F466474

General Info

Members Datasets Scaffolds Average Seq Length
585 373 374 97

Family's Representative Sequence

Representative Sequence 3300041491|Ga0451833_1293279|Ga0451833_1293279_140_466
Length 108
Sequence VRTEEGREIMAESLSGPRRNRIHRALSRPNLLMGADRELVLITGLAAVILIFVVLTVYSALFGVAVWIVIVGLLRMMAKSDPLMRQVYIRHISYKSTYKATTSPWRRY

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
4 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
5 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
6 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
7 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
8 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
9 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
10 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
11 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
12 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
13 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
14 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
15 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
16 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
17 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
18 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
19 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
20 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
21 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
22 2516143018 Ensifer sp. BR816 Isolate Nodule
23 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
24 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
25 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
26 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
27 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
28 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
29 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
30 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
31 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
32 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
33 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
34 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
35 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
36 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
37 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
38 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
39 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
40 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
41 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
42 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
43 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
44 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
45 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
46 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
47 2643221557 Ensifer sp. Root558 Isolate Unclassified
48 2643221558 Rhizobium sp. Root149 Isolate Unclassified
49 2643221568 Rhizobium sp. Root564 Isolate Unclassified
50 2643221582 Rhizobium sp. Root651 Isolate Unclassified
51 2643221610 Ensifer sp. Root74 Isolate Unclassified
52 2643221626 Ensifer sp. Root31 Isolate Unclassified
53 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
54 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
55 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
56 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
57 2643221668 Ensifer sp. Root423 Isolate Unclassified
58 2643221675 Ensifer sp. Root1298 Isolate Unclassified
59 2643221680 Ensifer sp. Root1312 Isolate Unclassified
60 2643221718 Rhizobium sp. Root268 Isolate Unclassified
61 2643221719 Rhizobium sp. Root274 Isolate Unclassified
62 2643221723 Ensifer sp. Root278 Isolate Unclassified
63 2643221726 Ensifer sp. Root954 Isolate Unclassified
64 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
65 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
66 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
67 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
68 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
69 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
70 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
71 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
72 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
73 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
74 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
75 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
76 2791355256 Rhizobium sp. M10 Isolate Nodule
77 2791355263 Rhizobium chutanense C5 Isolate Nodule
78 2791355266 Rhizobium sp. L43 Isolate Nodule
79 2791355267 Rhizobium sp. L18 Isolate Nodule
