria 1474
367 Ga0316582_0499823 3300036647 Unclassified 838
368 Ga0316584_0111617 3300036712 Bacteria 2046
369 Ga0316584_0221352 3300036712 Unclassified 1390
370 Ga0316584_0551524 3300036712 Unclassified 804
371 Ga0395899_0000002 3300037312 Bacteria 1324310
372 Ga0395899_0000188 3300037312 Bacteria 90869
373 Ga0395899_0010961 3300037312 Bacteria 6944
374 Ga0395899_0181925 3300037312 Unclassified 1475
375 Ga0395900_0000585 3300037418 Bacteria 50049
376 Ga0395900_0000626 3300037418 Bacteria 47534
377 Ga0395900_0015607 3300037418 Bacteria 7742
378 Ga0395898_0043308 3300037466 Bacteria 4436
379 Ga0395898_0360507 3300037466 Unclassified 1386
380 Ga0395905_0001193 3300037471 Bacteria 32487
381 Ga0395905_0002631 3300037471 Bacteria 19712
382 Ga0395901_0031655 3300038443 Bacteria 5453
383 Ga0395901_0297398 3300038443 Bacteria 1674
384 Ga0395901_0349723 3300038443 Bacteria 1525
385 Ga0436361_0403331 3300039447 Bacteria 6009
386 Ga0439447_009371 3300041407 Bacteria 2974
387 Ga0439466_0006507 3300041411 Bacteria 4439
388 Ga0451791_1445779 3300041451 Bacteria 1263
389 Ga0451807_1142615 3300041486 Bacteria 854
390 Ga0451807_2130728 3300041486 Bacteria 744
391 Ga0451843_1767997 3300041509 Bacteria 830
392 Ga0451853_1911102 3300041512 Bacteria 801
393 Ga0439448_0010245 3300042005 Bacteria 2776
394 Ga0451577_0671563 3300042876 Bacteria 939
395 Ga0466969_0026824 3300044656 Bacteria 2953
396 Ga0453683_0505013 3300044673 Unclassified 785
397 Ga0466966_0029330 3300044684 Bacteria 3580
398 Ga0453684_0051748 3300044712 Bacteria 5379
399 Ga0453684_0740837 3300044712 Bacteria 1064
400 Ga0453684_0740838 3300044712 Bacteria 1064
401 Ga0495627_001886 3300046453 Bacteria 11038
402 Ga0495627_046942 3300046453 Bacteria 1311
403 Ga0495592_0142877 3300046454 Bacteria 1663
404 Ga0495638_0081990 3300046460 Bacteria 1957
405 Ga0495651_0012279 3300046462 Bacteria 6601
406 Ga0495650_0000003 3300046471 Bacteria 900730
407 Ga0495605_0313454 3300046474 Bacteria 662
408 Ga0495585_0000085 3300046492 Bacteria 97836
409 Ga0495585_0000987 3300046492 Bacteria 23846
410 Ga0495596_0010321 3300046500 Bacteria 4070
411 Ga0495607_0028814 3300046501 Bacteria 3421
412 Ga0495607_0241748 3300046501 Bacteria 873
413 Ga0495583_0025247 3300046506 Bacteria 2972
414 Ga0495606_0000002 3300046507 Bacteria 554637
415 Ga0495606_0023190 3300046507 Bacteria 4504
416 Ga0495606_0030236 3300046507 Bacteria 3787
417 Ga0495606_0064989 3300046507 Bacteria 2320
418 Ga0495606_0245554 3300046507 Bacteria 996
419 Ga0495610_0000045 3300046512 Bacteria 155304
420 Ga0495610_0000329 3300046512 Bacteria 50268
421 Ga0495610_0003788 3300046512 Bacteria 11533
422 Ga0495616_0009547 3300046513 Bacteria 5665
423 Ga0495616_0009694 3300046513 Bacteria 5614
424 Ga0495631_0280416 3300046518 Bacteria 709
425 Ga0495637_0192056 3300046520 Bacteria 753
426 Ga0495643_0000926 3300046522 Bacteria 30682
427 Ga0495648_0049471 3300046524 Bacteria 2576
428 Ga0495648_0158459 3300046524 Bacteria 1173
429 Ga0495663_0205356 3300046525 Bacteria 689
430 Ga0495652_0036168 3300046529 Bacteria 4295
431 Ga0495652_0149623 3300046529 Bacteria 1826
432 Ga0495654_0021203 3300046530 Bacteria 3382
433 Ga0495654_0142666 3300046530 Bacteria 1066
434 Ga0495609_0060352 3300046538 Bacteria 1677
435 Ga0495609_0075776 3300046538 Bacteria 1474
436 Ga0495622_0009833 3300046557 Bacteria 4423
437 Ga0495633_0000069 3300046558 Bacteria 135128
438 Ga0495633_0011918 3300046558 Bacteria 4652
439 Ga0495633_0211116 3300046558 Bacteria 890
440 Ga0495633_0281221 3300046558 Bacteria 757
441 Ga0495633_0282236 3300046558 Bacteria 755
442 Ga0495668_0000494 3300046616 Bacteria 49401
443 Ga0495668_0344928 3300046616 Bacteria 817
444 Ga0495625_0000005 3300046660 Bacteria 596135
445 Ga0495625_0001977 3300046660 Bacteria 23134
446 Ga0495625_0002443 3300046660 Bacteria 20078
447 Ga0495625_0011431 3300046660 Bacteria 7239
448 Ga0495625_0050925 3300046660 Bacteria 2970
449 Ga0495625_0075996 3300046660 Bacteria 2349
450 Ga0495625_0189258 3300046660 Bacteria 1364
451 Ga0495625_0236263 3300046660 Bacteria 1192
452 Ga0495625_0272163 3300046660 Bacteria 1092
453 Ga0495661_0000244 3300046665 Bacteria 62633
454 Ga0495661_0014157 3300046665 Bacteria 5343
455 Ga0495658_0039278 3300046683 Bacteria 2625
456 Ga0495649_0000003 3300046694 Bacteria 880817
457 Ga0495649_0178201 3300046694 Bacteria 1110
458 Ga0495687_000544 3300047443 Bacteria 45065
459 Ga0495687_003544 3300047443 Bacteria 11232
460 Ga0495679_100931 3300047446 Bacteria 801
461 Ga0495673_0045836 3300047469 Bacteria 1941
462 Ga0495681_0136822 3300047470 Bacteria 1038
463 Ga0495686_0002155 3300047472 Bacteria 19212
464 Ga0495686_0004123 3300047472 Bacteria 12092
465 Ga0495686_0033318 3300047472 Bacteria 3327
466 Ga0495593_0251599 3300047673 Bacteria 885
467 Ga0495614_0036596 3300048089 Bacteria 2107
468 Ga0496115_0053326 3300048918 Bacteria 3245
469 Ga0496115_1087424 3300048918 Bacteria 607
470 Ga0496116_0000004 3300048919 Bacteria 839841
471 Ga0496117_0187069 3300048920 Bacteria 1184
472 Ga0496121_0041253 3300048924 Bacteria 4037
473 Ga0496122_0001629 3300048925 Bacteria 35029
474 Ga0496122_0216696 3300048925 Bacteria 1103
475 Ga0496123_0000906 3300048926 Bacteria 46669
476 Ga0496124_0012715 3300048927 Bacteria 8277
477 Ga0496124_0149026 3300048927 Bacteria 1838
478 Ga0496124_0176774 3300048927 Bacteria 1647
479 Ga0496125_0000082 3300048928 Bacteria 227300
480 Ga0496125_0000382 3300048928 Bacteria 82312
481 Ga0496126_0009008 3300048929 Bacteria 10675
482 Ga0496126_0040007 3300048929 Bacteria 4348
483 Ga0496126_0435508 3300048929 Unclassified 1058
484 Ga0501238_000593 3300049671 Bacteria 4146
485 Ga0501249_000031 3300049679 Bacteria 75821
486 Ga0501249_003789 3300049679 Bacteria 3052
487 Ga0501249_032452 3300049679 Bacteria 1168
488 Ga0501241_003227 3300049758 Bacteria 3095
489 Ga0501266_000030 3300049763 Bacteria 42664
490 Ga0501269_003178 3300049766 Bacteria 1992
491 Ga0501269_035010 3300049766 Bacteria 655
492 Ga0501279_025313 3300049775 Bacteria 862