80 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
81 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
82 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
83 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
84 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
85 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
86 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
87 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
88 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
89 2802429633 Rhizobium anhuiense J3 Isolate Nodule
90 2802429634 Rhizobium anhuiense S10 Isolate Nodule
91 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
92 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
93 2802429637 Rhizobium anhuiense C15 Isolate Nodule
94 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
95 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
96 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
97 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
98 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
99 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
100 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
101 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
102 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
103 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
104 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
105 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
106 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
107 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
108 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
109 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
110 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
111 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
112 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
113 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
114 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
115 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
116 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
117 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
118 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
119 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
120 2844163670 Ensifer sp. 1H6 Isolate Unclassified
121 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
122 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
123 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
124 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
125 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
126 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
127 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
128 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
129 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
130 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
131 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
132 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
133 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
134 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
135 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
136 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
137 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
138 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
139 2936381700 Rhizobium chutanense C16 Isolate Unclassified
140 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
141 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
142 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
143 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
144 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
145 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
146 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
147 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
148 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
149 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
150 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
151 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
152 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
153 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
154 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
155 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
156 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
157 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
158 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
159 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
160 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
161 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
162 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
163 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
164 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
165 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
166 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
167 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
168 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
169 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
170 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
171 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
172 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
173 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
174 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
175 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
176 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
177 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
178 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
179 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
180 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
181 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
182 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
183 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
184 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
185 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
186 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
187 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
188 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
189 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
190 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
191 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
192 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
193 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
194 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
195 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
196 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
197 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
198 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
199 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
200 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
201 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
202 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
203 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
204 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
206 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
208 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
209 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
210 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
212 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
213 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
221 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
226 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
227 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
230 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
233 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
234 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
235 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
236 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
244 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
245 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
246 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
247 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
248 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
249 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
250 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
251 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
252 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
253 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
254 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
255 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
256 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
257 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
258 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
259 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
260 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
261 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
262 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
263 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
264 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
265 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
266 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
269 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
270 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
271 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
272 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
273 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
276 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
277 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
278 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
279 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
280 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
281 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
282 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
283 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
284 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
285 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
286 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
287 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
288 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
289 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
290 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
291 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
292 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
293 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
294 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
295 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
296 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
297 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
298 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
299 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
300 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
301 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
313 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
314 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
315 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
316 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
317 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
318 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
319 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
320 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
321 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
322 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
323 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
324 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
325 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
330 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
332 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
333 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
334 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
335 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
336 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
337 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
338 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
339 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
340 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
341 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
342 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
343 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
344 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
345 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
346 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
347 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
348 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
349 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
350 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
351 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
352 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
353 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
354 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
355 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
356 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
357 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
358 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
359 8005395548 Rhizobium sp. R339 Isolate Nodule
360 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
361 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
362 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
363 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
364 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
365 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
366 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
367 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
368 8018176218 Rhizobium sp. N122 Isolate Nodule
369 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
370 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
371 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
372 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
373 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.93
Metatranscriptomes 0
Isolates 36.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.22
Nodule 28.38
Rhizoplane 2.05
Rhizosphere 25.64
Stem 0
Stem Tuber 0
Unclassified 21.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001183 3300002773 Bacteria 12050
2 JGI25152J39213_1019991 3300002773 Bacteria 1207
3 JGI25152J39213_1041718 3300002773 Bacteria 640
4 JGI25151J46595_10001708 3300003187 Bacteria 14340
5 JGI25151J46595_10004310 3300003187 Bacteria 7557
6 JGI25153J46596_10001647 3300003215 Bacteria 13244
7 JGI25153J46596_10003224 3300003215 Bacteria 9170
8 JGI25153J46596_10047369 3300003215 Bacteria 1265
9 JGI25153J46596_10049846 3300003215 Bacteria 1212
10 JGI25153J46596_10097691 3300003215 Bacteria 696
11 rootH1_10002814 3300003316 Bacteria 40375
12 rootH1_10002814 3300003323 Bacteria 12796
13 rootH2_10029723 3300003320 Bacteria 13503
14 rootH2_10139809 3300003320 Bacteria 3650
15 rootL2_10010387 3300003322 Bacteria 55016
16 rootH1_10025473 3300003323 Bacteria 4607
17 rootH1_10076352 3300003323 Bacteria 8662
18 rootH1_10207768 3300003323 Bacteria 1853
19 JGI25161J50226_1004304 3300003374 Bacteria 3008
20 Ga0055526_1001150 3300003771 Bacteria 19182
21 Ga0055526_1001750 3300003771 Bacteria 15071
22 Ga0055526_1005680 3300003771 Bacteria 7081
23 Ga0055526_1037371 3300003771 Bacteria 1271
24 Ga0055524_1000369 3300003775 Bacteria 39814
25 Ga0055524_1000407 3300003775 Bacteria 36421
26 Ga0055524_1003922 3300003775 Bacteria 7048
27 Ga0055524_1026558 3300003775 Bacteria 1785
28 Ga0055524_1036550 3300003775 Bacteria 1318
29 Ga0055536_1003999 3300003781 Bacteria 7700
30 Ga0055536_1063675 3300003781 Bacteria 754
31 Ga0055528_1000039 3300003790 Bacteria 112899
32 Ga0055528_1010450 3300003790 Bacteria 3772
33 Ga0055528_1055426 3300003790 Bacteria 775
34 Ga0055528_1058154 3300003790 Bacteria 743
35 Ga0055530_10008130 3300003791 Bacteria 4262
36 Ga0055530_10052845 3300003791 Bacteria 935
37 Ga0055540_1000094 3300003792 Bacteria 97733
38 Ga0055540_1000381 3300003792 Bacteria 37015
39 Ga0055540_1050520 3300003792 Bacteria 859
40 Ga0055531_10000389 3300003794 Bacteria 42420
41 Ga0055531_10006353 3300003794 Bacteria 6725
42 Ga0058692_1000019 3300003856 Bacteria 255580
43 Ga0058692_1000083 3300003856 Bacteria 66222
44 Ga0065165_1001497 3300005262 Bacteria 24706
45 Ga0065165_1001509 3300005262 Bacteria 24602
46 Ga0065165_1011007 3300005262 Bacteria 3833
47 Ga0070671_100025248 3300005355 Bacteria 4874
48 Ga0070663_100107445 3300005455 Bacteria 2092
49 Ga0070685_10844099 3300005466 Bacteria 678
50 Ga0068854_101579082 3300005578 Bacteria 597
51 Ga0068862_100994155 3300005844 Bacteria 829
52 Ga0075365_10320722 3300006038 Bacteria 1091
53 Ga0075364_10003243 3300006051 Bacteria 9214
54 Ga0075362_10519386 3300006177 Bacteria 610
55 Ga0075362_10601504 3300006177 Bacteria 568
56 Ga0075367_10321964 3300006178 Bacteria 974
57 Ga0075369_10313522 3300006186 Bacteria 733
58 Ga0075366_10318815 3300006195 Bacteria 952
59 Ga0075366_10385299 3300006195 Bacteria 862
60 Ga0075370_10080554 3300006353 Bacteria 1871
61 Ga0079104_1019593 3300006946 Bacteria 1886
62 Ga0099826_10032287 3300006948 Bacteria 3776
63 Ga0105251_10029813 3300009011 Bacteria 2745
64 Ga0105244_10288922 3300009036 Bacteria 760
65 Ga0105250_10026117 3300009092 Bacteria 2352
66 Ga0105247_10057299 3300009101 Bacteria 2409
67 Ga0105248_10045733 3300009177 Bacteria 4907
68 Ga0105249_10331140 3300009553 Bacteria 1537
69 Ga0157372_11106112 3300013307 Bacteria 917
70 Ga0163161_10551344 3300017792 Bacteria 945
71 Ga0163161_11227831 3300017792 Bacteria 649
72 Ga0214544_1000097 3300021320 Bacteria 116548
73 Ga0214544_1000584 3300021320 Bacteria 68638
74 Ga0214544_1015545 3300021320 Bacteria 7875
75 Ga0214542_1000418 3300021321 Bacteria 75807
76 Ga0214542_1017888 3300021321 Bacteria 6219
77 Ga0214542_1031313 3300021321 Bacteria 1987
78 Ga0214543_1000929 3300021327 Bacteria 53976
79 Ga0214543_1003317 3300021327 Bacteria 31302
80 Ga0214543_1004049 3300021327 Bacteria 28048
81 Ga0214543_1038252 3300021327 Bacteria 1385
82 Ga0228711_1026720 3300022739 Bacteria 3646
83 Ga0228710_1011825 3300022740 Bacteria 11087