493 Ga0501280_000426 3300049776 Bacteria 10111
494 Ga0501044_0880296 3300049823 Bacteria 771
495 nmdc:mga0k408_1588_c1 3300050493 Bacteria 12290
496 nmdc:mga0k408_1866_c1 3300050493 Bacteria 11300
497 nmdc:mga0k408_46125_c1 3300050493 Bacteria 2516
498 nmdc:mga07m45_131171_c1 3300050496 Bacteria 1450
499 Ga0500635_0000304 3300053080 Bacteria 17218
500 Ga0500578_0168208 3300053086 Bacteria 1357
501 Ga0500646_0020861 3300053090 Bacteria 1743
502 Ga0500646_0041289 3300053090 Bacteria 1299
503 Ga0500651_0000207 3300053093 Bacteria 36951
504 Ga0500641_0000009 3300053096 Bacteria 173260
505 Ga0500641_0000101 3300053096 Bacteria 33256
506 Ga0500641_0000343 3300053096 Bacteria 17245
507 Ga0500608_000545 3300053122 Bacteria 14099
508 Ga0500608_022783 3300053122 Bacteria 2906
509 Ga0500614_032236 3300053123 Bacteria 1288
510 Ga0500618_000002 3300053125 Bacteria 370822
511 Ga0500618_014160 3300053125 Bacteria 2044
512 Ga0500658_0000061 3300053134 Bacteria 53519
513 Ga0500559_0207102 3300053136 Bacteria 925
514 Ga0500568_0097217 3300053139 Bacteria 1107
515 Ga0500573_0213043 3300053140 Bacteria 1018
516 Ga0500622_0001903 3300053156 Bacteria 15749
517 Ga0500622_0050194 3300053156 Bacteria 2150
518 Ga0500622_0105960 3300053156 Bacteria 1379
519 Ga0500624_000771 3300053157 Bacteria 7663
520 Ga0500584_073873 3300053726 Bacteria 1480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046558 Ga0495633_0282236 Ga0495633_0282236_13_468 150
2 3300003187 JGI25151J46595_10000003 JGI25151J46595_10000003416 151
3 3300003215 JGI25153J46596_10000003 JGI25153J46596_10000003248 151
4 3300005288 Ga0065714_10084878 Ga0065714_100848783 151
5 3300017792 Ga0163161_10000046 Ga0163161_1000004695 151
6 3300032004 Ga0307414_10007084 Ga0307414_100070845 151
7 iso_pu_bacteria 2738541283 2738754288 163
8 3300017792 Ga0163161_10000572 Ga0163161_1000057216 165
9 3300031824 Ga0307413_10447786 Ga0307413_104477862 165
10 3300031911 Ga0307412_10349977 Ga0307412_103499772 165
11 3300005288 Ga0065714_10149660 Ga0065714_101496602 166
12 3300017792 Ga0163161_10001264 Ga0163161_1000126414 167
13 3300025914 Ga0207671_10094594 Ga0207671_100945943 167
14 3300046558 Ga0495633_0281221 Ga0495633_0281221_182_709 169
15 3300053140 Ga0500573_0213043 Ga0500573_0213043_433_960 169
16 iso_pu_bacteria 2902048731 2902053047 171
17 iso_pu_bacteria 2585427687 2586210440 172
18 iso_pu_bacteria 2599185184 2599477964 172
19 iso_pu_bacteria 2818991437 2819548431 172
20 iso_pu_bacteria 2842722452 2842723005 172
21 iso_pu_bacteria 2842909656 2842913961 172
22 iso_pu_bacteria 2884933994 2884937277 172
23 iso_pu_bacteria 2890737413 2890741057 172
24 iso_pu_bacteria 2898713307 2898715061 172
25 iso_pu_bacteria 2928078545 2928079925 172
26 iso_pu_bacteria 2928147474 2928147620 172
27 iso_pu_bacteria 2932082852 2932083622 172
28 iso_pu_bacteria 2945997725 2945999972 172
29 iso_pu_bacteria 8055588893 8055589126 172
30 iso_pu_bacteria 2738541302 2738855766 173
31 iso_pu_bacteria 2738543023 2739301646 173
32 iso_pu_bacteria 2739367651 2739590181 173
33 iso_pu_bacteria 2739367663 2739644406 173
34 iso_pu_bacteria 2842903701 2842906757 173
35 iso_pu_bacteria 2849281842 2849283702 173
36 iso_pu_bacteria 2852627209 2852627683 173
37 iso_pu_bacteria 2895498888 2895502786 173
38 iso_pu_bacteria 2904445276 2904449544 173
39 iso_pu_bacteria 2919186247 2919187854 173
40 iso_pu_bacteria 2939664404 2939664879 173
41 iso_pu_bacteria 2954016120 2954016578 173
42 3300027471 Ga0209995_1008821 Ga0209995_10088212 174
43 3300027617 Ga0210002_1008819 Ga0210002_10088192 174
44 iso_pu_bacteria 2739367656 2739615400 174
45 iso_pu_bacteria 2775506987 2776614554 174
46 3300005339 Ga0070660_100284506 Ga0070660_1002845062 175
47 3300005366 Ga0070659_100001238 Ga0070659_10000123821 175
48 3300013296 Ga0157374_10059021 Ga0157374_100590212 175
49 3300025919 Ga0207657_10348612 Ga0207657_103486122 175
50 3300025932 Ga0207690_10000943 Ga0207690_100009436 175
51 3300031727 Ga0316576_10380793 Ga0316576_103807932 175
52 3300031733 Ga0316577_10201950 Ga0316577_102019501 175
53 3300032004 Ga0307414_10013073 Ga0307414_100130732 175
54 3300036647 Ga0316582_0499823 Ga0316582_0499823_261_791 175
55 3300036712 Ga0316584_0221352 Ga0316584_0221352_28_558 175
56 3300036712 Ga0316584_0551524 Ga0316584_0551524_10_540 175
57 iso_pu_bacteria 2738541284 2738762946 175
58 iso_pu_bacteria 2857627736 2857630172 175
59 3300001979 JGI24740J21852_10026945 JGI24740J21852_100269452 176
60 3300001989 JGI24739J22299_10021822 JGI24739J22299_100218222 176
61 3300001989 JGI24739J22299_10082971 JGI24739J22299_100829712 176
62 3300001990 JGI24737J22298_10002356 JGI24737J22298_100023564 176
63 3300002067 JGI24735J21928_10000050 JGI24735J21928_100000506 176
64 3300002737 JGI25162J39368_1000516 JGI25162J39368_100051623 176
65 3300002772 JGI25164J39214_1002379 JGI25164J39214_10023793 176
66 3300003214 JGI25165J46597_1000420 JGI25165J46597_100042017 176
67 3300003214 JGI25165J46597_1012298 JGI25165J46597_10122981 176
68 3300003316 rootH1_10040717 rootH1_100407176 176
69 3300003320 rootH2_10009001 rootH2_100090016 176
70 3300003320 rootH2_10116182 rootH2_101161822 176
71 3300003323 rootH1_10016880 rootH1_100168809 176
72 3300003323 rootH1_10019100 rootH1_100191005 176
73 3300003323 rootH1_10203603 rootH1_102036035 176
74 3300003323 rootH1_10393646 rootH1_103936462 176
75 3300005288 Ga0065714_10009665 Ga0065714_100096653 176
76 3300005288 Ga0065714_10065634 Ga0065714_1006563411 176
77 3300005288 Ga0065714_10071503 Ga0065714_100715036 176
78 3300005339 Ga0070660_100134812 Ga0070660_1001348122 176
79 3300005366 Ga0070659_100001469 Ga0070659_1000014697 176
80 3300005539 Ga0068853_100350492 Ga0068853_1003504922 176
81 3300005548 Ga0070665_100220035 Ga0070665_1002200352 176
82 3300005563 Ga0068855_100056124 Ga0068855_1000561246 176
83 3300005577 Ga0068857_100633352 Ga0068857_1006333522 176
84 3300005577 Ga0068857_101076202 Ga0068857_1010762022 176
85 3300005614 Ga0068856_100126211 Ga0068856_1001262112 176