84 Ga0207425_1000083 3300025245 Bacteria 96984
85 Ga0209129_1000098 3300025258 Bacteria 163406
86 Ga0209129_1000719 3300025258 Bacteria 21372
87 Ga0209129_1000821 3300025258 Bacteria 19527
88 Ga0209129_1014080 3300025258 Bacteria 1721
89 Ga0209673_1000126 3300025273 Bacteria 167949
90 Ga0209673_1000161 3300025273 Bacteria 142073
91 Ga0209673_1001573 3300025273 Bacteria 20332
92 Ga0209673_1016374 3300025273 Bacteria 2776
93 Ga0209130_1041637 3300025284 Bacteria 883
94 Ga0209130_1047867 3300025284 Bacteria 791
95 Ga0209676_1003351 3300025292 Bacteria 9985
96 Ga0209676_1006418 3300025292 Bacteria 5812
97 Ga0209025_1000142 3300025294 Bacteria 183903
98 Ga0209025_1000532 3300025294 Bacteria 72555
99 Ga0209025_1001930 3300025294 Bacteria 24020
100 Ga0209025_1005458 3300025294 Bacteria 10361
101 Ga0209025_1150797 3300025294 Bacteria 642
102 Ga0209025_1168096 3300025294 Bacteria 580
103 Ga0209025_1181875 3300025294 Bacteria 539
104 Ga0209564_1000368 3300025295 Bacteria 83910
105 Ga0209564_1000450 3300025295 Bacteria 69909
106 Ga0209564_1001053 3300025295 Bacteria 33613
107 Ga0209564_1006478 3300025295 Bacteria 6300
108 Ga0209564_1011104 3300025295 Bacteria 4070
109 Ga0209564_1041591 3300025295 Bacteria 1231
110 Ga0209758_1000300 3300025297 Bacteria 97000
111 Ga0209758_1000396 3300025297 Bacteria 75453
112 Ga0209758_1001917 3300025297 Bacteria 22638
113 Ga0209758_1004261 3300025297 Bacteria 12094
114 Ga0209758_1008506 3300025297 Bacteria 6622
115 Ga0209758_1008866 3300025297 Bacteria 6394
116 Ga0209758_1036651 3300025297 Bacteria 1909
117 Ga0209758_1159156 3300025297 Bacteria 563
118 Ga0209050_1003671 3300025298 Bacteria 11078
119 Ga0209050_1008740 3300025298 Bacteria 5333
120 Ga0209256_1000228 3300025299 Bacteria 102990
121 Ga0209256_1000613 3300025299 Bacteria 49419
122 Ga0209256_1000999 3300025299 Bacteria 33608
123 Ga0209256_1001076 3300025299 Bacteria 31547
124 Ga0209256_1002109 3300025299 Bacteria 17299
125 Ga0209256_1003352 3300025299 Bacteria 11356
126 Ga0209256_1022384 3300025299 Bacteria 1914
127 Ga0207426_1001108 3300025302 Bacteria 24750
128 Ga0207426_1002581 3300025302 Bacteria 11267
129 Ga0207426_1029567 3300025302 Bacteria 1805
130 Ga0209051_1000032 3300025303 Bacteria 383445
131 Ga0209051_1000132 3300025303 Bacteria 139145
132 Ga0209051_1004297 3300025303 Bacteria 8858
133 Ga0209051_1011693 3300025303 Bacteria 4311
134 Ga0209051_1034883 3300025303 Bacteria 1879
135 Ga0209257_1000209 3300025304 Bacteria 141383
136 Ga0209257_1001963 3300025304 Bacteria 22169
137 Ga0209257_1016877 3300025304 Bacteria 2918
138 Ga0209257_1099421 3300025304 Bacteria 712
139 Ga0207647_10255943 3300025904 Bacteria 1003
140 Ga0207709_10899768 3300025935 Bacteria 719
141 Ga0207711_10111913 3300025941 Bacteria 2429
142 Ga0207678_10295517 3300026067 Bacteria 1391
143 Ga0207676_10422400 3300026095 Bacteria 1251
144 Ga0209281_1000348 3300027111 Bacteria 76877
145 Ga0209371_1000107 3300027312 Bacteria 141889
146 Ga0209371_1000251 3300027312 Bacteria 66325
147 Ga0209371_1051965 3300027312 Unclassified 783
148 Ga0209282_1000070 3300027666 Bacteria 85274
149 Ga0268266_11602663 3300028379 Bacteria 626
150 Ga0268265_10873481 3300028380 Bacteria 881
151 Ga0307515_10058270 3300028794 Bacteria 5566
152 Ga0307515_10291777 3300028794 Bacteria 1326
153 Ga0268256_1000093 3300030500 Bacteria 141889
154 Ga0268256_1001634 3300030500 Bacteria 12958
155 Ga0268256_1058368 3300030500 Unclassified 783
156 Ga0307513_10014116 3300031456 Bacteria 9776
157 Ga0307513_10075160 3300031456 Bacteria 3510
158 Ga0307408_100369520 3300031548 Bacteria 1223
159 Ga0307408_100546227 3300031548 Bacteria 1022
160 Ga0307514_10182934 3300031649 Bacteria 1348
161 Ga0307406_10480992 3300031901 Bacteria 1003
162 Ga0307412_11627558 3300031911 Bacteria 590
163 Ga0315914_1000082 3300031967 Bacteria 78317
164 Ga0307510_10004792 3300033180 Bacteria 16009
165 Ga0315913_1000028 3300033430 Bacteria 78319
166 Ga0315915_1000004 3300033464 Bacteria 403083
167 Ga0373926_0063757 3300035083 Bacteria 1346
168 Ga0373927_0001245 3300035695 Bacteria 19322
169 Ga0373925_0000579 3300037068 Bacteria 35494
170 Ga0395899_0684984 3300037312 Bacteria 644
171 Ga0395900_0464342 3300037418 Bacteria 1220
172 Ga0395898_0000840 3300037466 Bacteria 50812
173 Ga0395905_0004538 3300037471 Bacteria 14378
174 Ga0395901_0000132 3300038443 Bacteria 96418
175 Ga0439436_0004799 3300041404 Bacteria 4149
176 Ga0439438_048465 3300041405 Bacteria 1087
177 Ga0439447_106120 3300041407 Bacteria 645
178 Ga0439466_0156386 3300041411 Bacteria 698
179 Ga0439465_0000118 3300041413 Bacteria 18781
180 Ga0439465_0001766 3300041413 Bacteria 7072
181 Ga0439465_0046970 3300041413 Bacteria 1406
182 Ga0439465_0162128 3300041413 Bacteria 802
183 Ga0451793_0879669 3300041452 Bacteria 721
184 Ga0451798_0684008 3300041458 Bacteria 1337
185 Ga0451833_0186191 3300041491 Bacteria 3268
186 Ga0451833_0377058 3300041491 Bacteria 2886
187 Ga0451833_0858088 3300041491 Bacteria 7564
188 Ga0451833_1293279 3300041491 Bacteria 531
189 Ga0451835_0100703 3300041492 Bacteria 552
190 Ga0451835_0104935 3300041492 Bacteria 3167
191 Ga0451835_1242391 3300041492 Bacteria 4960
192 Ga0451837_0165450 3300041494 Bacteria 1860
193 Ga0451837_0249402 3300041494 Bacteria 672
194 Ga0451837_0629808 3300041494 Bacteria 753
195 Ga0451837_1458164 3300041494 Bacteria 1118
196 Ga0451839_0352628 3300041496 Bacteria 15201
197 Ga0451839_1460354 3300041496 Bacteria 1587
198 Ga0451839_1571223 3300041496 Bacteria 901
199 Ga0451841_0110022 3300041498 Bacteria 6995
200 Ga0451841_0176674 3300041498 Bacteria 2107
201 Ga0451845_0361663 3300041501 Bacteria 8485
202 Ga0451845_0715021 3300041501 Bacteria 1866
203 Ga0451847_0075758 3300041503 Bacteria 2448
204 Ga0451847_0206364 3300041503 Bacteria 12047
205 Ga0451849_0181325 3300041505 Bacteria 11677
206 Ga0451849_0692168 3300041505 Bacteria 2184
207 Ga0451849_1136831 3300041505 Bacteria 506
208 Ga0451849_1311520 3300041505 Bacteria 3515
209 Ga0451849_1313199 3300041505 Bacteria 703
210 Ga0451849_1476207 3300041505 Bacteria 4672
211 Ga0451851_0003572 3300041507 Bacteria 27523
212 Ga0451851_0545725 3300041507 Bacteria 1221
213 Ga0451843_0163406 3300041509 Bacteria 2597
214 Ga0451843_0286922 3300041509 Bacteria 9565
215 Ga0451843_1204107 3300041509 Bacteria 1286
216 Ga0451855_0138740 3300041511 Bacteria 3142
217 Ga0451855_0302858 3300041511 Bacteria 1661
218 Ga0451855_1291389 3300041511 Bacteria 2980
219 Ga0451853_0334798 3300041512 Bacteria 5514
220 Ga0451853_1298236 3300041512 Bacteria 963
221 Ga0451853_2245295 3300041512 Bacteria 819
222 Ga0439449_0054969 3300042007 Bacteria 1470
223 Ga0439449_0059762 3300042007 Bacteria 1407
224 Ga0439449_0254279 3300042007 Bacteria 661
225 Ga0439452_088965 3300042010 Bacteria 668
226 Ga0439462_0071524 3300042015 Bacteria 942
227 Ga0439462_0145536 3300042015 Bacteria 665
228 Ga0495627_010666 3300046453 Bacteria 3331
229 Ga0495638_0007091 3300046460 Bacteria 8083
230 Ga0495650_0159915 3300046471 Bacteria 804
231 Ga0495605_0054976 3300046474 Bacteria 1925
232 Ga0495585_0002471 3300046492 Bacteria 13197
233 Ga0495585_0037727 3300046492 Bacteria 2721
234 Ga0495596_0020036 3300046500 Bacteria 2741
235 Ga0495607_0059013 3300046501 Bacteria 2190
236 Ga0495607_0203550 3300046501 Bacteria 978
237 Ga0495607_0350850 3300046501 Bacteria 681
238 Ga0495583_0012955 3300046506 Bacteria 4684
239 Ga0495583_0141675 3300046506 Bacteria 1000
240 Ga0495606_0017129 3300046507 Bacteria 5493
241 Ga0495610_0022958 3300046512 Bacteria 3399
242 Ga0495610_0140817 3300046512 Bacteria 1038
243 Ga0495610_0155411 3300046512 Bacteria 972
244 Ga0495616_0070499 3300046513 Bacteria 1692
245 Ga0495620_0000107 3300046515 Bacteria 66810
246 Ga0495620_0001213 3300046515 Bacteria 15761
247 Ga0495620_0344642 3300046515 Bacteria 565
248 Ga0495631_0001797 3300046518 Bacteria 12717
249 Ga0495631_0196051 3300046518 Bacteria 864
250 Ga0495632_0011639 3300046519 Bacteria 5125
251 Ga0495637_0006745 3300046520 Bacteria 5746
252 Ga0495637_0117152 3300046520 Bacteria 1028
253 Ga0495643_0003041 3300046522 Bacteria 12611
254 Ga0495648_0030894 3300046524 Bacteria 3535
255 Ga0495663_0159475 3300046525 Bacteria 773
256 Ga0495654_0004327 3300046530 Bacteria 8462
257 Ga0495609_0007882 3300046538 Bacteria 5265
258 Ga0495622_0329725 3300046557 Bacteria 662
259 Ga0495633_0012813 3300046558 Bacteria 4442
260 Ga0495633_0031063 3300046558 Bacteria 2592
261 Ga0495633_0504524 3300046558 Bacteria 545
262 Ga0495656_0020493 3300046615 Bacteria 2565
263 Ga0495668_0042877 3300046616 Bacteria 2518
264 Ga0495611_0144159 3300046648 Bacteria 1112
265 Ga0495625_0004571 3300046660 Bacteria 13017
266 Ga0495625_0011236 3300046660 Bacteria 7322
267 Ga0495625_0018841 3300046660 Bacteria 5374
268 Ga0495625_0057994 3300046660 Bacteria 2752
269 Ga0495625_0143335 3300046660 Bacteria 1610
270 Ga0495661_0400498 3300046665 Bacteria 667
271 Ga0495588_0016014 3300046674 Bacteria 3618
272 Ga0495588_0036095 3300046674 Bacteria 2506
273 Ga0495588_0086832 3300046674 Bacteria 1636
274 Ga0495588_0364812 3300046674 Bacteria 759
275 Ga0495670_0050275 3300046691 Bacteria 2087
276 Ga0495671_0002228 3300046692 Bacteria 12330
277 Ga0495671_0166133 3300046692 Bacteria 1073
278 Ga0495671_0243608 3300046692 Bacteria 868
279 Ga0495649_0040391 3300046694 Bacteria 2555
280 Ga0495649_0059852 3300046694 Bacteria 2050