86 3300005614 Ga0068856_100544127 Ga0068856_1005441272 176
87 3300006028 Ga0070717_11385065 Ga0070717_113850651 176
88 3300006195 Ga0075366_10049384 Ga0075366_100493842 176
89 3300009036 Ga0105244_10051568 Ga0105244_100515682 176
90 3300009093 Ga0105240_10051774 Ga0105240_100517744 176
91 3300009093 Ga0105240_10067695 Ga0105240_100676953 176
92 3300009093 Ga0105240_10095167 Ga0105240_100951672 176
93 3300009093 Ga0105240_11065332 Ga0105240_110653322 176
94 3300009174 Ga0105241_10098513 Ga0105241_100985132 176
95 3300009174 Ga0105241_10116979 Ga0105241_101169792 176
96 3300009174 Ga0105241_10770142 Ga0105241_107701421 176
97 3300009545 Ga0105237_10031639 Ga0105237_100316395 176
98 3300009545 Ga0105237_10060104 Ga0105237_100601044 176
99 3300009551 Ga0105238_10227582 Ga0105238_102275822 176
100 3300010375 Ga0105239_10000005 Ga0105239_10000005438 176
101 3300010375 Ga0105239_10000010 Ga0105239_10000010108 176
102 3300010375 Ga0105239_10007450 Ga0105239_100074504 176
103 3300010375 Ga0105239_10073058 Ga0105239_100730582 176
104 3300013100 Ga0157373_10013397 Ga0157373_100133973 176
105 3300013100 Ga0157373_10692949 Ga0157373_106929491 176
106 3300013102 Ga0157371_10000119 Ga0157371_1000011940 176
107 3300013102 Ga0157371_10001189 Ga0157371_100011892 176
108 3300013102 Ga0157371_10055034 Ga0157371_100550344 176
109 3300013104 Ga0157370_10296713 Ga0157370_102967131 176
110 3300013105 Ga0157369_10046288 Ga0157369_100462884 176
111 3300013105 Ga0157369_10095996 Ga0157369_100959962 176
112 3300013105 Ga0157369_10424963 Ga0157369_104249631 176
113 3300013306 Ga0163162_10002037 Ga0163162_1000203716 176
114 3300013306 Ga0163162_10045474 Ga0163162_100454742 176
115 3300013307 Ga0157372_10000743 Ga0157372_1000074318 176
116 3300025231 Ga0207427_100173 Ga0207427_10017338 176
117 3300025233 Ga0209437_100008 Ga0209437_100008694 176
118 3300025261 Ga0209233_1000158 Ga0209233_100015884 176
119 3300025261 Ga0209233_1002917 Ga0209233_10029172 176
120 3300025272 Ga0209455_1003455 Ga0209455_10034551 176
121 3300025728 Ga0207655_1081029 Ga0207655_10810292 176
122 3300025904 Ga0207647_10204955 Ga0207647_102049552 176
123 3300025911 Ga0207654_10427108 Ga0207654_104271081 176
124 3300025913 Ga0207695_10048396 Ga0207695_100483963 176
125 3300025913 Ga0207695_10093694 Ga0207695_100936945 176
126 3300025913 Ga0207695_10388550 Ga0207695_103885502 176
127 3300025914 Ga0207671_10027072 Ga0207671_100270722 176
128 3300025914 Ga0207671_10049251 Ga0207671_100492512 176
129 3300025932 Ga0207690_10013014 Ga0207690_100130145 176
130 3300025949 Ga0207667_10039499 Ga0207667_100394994 176
131 3300026041 Ga0207639_10309051 Ga0207639_103090512 176
132 3300026078 Ga0207702_10372474 Ga0207702_103724742 176
133 3300026078 Ga0207702_11573149 Ga0207702_115731491 176
134 3300026116 Ga0207674_11042107 Ga0207674_110421072 176
135 3300031507 Ga0307509_10086869 Ga0307509_100868694 176
136 3300031731 Ga0307405_10000124 Ga0307405_1000012414 176
137 3300037418 Ga0395900_0000585 Ga0395900_0000585_25150_25683 176
138 3300038443 Ga0395901_0297398 Ga0395901_0297398_1027_1560 176
139 3300041509 Ga0451843_1767997 Ga0451843_1767997_46_651 176
140 3300044712 Ga0453684_0051748 Ga0453684_0051748_461_994 176
141 3300046453 Ga0495627_046942 Ga0495627_046942_731_1264 176
142 3300046460 Ga0495638_0081990 Ga0495638_0081990_1286_1822 176
143 3300046462 Ga0495651_0012279 Ga0495651_0012279_3481_4014 176
144 3300046471 Ga0495650_0000003 Ga0495650_0000003_187862_188398 176
145 3300046492 Ga0495585_0000085 Ga0495585_0000085_97208_97744 176
146 3300046506 Ga0495583_0025247 Ga0495583_0025247_2409_2945 176
147 3300046507 Ga0495606_0000002 Ga0495606_0000002_530223_530759 176
148 3300046512 Ga0495610_0003788 Ga0495610_0003788_10681_11217 176
149 3300046513 Ga0495616_0009694 Ga0495616_0009694_4524_5060 176
150 3300046525 Ga0495663_0205356 Ga0495663_0205356_80_613 176
151 3300046529 Ga0495652_0036168 Ga0495652_0036168_3232_3765 176
152 3300046529 Ga0495652_0149623 Ga0495652_0149623_163_699 176
153 3300046558 Ga0495633_0011918 Ga0495633_0011918_1414_1950 176
154 3300046660 Ga0495625_0000005 Ga0495625_0000005_304866_305402 176
155 3300046665 Ga0495661_0014157 Ga0495661_0014157_2311_2847 176
156 3300046694 Ga0495649_0000003 Ga0495649_0000003_304854_305390 176
157 3300047443 Ga0495687_000544 Ga0495687_000544_29070_29606 176
158 3300047446 Ga0495679_100931 Ga0495679_100931_103_639 176
159 3300047469 Ga0495673_0045836 Ga0495673_0045836_104_640 176
160 3300047470 Ga0495681_0136822 Ga0495681_0136822_54_587 176
161 3300049679 Ga0501249_032452 Ga0501249_032452_188_721 176
162 3300049775 Ga0501279_025313 Ga0501279_025313_65_598 176
163 3300049823 Ga0501044_0880296 Ga0501044_0880296_152_685 176
164 3300050493 nmdc:mga0k408_46125_c1 nmdc:mga0k408_46125_c1_1287_1823 176
165 3300053080 Ga0500635_0000304 Ga0500635_0000304_6285_6818 176
166 3300053125 Ga0500618_000002 Ga0500618_000002_199783_200319 176
167 3300053125 Ga0500618_014160 Ga0500618_014160_1241_1777 176
168 3300053156 Ga0500622_0105960 Ga0500622_0105960_711_1247 176
169 iso_pu_bacteria 2852623160 2852623820 176
170 3300001991 JGI24743J22301_10047552 JGI24743J22301_100475522 177
171 3300002737 JGI25162J39368_1000011 JGI25162J39368_1000011165 177
172 3300002773 JGI25152J39213_1000476 JGI25152J39213_100047621 177
173 3300002774 JGI25150J39212_1000002 JGI25150J39212_1000002242 177
174 3300003320 rootH2_10050636 rootH2_100506363 177
175 3300003322 rootL2_10055142 rootL2_100551422 177
176 3300003323 rootH1_10102135 rootH1_101021357 177
177 3300003323 rootH1_10164698 rootH1_101646983 177
178 3300003781 Ga0055536_1000049 Ga0055536_100004964 177
179 3300003791 Ga0055530_10002714 Ga0055530_100027147 177
180 3300005327 Ga0070658_10312656 Ga0070658_103126562 177
181 3300005355 Ga0070671_100011353 Ga0070671_1000113535 177
182 3300005365 Ga0070688_100526304 Ga0070688_1005263042 177
183 3300005539 Ga0068853_100147195 Ga0068853_1001471954 177
184 3300005548 Ga0070665_100000104 Ga0070665_100000104113 177
185 3300005563 Ga0068855_100000048 Ga0068855_10000004830 177
186 3300005563 Ga0068855_100001222 Ga0068855_10000122227 177
187 3300005563 Ga0068855_100025513 Ga0068855_1000255138 177
188 3300005563 Ga0068855_100672322 Ga0068855_1006723221 177
189 3300005577 Ga0068857_100327186 Ga0068857_1003271863 177
190 3300005614 Ga0068856_100161081 Ga0068856_1001610812 177
191 3300006195 Ga0075366_10005129 Ga0075366_100051292 177
192 3300006195 Ga0075366_10748565 Ga0075366_107485651 177
193 3300009093 Ga0105240_10000193 Ga0105240_1000019362 177
194 3300009093 Ga0105240_10003500 Ga0105240_100035003 177
195 3300009093 Ga0105240_10036495 Ga0105240_100364953 177
196 3300009093 Ga0105240_10676418 Ga0105240_106764181 177
197 3300009545 Ga0105237_10000417 Ga0105237_1000041720 177
198 3300010375 Ga0105239_10000482 Ga0105239_1000048225 177
199 3300010375 Ga0105239_10006733 Ga0105239_1000673310 177
200 3300013100 Ga0157373_10006545 Ga0157373_100065457 177
201 3300013100 Ga0157373_10087836 Ga0157373_100878362 177
202 3300013104 Ga0157370_10051173 Ga0157370_100511736 177
203 3300013104 Ga0157370_10260512 Ga0157370_102605122 177
204 3300013104 Ga0157370_10378736 Ga0157370_103787362 177
205 3300013105 Ga0157369_10000015 Ga0157369_1000001577 177
206 3300013306 Ga0163162_10000034 Ga0163162_1000003475 177
207 3300013306 Ga0163162_10000520 Ga0163162_1000052035 177
208 3300013307 Ga0157372_10074067 Ga0157372_100740674 177
209 3300013308 Ga0157375_10065996 Ga0157375_100659963 177
210 3300013308 Ga0157375_10225483 Ga0157375_102254831 177
211 3300014497 Ga0182008_10001023 Ga0182008_100010234 177
212 3300015261 Ga0182006_1000091 Ga0182006_100009157 177
213 3300015261 Ga0182006_1000352 Ga0182006_10003524 177
214 3300015262 Ga0182007_10000010 Ga0182007_10000010137 177
215 3300015682 Ga0183373_1005 Ga0183373_1005279 177
216 3300017792 Ga0163161_10003880 Ga0163161_100038801 177
217 3300017792 Ga0163161_10019645 Ga0163161_100196452 177
218 3300025233 Ga0209437_100017 Ga0209437_100017328 177
219 3300025245 Ga0207425_1000004 Ga0207425_1000004703 177
220 3300025258 Ga0209129_1000005 Ga0209129_1000005239 177
221 3300025261 Ga0209233_1011239 Ga0209233_10112393 177
222 3300025292 Ga0209676_1000001 Ga0209676_100000134 177
223 3300025294 Ga0209025_1000009 Ga0209025_1000009703 177
224 3300025297 Ga0209758_1000010 Ga0209758_1000010704 177
225 3300025298 Ga0209050_1000258 Ga0209050_100025865 177
226 3300025912 Ga0207707_10383124 Ga0207707_103831242 177
227 3300025913 Ga0207695_10000013 Ga0207695_10000013193 177
228 3300025913 Ga0207695_10007902 Ga0207695_100079027 177
229 3300025914 Ga0207671_10009833 Ga0207671_100098333 177
230 3300025917 Ga0207660_10014064 Ga0207660_100140644 177
231 3300025933 Ga0207706_10623540 Ga0207706_106235402 177
232 3300025949 Ga0207667_10000023 Ga0207667_10000023126 177
233 3300025949 Ga0207667_10000956 Ga0207667_1000095616 177
234 3300025949 Ga0207667_10038291 Ga0207667_100382912 177
235 3300026041 Ga0207639_10122002 Ga0207639_101220024 177
236 3300028379 Ga0268266_10000108 Ga0268266_10000108108 177
237 3300028786 Ga0307517_10013924 Ga0307517_100139242 177
238 3300028800 Ga0265338_10000426 Ga0265338_1000042622 177
239 3300028800 Ga0265338_10018087 Ga0265338_100180873 177
240 3300030731 Ga0316177_1174560 Ga0316177_11745606 177
241 3300030732 Ga0316176_1065149 Ga0316176_10651493 177
242 3300030742 Ga0316183_1026870 Ga0316183_102687015 177
243 3300030744 Ga0316181_1132579 Ga0316181_11325795 177
244 3300031903 Ga0307407_10000024 Ga0307407_100000246 177
245 3300032002 Ga0307416_100000037 Ga0307416_10000003727 177
246 3300032004 Ga0307414_10030748 Ga0307414_100307482 177
247 3300032004 Ga0307414_10171439 Ga0307414_101714391 177
248 3300032126 Ga0307415_101583748 Ga0307415_1015837481 177
249 3300033179 Ga0307507_10001977 Ga0307507_1000197713 177
250 3300037312 Ga0395899_0000002 Ga0395899_0000002_1275127_1275663 177
251 3300041512 Ga0451853_1911102 Ga0451853_1911102_154_690 177
252 3300046474 Ga0495605_0313454 Ga0495605_0313454_74_610 177
253 3300046507 Ga0495606_0023190 Ga0495606_0023190_2356_2895 177
254 3300046507 Ga0495606_0030236 Ga0495606_0030236_2879_3418 177
255 3300046507 Ga0495606_0245554 Ga0495606_0245554_308_844 177
256 3300046512 Ga0495610_0000045 Ga0495610_0000045_43444_43980 177
257 3300046512 Ga0495610_0000329 Ga0495610_0000329_33105_33641 177
258 3300046520 Ga0495637_0192056 Ga0495637_0192056_81_620 177
259 3300046538 Ga0495609_0060352 Ga0495609_0060352_951_1490 177
260 3300046660 Ga0495625_0002443 Ga0495625_0002443_3917_4456 177
261 3300047472 Ga0495686_0002155 Ga0495686_0002155_415_951 177
262 3300049766 Ga0501269_035010 Ga0501269_035010_89_625 177
263 3300050493 nmdc:mga0k408_1588_c1 nmdc:mga0k408_1588_c1_176_715 177
264 3300050496 nmdc:mga07m45_131171_c1 nmdc:mga07m45_131171_c1_671_1207 177
265 3300053156 Ga0500622_0001903 Ga0500622_0001903_9533_10069 177
266 iso_pu_bacteria 2919437846 2919440746 177
267 2162886007 SwRhRL2b_contig_2896220 SwRhRL2b_0742.00000980 178
268 2162886007 SwRhRL2b_contig_475676 SwRhRL2b_0167.00008620 178
269 3300003316 rootH1_10162791 rootH1_101627911 178
270 3300003320 rootH2_10002871 rootH2_1000287114 178
271 3300005288 Ga0065714_10002298 Ga0065714_1000229826 178
272 3300005289 Ga0065704_10000205 Ga0065704_1000020512 178
273 3300005289 Ga0065704_10001103 Ga0065704_100011037 178
274 3300005328 Ga0070676_10001044 Ga0070676_100010443 178
275 3300005456 Ga0070678_100023213 Ga0070678_1000232133 178
276 3300005563 Ga0068855_100047574 Ga0068855_1000475742 178
277 3300005834 Ga0068851_10424688 Ga0068851_104246881 178
278 3300009093 Ga0105240_10323754 Ga0105240_103237542 178
279 3300009148 Ga0105243_10648231 Ga0105243_106482312 178
280 3300009174 Ga0105241_10006942 Ga0105241_100069427 178
281 3300009174 Ga0105241_10358166 Ga0105241_103581662 178
282 3300009176 Ga0105242_10358106 Ga0105242_103581062 178
283 3300009545 Ga0105237_10022631 Ga0105237_100226315 178
284 3300009545 Ga0105237_10024656 Ga0105237_100246562 178
285 3300010375 Ga0105239_10010744 Ga0105239_1001074411 178
286 3300013100 Ga0157373_10000974 Ga0157373_1000097419 178
287 3300013102 Ga0157371_10001476 Ga0157371_1000147620 178
288 3300013102 Ga0157371_10010487 Ga0157371_100104872 178
289 3300013104 Ga0157370_10056450 Ga0157370_100564503 178
290 3300013104 Ga0157370_10091869 Ga0157370_100918693 178
291 3300013308 Ga0157375_10115254 Ga0157375_101152542 178
292 3300015261 Ga0182006_1018008 Ga0182006_10180082 178
293 3300017792 Ga0163161_10044315 Ga0163161_100443154 178
294 3300017792 Ga0163161_10533666 Ga0163161_105336661 178
295 3300021361 Ga0213872_10021740 Ga0213872_100217403 178
296 3300025907 Ga0207645_10000167 Ga0207645_1000016728 178
297 3300025911 Ga0207654_10010192 Ga0207654_100101925 178
298 3300025913 Ga0207695_10810033 Ga0207695_108100331 178
299 3300025914 Ga0207671_10011935 Ga0207671_100119355 178
300 3300025914 Ga0207671_10196739 Ga0207671_101967392 178
301 3300025935 Ga0207709_10760726 Ga0207709_107607261 178
302 3300025938 Ga0207704_10000062 Ga0207704_1000006257 178
303 3300025949 Ga0207667_10199473 Ga0207667_101994732 178
304 3300028794 Ga0307515_10018000 Ga0307515_1001800012 178
305 3300030744 Ga0316181_1146663 Ga0316181_11466633 178
306 3300031616 Ga0307508_10382722 Ga0307508_103827222 178
307 3300031727 Ga0316576_10112673 Ga0316576_101126732 178
308 3300031911 Ga0307412_10000004 Ga0307412_10000004368 178
309 3300032004 Ga0307414_10000477 Ga0307414_100004779 178
310 3300032004 Ga0307414_10023212 Ga0307414_100232126 178
311 3300032004 Ga0307414_10062991 Ga0307414_100629913 178
312 3300037312 Ga0395899_0010961 Ga0395899_0010961_1594_2133 178
313 3300037418 Ga0395900_0000626 Ga0395900_0000626_21954_22493 178
314 3300037466 Ga0395898_0043308 Ga0395898_0043308_2553_3092 178
315 3300037471 Ga0395905_0001193 Ga0395905_0001193_31676_32215 178
316 3300038443 Ga0395901_0349723 Ga0395901_0349723_529_1068 178
317 3300039447 Ga0436361_0403331 Ga0436361_0403331_983_1522 178
318 3300042005 Ga0439448_0010245 Ga0439448_0010245_864_1403 178
319 3300046454 Ga0495592_0142877 Ga0495592_0142877_350_889 178
320 3300046513 Ga0495616_0009547 Ga0495616_0009547_1591_2133 178
321 3300046518 Ga0495631_0280416 Ga0495631_0280416_65_604 178
322 3300046660 Ga0495625_0075996 Ga0495625_0075996_362_904 178
323 3300046665 Ga0495661_0000244 Ga0495661_0000244_45181_45723 178
324 3300047472 Ga0495686_0033318 Ga0495686_0033318_1162_1704 178
325 3300048929 Ga0496126_0435508 Ga0496126_0435508_230_772 178
326 3300049758 Ga0501241_003227 Ga0501241_003227_2071_2613 178
327 3300053093 Ga0500651_0000207 Ga0500651_0000207_6520_7062 178
328 3300053122 Ga0500608_000545 Ga0500608_000545_13024_13563 178
329 3300053139 Ga0500568_0097217 Ga0500568_0097217_37_579 178
330 3300002741 JGI25157J39369_1002605 JGI25157J39369_10026052 179
331 3300003323 rootH1_10218449 rootH1_102184496 179
332 3300005288 Ga0065714_10002621 Ga0065714_1000262115 179
333 3300005288 Ga0065714_10021565 Ga0065714_100215651 179
334 3300005288 Ga0065714_10144305 Ga0065714_101443051 179
335 3300005327 Ga0070658_10000047 Ga0070658_1000004731 179
336 3300005327 Ga0070658_10134238 Ga0070658_101342383 179
337 3300005329 Ga0070683_100017009 Ga0070683_1000170093 179
338 3300005535 Ga0070684_100130788 Ga0070684_1001307882 179
339 3300005614 Ga0068856_100390907 Ga0068856_1003909072 179
340 3300009545 Ga0105237_10004270 Ga0105237_100042707 179
341 3300009545 Ga0105237_10124945 Ga0105237_101249452 179
342 3300009551 Ga0105238_10446122 Ga0105238_104461222 179
343 3300010375 Ga0105239_10035975 Ga0105239_100359753 179
344 3300013100 Ga0157373_10000188 Ga0157373_1000018835 179
345 3300013104 Ga0157370_10004633 Ga0157370_1000463310 179
346 3300013104 Ga0157370_10014232 Ga0157370_100142326 179
347 3300013296 Ga0157374_10250668 Ga0157374_102506681 179
348 3300013307 Ga0157372_10000458 Ga0157372_1000045831 179
349 3300014497 Ga0182008_10000069 Ga0182008_1000006959 179
350 3300014497 Ga0182008_10000247 Ga0182008_1000024710 179
351 3300014497 Ga0182008_10011758 Ga0182008_100117585 179
352 3300014497 Ga0182008_10043944 Ga0182008_100439442 179
353 3300014497 Ga0182008_10121860 Ga0182008_101218603 179
354 3300015261 Ga0182006_1000210 Ga0182006_100021042 179
355 3300015261 Ga0182006_1009379 Ga0182006_10093793 179
356 3300015262 Ga0182007_10013273 Ga0182007_100132733 179
357 3300015262 Ga0182007_10081480 Ga0182007_100814802 179
358 3300025250 Ga0209026_1001114 Ga0209026_100111410 179
359 3300025250 Ga0209026_1001326 Ga0209026_10013263 179
360 3300025250 Ga0209026_1036216 Ga0209026_10362161 179
361 3300025909 Ga0207705_10000052 Ga0207705_1000005231 179
362 3300025914 Ga0207671_10275509 Ga0207671_102755092 179
363 3300025924 Ga0207694_10335899 Ga0207694_103358992 179
364 3300025944 Ga0207661_10041014 Ga0207661_100410142 179
365 3300026078 Ga0207702_10017728 Ga0207702_100177282 179
366 3300028794 Ga0307515_10005018 Ga0307515_1000501820 179
367 3300031251 Ga0265327_10165183 Ga0265327_101651831 179
368 3300032004 Ga0307414_10004346 Ga0307414_100043462 179
369 3300037312 Ga0395899_0181925 Ga0395899_0181925_733_1275 179
370 3300037418 Ga0395900_0015607 Ga0395900_0015607_3296_3838 179
371 3300037466 Ga0395898_0360507 Ga0395898_0360507_492_1034 179
372 3300037471 Ga0395905_0002631 Ga0395905_0002631_14199_14741 179
373 3300038443 Ga0395901_0031655 Ga0395901_0031655_2461_3003 179
374 3300042876 Ga0451577_0671563 Ga0451577_0671563_152_700 179
375 3300044712 Ga0453684_0740837 Ga0453684_0740837_17_565 179
376 3300044712 Ga0453684_0740838 Ga0453684_0740838_17_565 179
377 3300046507 Ga0495606_0064989 Ga0495606_0064989_76_621 179
378 3300046524 Ga0495648_0158459 Ga0495648_0158459_373_918 179
379 3300046558 Ga0495633_0211116 Ga0495633_0211116_67_612 179
380 3300046616 Ga0495668_0344928 Ga0495668_0344928_158_703 179
381 3300046660 Ga0495625_0011431 Ga0495625_0011431_5992_6537 179
382 3300047443 Ga0495687_003544 Ga0495687_003544_3885_4427 179
383 3300048925 Ga0496122_0001629 Ga0496122_0001629_2292_2837 179
384 3300048926 Ga0496123_0000906 Ga0496123_0000906_43449_43994 179
385 3300001990 JGI24737J22298_10014539 JGI24737J22298_100145394 180
386 3300005338 Ga0068868_101601470 Ga0068868_1016014701 180
387 3300005339 Ga0070660_100020897 Ga0070660_1000208972 180
388 3300005364 Ga0070673_100006628 Ga0070673_1000066281 180
389 3300005366 Ga0070659_100013744 Ga0070659_1000137449 180
390 3300005457 Ga0070662_100000252 Ga0070662_10000025211 180
391 3300005459 Ga0068867_100001529 Ga0068867_1000015295 180
392 3300005563 Ga0068855_100097760 Ga0068855_1000977604 180
393 3300005616 Ga0068852_100448800 Ga0068852_1004488002 180
394 3300006237 Ga0097621_100001962 Ga0097621_10000196214 180
395 3300009093 Ga0105240_10258173 Ga0105240_102581732 180
396 3300009174 Ga0105241_10000898 Ga0105241_100008987 180
397 3300009545 Ga0105237_10600872 Ga0105237_106008722 180
398 3300009551 Ga0105238_10156718 Ga0105238_101567182 180
399 3300010375 Ga0105239_10074992 Ga0105239_100749922 180
400 3300011119 Ga0105246_10096396 Ga0105246_100963961 180
401 3300013100 Ga0157373_10025041 Ga0157373_100250413 180
402 3300013102 Ga0157371_10048158 Ga0157371_100481581 180
403 3300013105 Ga0157369_10234111 Ga0157369_102341112 180
404 3300013296 Ga0157374_10000408 Ga0157374_1000040827 180
405 3300013296 Ga0157374_10000618 Ga0157374_1000061825 180
406 3300013296 Ga0157374_10008291 Ga0157374_100082916 180
407 3300013297 Ga0157378_10199245 Ga0157378_101992452 180
408 3300013307 Ga0157372_10023113 Ga0157372_100231133 180
409 3300013308 Ga0157375_10164366 Ga0157375_101643662 180
410 3300014745 Ga0157377_10002282 Ga0157377_100022825 180
411 3300015262 Ga0182007_10060178 Ga0182007_100601782 180
412 3300025904 Ga0207647_10000514 Ga0207647_1000051411 180
413 3300025911 Ga0207654_10017804 Ga0207654_100178041 180
414 3300025911 Ga0207654_10022742 Ga0207654_100227423 180
415 3300025913 Ga0207695_10211523 Ga0207695_102115232 180
416 3300025914 Ga0207671_10022792 Ga0207671_100227923 180
417 3300025914 Ga0207671_10437891 Ga0207671_104378912 180
418 3300025919 Ga0207657_10026036 Ga0207657_100260365 180
419 3300025932 Ga0207690_10047335 Ga0207690_100473351 180
420 3300025933 Ga0207706_10000844 Ga0207706_1000084424 180
421 3300025934 Ga0207686_10015969 Ga0207686_100159692 180
422 3300025949 Ga0207667_10088364 Ga0207667_100883644 180
423 3300026023 Ga0207677_10983154 Ga0207677_109831541 180
424 3300026089 Ga0207648_10000294 Ga0207648_1000029417 180
425 3300026121 Ga0207683_10031086 Ga0207683_100310864 180
426 3300026142 Ga0207698_10370252 Ga0207698_103702522 180
427 3300028800 Ga0265338_10349436 Ga0265338_103494362 180
428 3300033180 Ga0307510_10150937 Ga0307510_101509372 180
429 3300046660 Ga0495625_0236263 Ga0495625_0236263_501_1046 180
430 3300046694 Ga0495649_0178201 Ga0495649_0178201_232_777 180
431 3300047673 Ga0495593_0251599 Ga0495593_0251599_141_746 180
432 3300048918 Ga0496115_1087424 Ga0496115_1087424_13_558 180
433 3300053096 Ga0500641_0000343 Ga0500641_0000343_7243_7845 180
434 3300053157 Ga0500624_000771 Ga0500624_000771_7030_7578 180
435 iso_pu_bacteria 2977232053 2977235903 180
436 3300005288 Ga0065714_10007462 Ga0065714_100074624 181
437 3300013306 Ga0163162_11178684 Ga0163162_111786842 181
438 3300028794 Ga0307515_10002169 Ga0307515_1000216917 181
439 3300033180 Ga0307510_10090109 Ga0307510_100901092 181
440 3300035398 Ga0316574_0155368 Ga0316574_0155368_492_1040 181
441 3300036712 Ga0316584_0111617 Ga0316584_0111617_187_735 181
442 3300044673 Ga0453683_0505013 Ga0453683_0505013_185_733 181
443 3300046492 Ga0495585_0000987 Ga0495585_0000987_6481_7032 181
444 3300046501 Ga0495607_0241748 Ga0495607_0241748_223_774 181
445 3300046524 Ga0495648_0049471 Ga0495648_0049471_681_1232 181
446 3300046530 Ga0495654_0021203 Ga0495654_0021203_1695_2246 181
447 3300046538 Ga0495609_0075776 Ga0495609_0075776_136_687 181
448 3300046557 Ga0495622_0009833 Ga0495622_0009833_2326_2877 181
449 3300046558 Ga0495633_0000069 Ga0495633_0000069_18087_18638 181
450 3300046616 Ga0495668_0000494 Ga0495668_0000494_7352_7903 181
451 3300046660 Ga0495625_0001977 Ga0495625_0001977_13974_14525 181
452 3300046660 Ga0495625_0050925 Ga0495625_0050925_2335_2886 181
453 3300046660 Ga0495625_0272163 Ga0495625_0272163_189_740 181
454 3300046683 Ga0495658_0039278 Ga0495658_0039278_1152_1703 181
455 3300047472 Ga0495686_0004123 Ga0495686_0004123_6378_6929 181
456 3300048089 Ga0495614_0036596 Ga0495614_0036596_241_792 181
457 3300053122 Ga0500608_022783 Ga0500608_022783_448_999 181
458 3300053123 Ga0500614_032236 Ga0500614_032236_612_1163 181
459 3300005288 Ga0065714_10229307 Ga0065714_102293072 182
460 3300013102 Ga0157371_10002382 Ga0157371_1000238211 182
461 3300013104 Ga0157370_10086945 Ga0157370_100869453 182
462 3300013105 Ga0157369_10000853 Ga0157369_1000085314 182
463 3300013307 Ga0157372_10000011 Ga0157372_10000011156 182
464 3300032002 Ga0307416_100002685 Ga0307416_1000026859 182
465 3300037312 Ga0395899_0000188 Ga0395899_0000188_44372_44926 182
466 3300044656 Ga0466969_0026824 Ga0466969_0026824_2040_2594 182
467 3300044684 Ga0466966_0029330 Ga0466966_0029330_2441_2995 182
468 3300050493 nmdc:mga0k408_1866_c1 nmdc:mga0k408_1866_c1_5313_5867 182
469 3300005577 Ga0068857_100061221 Ga0068857_1000612215 183
470 3300005614 Ga0068856_100004452 Ga0068856_1000044522 183
471 3300013100 Ga0157373_10006199 Ga0157373_100061997 183
472 3300013297 Ga0157378_10243733 Ga0157378_102437332 183
473 3300013308 Ga0157375_10693755 Ga0157375_106937551 183
474 3300025904 Ga0207647_10009729 Ga0207647_100097293 183
475 3300026078 Ga0207702_10000196 Ga0207702_100001966 183
476 3300026116 Ga0207674_10074451 Ga0207674_100744512 183
477 3300046500 Ga0495596_0010321 Ga0495596_0010321_3497_4057 183
478 3300046522 Ga0495643_0000926 Ga0495643_0000926_4499_5086 184
479 3300046660 Ga0495625_0189258 Ga0495625_0189258_395_982 184
480 3300053090 Ga0500646_0020861 Ga0500646_0020861_487_1074 184
481 3300053156 Ga0500622_0050194 Ga0500622_0050194_359_946 184
482 3300048924 Ga0496121_0041253 Ga0496121_0041253_2855_3460 185
483 3300048925 Ga0496122_0216696 Ga0496122_0216696_61_627 185
484 3300053090 Ga0500646_0041289 Ga0500646_0041289_251_856 186
485 3300053096 Ga0500641_0000009 Ga0500641_0000009_138730_139335 186
486 3300053086 Ga0500578_0168208 Ga0500578_0168208_332_919 188
487 iso_pu_bacteria 2958512119 2958512441 188
488 iso_pu_bacteria 8036736890 8036737987 188
489 iso_pu_bacteria 2881247448 2881247951 189
490 3300013100 Ga0157373_10000001 Ga0157373_10000001594 190
491 3300013104 Ga0157370_10002418 Ga0157370_1000241819 190
492 iso_pu_bacteria 2919683626 2919687815 190
493 iso_pu_bacteria 2513020052 2513235961 191
494 iso_pu_bacteria 2519899754 2520881717 191
495 iso_pu_bacteria 2643221600 2644008963 191
496 iso_pu_bacteria 2643221667 2644372170 191
497 iso_pu_bacteria 2643221716 2644640200 191
498 iso_pu_bacteria 2643221725 2644683305 191
499 iso_pu_bacteria 2738541279 2738734248 191
500 iso_pu_bacteria 2738541285 2738767006 191
501 iso_pu_bacteria 2738543007 2739215829 191
502 iso_pu_bacteria 2739367857 2740002097 191
503 iso_pu_bacteria 2739367858 2740006913 191
504 iso_pu_bacteria 2802428842 2802652810 191
505 iso_pu_bacteria 2816332280 2817416998 191
506 iso_pu_bacteria 2857613821 2857618071 191
507 iso_pu_bacteria 2857618242 2857623026 191
508 iso_pu_bacteria 2881359912 2881362124 191
509 iso_pu_bacteria 2903895155 2903896532 191
510 iso_pu_bacteria 2904419702 2904423864 191
511 iso_pu_bacteria 2904555929 2904560492 191
512 iso_pu_bacteria 2919191525 2919191598 191
513 iso_pu_bacteria 2919509842 2919512566 191
514 iso_pu_bacteria 2929150217 2929154270 191
515 iso_pu_bacteria 2958458903 2958461636 191
516 iso_pu_bacteria 2977268062 2977271091 191
517 iso_pu_bacteria 8054307821 8054311115 191
518 iso_pu_bacteria 8055419101 8055422587 191
519 iso_pu_bacteria 8055592153 8055595563 191
520 iso_pu_bacteria 8056440228 8056443660 191
521 3300013104 Ga0157370_10000026 Ga0157370_10000026119 193
522 3300013104 Ga0157370_10234844 Ga0157370_102348442 193
523 3300013306 Ga0163162_10018875 Ga0163162_100188752 193
524 3300017792 Ga0163161_10001751 Ga0163161_1000175114 193
525 3300031824 Ga0307413_10220525 Ga0307413_102205252 193
526 3300032004 Ga0307414_10001818 Ga0307414_1000181811 193
527 3300032005 Ga0307411_10757409 Ga0307411_107574091 193
528 3300046501 Ga0495607_0028814 Ga0495607_0028814_1094_1678 193
529 3300048918 Ga0496115_0053326 Ga0496115_0053326_707_1294 193
530 3300048928 Ga0496125_0000382 Ga0496125_0000382_36241_36828 193
531 3300048929 Ga0496126_0040007 Ga0496126_0040007_2110_2697 193
532 3300053096 Ga0500641_0000101 Ga0500641_0000101_28981_29565 193
533 3300041451 Ga0451791_1445779 Ga0451791_1445779_352_954 194
534 3300046453 Ga0495627_001886 Ga0495627_001886_136_726 194
535 3300005288 Ga0065714_10121686 Ga0065714_101216861 195
536 3300005293 Ga0065715_10230921 Ga0065715_102309211 195
537 3300005337 Ga0070682_100100927 Ga0070682_1001009272 195
538 3300006942 Ga0099824_1000378 Ga0099824_100037819 195
539 3300006946 Ga0079104_1000108 Ga0079104_100010877 195
540 3300006948 Ga0099826_10000322 Ga0099826_100003223 195
541 3300009036 Ga0105244_10000099 Ga0105244_1000009926 195
542 3300013102 Ga0157371_10040694 Ga0157371_100406942 195
543 3300013104 Ga0157370_10008951 Ga0157370_100089519 195
544 3300013104 Ga0157370_10010332 Ga0157370_100103327 195
545 3300013105 Ga0157369_10002378 Ga0157369_100023786 195
546 3300017792 Ga0163161_10000023 Ga0163161_1000002329 195
547 3300025728 Ga0207655_1000239 Ga0207655_100023938 195
548 3300027111 Ga0209281_1000208 Ga0209281_100020872 195
549 3300027666 Ga0209282_1008636 Ga0209282_10086362 195
550 3300031548 Ga0307408_100011490 Ga0307408_1000114905 195
551 3300031824 Ga0307413_10000047 Ga0307413_100000479 195
552 3300031824 Ga0307413_10268435 Ga0307413_102684352 195
553 3300031852 Ga0307410_10000498 Ga0307410_1000049810 195
554 3300031901 Ga0307406_10000428 Ga0307406_100004287 195
555 3300031903 Ga0307407_10099767 Ga0307407_100997672 195
556 3300031911 Ga0307412_10058288 Ga0307412_100582882 195
557 3300032004 Ga0307414_10000008 Ga0307414_1000000859 195
558 3300032004 Ga0307414_10293573 Ga0307414_102935732 195
559 3300032004 Ga0307414_10521648 Ga0307414_105216482 195
560 3300032005 Ga0307411_10000018 Ga0307411_1000001815 195
561 3300032005 Ga0307411_10174124 Ga0307411_101741242 195
562 3300041407 Ga0439447_009371 Ga0439447_009371_1464_2069 195
563 3300041411 Ga0439466_0006507 Ga0439466_0006507_43_651 195
564 3300041486 Ga0451807_1142615 Ga0451807_1142615_156_761 195
565 3300041486 Ga0451807_2130728 Ga0451807_2130728_33_635 195
566 3300046530 Ga0495654_0142666 Ga0495654_0142666_267_872 195
567 3300048919 Ga0496116_0000004 Ga0496116_0000004_657657_658265 195
568 3300048920 Ga0496117_0187069 Ga0496117_0187069_485_1093 195
569 3300048927 Ga0496124_0012715 Ga0496124_0012715_7295_7903 195
570 3300048927 Ga0496124_0149026 Ga0496124_0149026_458_1063 195
571 3300048927 Ga0496124_0176774 Ga0496124_0176774_665_1270 195
572 3300048928 Ga0496125_0000082 Ga0496125_0000082_46461_47069 195
573 3300048929 Ga0496126_0009008 Ga0496126_0009008_7576_8184 195
574 3300049671 Ga0501238_000593 Ga0501238_000593_3526_4134 195
575 3300049679 Ga0501249_000031 Ga0501249_000031_48627_49229 195
576 3300049679 Ga0501249_003789 Ga0501249_003789_1178_1783 195
577 3300049763 Ga0501266_000030 Ga0501266_000030_31990_32595 195
578 3300049766 Ga0501269_003178 Ga0501269_003178_311_919 195
579 3300049776 Ga0501280_000426 Ga0501280_000426_6643_7251 195
580 3300053134 Ga0500658_0000061 Ga0500658_0000061_30089_30694 195
581 3300053136 Ga0500559_0207102 Ga0500559_0207102_84_689 195
582 3300053726 Ga0500584_073873 Ga0500584_073873_454_1056 195
583 2162886007 SwRhRL2b_contig_1994321 SwRhRL2b_0892.00007600 196
584 3300005289 Ga0065704_10072486 Ga0065704_100724867 196
585 3300013104 Ga0157370_11073849 Ga0157370_110738491 196
586 3300031731 Ga0307405_10000007 Ga0307405_10000007318 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09445

Methyltransf_15

RNA cap guanine-N2 methyltransferase

45

128

0.91

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

1

177

0.91

PF05175

MTS

Methyltransferase small domain

21

169

0.87

PF13847

Methyltransf_31

Methyltransferase domain

41

188

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m1c-assembly1.cif.gz_A crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions 0.9138 1 177
3p9n-assembly1.cif.gz_A rv2966c of m. tuberculosis is a rsmd-like methyltransferase 0.8985 1 177
1ws6-assembly1.cif.gz_A the structure of thermus thermphillus hb8 hypothetical protein ttha0928 0.8946 1 177
2fpo-assembly5.cif.gz_E putative methyltransferase yhhf from escherichia coli. 0.8909 1 176
2fpo-assembly1.cif.gz_A putative methyltransferase yhhf from escherichia coli. 0.8891 1 176
ID Description Score Start End Superfamily
6aieC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9052 1 177 3.40.50.150
1ws6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8932 1 177 3.40.50.150
af_A0A5K1K930_343_529_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8853 3 176 3.40.50.150
1ws6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8785 1 177 3.40.50.150
6aieC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8769 1 177 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1M5VL34-F1-model_v4 16S rRNA (Guanine966-N2)-methyltransferase 0.9917 1 178 GO:0003676
GO:0008168
GO:0031167
AF-A0A519MP34-F1-model_v4 Methyltransferase domain-containing protein 0.9908 1 119 GO:0008168
GO:0031167
AF-A0A4R8EKU5-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9887 1 183 GO:0003676
GO:0008168
GO:0031167
AF-A0A543G040-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9874 1 183 GO:0003676
GO:0008168
GO:0031167
AF-A0A368D561-F1-model_v4 Methyltransferase domain-containing protein 0.9864 1 176 GO:0003676
GO:0008168
GO:0031167

Feature Viewer

pLDDT pTM Quality
91.12 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map