281 Ga0495600_0957550 3300046809 Bacteria 503
282 Ga0495660_0111281 3300046810 Bacteria 1397
283 Ga0495687_027851 3300047443 Bacteria 2638
284 Ga0495687_032729 3300047443 Bacteria 2369
285 Ga0495679_109075 3300047446 Bacteria 763
286 Ga0495681_0008822 3300047470 Bacteria 6274
287 Ga0495681_0055527 3300047470 Bacteria 1846
288 Ga0495681_0080431 3300047470 Bacteria 1456
289 Ga0495686_0054389 3300047472 Bacteria 2506
290 Ga0495686_0344089 3300047472 Bacteria 812
291 Ga0495615_0087130 3300048090 Bacteria 865
292 Ga0495615_0292930 3300048090 Bacteria 525
293 Ga0496100_0152488 3300048903 Bacteria 1650
294 Ga0496102_0098274 3300048905 Bacteria 2716
295 Ga0496103_0297945 3300048906 Bacteria 1037
296 Ga0496104_0016015 3300048907 Bacteria 6807
297 Ga0496105_0000087 3300048908 Bacteria 65230
298 Ga0496106_0235010 3300048909 Bacteria 1464
299 Ga0496107_0292682 3300048910 Bacteria 1212
300 Ga0496109_0026714 3300048912 Bacteria 5150
301 Ga0496116_0000601 3300048919 Bacteria 47643
302 Ga0496116_0001726 3300048919 Bacteria 23861
303 Ga0496116_0038702 3300048919 Bacteria 3307
304 Ga0496117_0002417 3300048920 Bacteria 23697
305 Ga0496117_0093904 3300048920 Bacteria 1922
306 Ga0496118_0079213 3300048921 Bacteria 2320
307 Ga0496118_0177968 3300048921 Bacteria 1289
308 Ga0496119_0000569 3300048922 Bacteria 49819
309 Ga0496119_0011170 3300048922 Bacteria 7478
310 Ga0496119_0020439 3300048922 Bacteria 4832
311 Ga0496119_0498274 3300048922 Bacteria 567
312 Ga0496120_0012525 3300048923 Bacteria 5769
313 Ga0496120_0020913 3300048923 Bacteria 4146
314 Ga0496121_0011301 3300048924 Bacteria 9940
315 Ga0496121_0191439 3300048924 Bacteria 1466
316 Ga0496121_0487923 3300048924 Bacteria 785
317 Ga0496121_0725498 3300048924 Bacteria 594
318 Ga0496121_0725780 3300048924 Bacteria 594
319 Ga0496122_0005173 3300048925 Bacteria 15693
320 Ga0496122_0010254 3300048925 Bacteria 9701
321 Ga0496122_0010574 3300048925 Bacteria 9480
322 Ga0496122_0061402 3300048925 Bacteria 2759
323 Ga0496123_0002390 3300048926 Bacteria 23485
324 Ga0496123_0114871 3300048926 Bacteria 1529
325 Ga0496124_0010911 3300048927 Bacteria 9141
326 Ga0496124_0018666 3300048927 Bacteria 6487
327 Ga0496124_0020377 3300048927 Bacteria 6129
328 Ga0496124_0027146 3300048927 Bacteria 5145
329 Ga0496125_0000182 3300048928 Bacteria 137747
330 Ga0496126_0001273 3300048929 Bacteria 40531
331 Ga0496126_0055713 3300048929 Bacteria 3575
332 Ga0496126_0158904 3300048929 Bacteria 1932
333 Ga0495678_096969 3300049459 Bacteria 1028
334 Ga0495682_0163967 3300049460 Bacteria 791
335 Ga0501032_0388342 3300049569 Bacteria 897
336 Ga0501033_0000054 3300049570 Bacteria 108163
337 Ga0501033_0077354 3300049570 Bacteria 2442
338 Ga0501034_0054016 3300049571 Bacteria 4045
339 Ga0501034_0170044 3300049571 Bacteria 2147
340 Ga0501036_1235131 3300049572 Bacteria 608
341 Ga0501280_000892 3300049776 Bacteria 6379
342 Ga0501035_0001626 3300049822 Bacteria 22754
343 Ga0501035_0668635 3300049822 Bacteria 840
344 Ga0501044_0438234 3300049823 Bacteria 1215
345 nmdc:mga03683_69828_c1 3300050489 Bacteria 1499
346 nmdc:mga00v17_85_c1 3300050491 Bacteria 57269
347 nmdc:mga0yw44_446206_c1 3300050492 Bacteria 877
348 nmdc:mga0k408_78177_c1 3300050493 Bacteria 1935
349 nmdc:mga06z11_278895_c1 3300050494 Bacteria 990
350 nmdc:mga07m45_23918_c2 3300050496 Bacteria 1811
351 nmdc:mga0sz30_155921_c1 3300050516 Bacteria 1011
352 nmdc:mga0sz30_196157_c1 3300050516 Bacteria 896
353 Ga0500610_0131126 3300053079 Bacteria 1274
354 Ga0500643_058119 3300053087 Bacteria 1091
355 Ga0500556_0314621 3300053104 Bacteria 610
356 Ga0500557_001176 3300053105 Bacteria 4076
357 Ga0500593_159323 3300053117 Bacteria 865
358 Ga0500594_0001801 3300053118 Bacteria 4645
359 Ga0500594_0022369 3300053118 Bacteria 1594
360 Ga0500618_000097 3300053125 Bacteria 71932
361 Ga0500618_008258 3300053125 Bacteria 2919
362 Ga0500658_0287227 3300053134 Bacteria 756
363 Ga0500559_0408854 3300053136 Bacteria 631
364 Ga0500561_0060087 3300053137 Bacteria 1062
365 Ga0500573_0003603 3300053140 Bacteria 8036
366 Ga0500606_044720 3300053152 Bacteria 1470
367 Ga0500616_0000438 3300053153 Bacteria 55072
368 Ga0500622_0000278 3300053156 Bacteria 52272
369 Ga0500636_0000231 3300053177 Bacteria 30492
370 Ga0500636_0017031 3300053177 Bacteria 4286
371 Ga0500636_0088661 3300053177 Bacteria 1774
372 Ga0500636_0132696 3300053177 Bacteria 1385
373 Ga0500636_0136935 3300053177 Bacteria 1359
374 Ga0500611_253049 3300053727 Bacteria 508

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221558 2643810874 90
2 iso_pu_bacteria 2643221568 2643858400 90
3 iso_pu_bacteria 2643221637 2644208164 90
4 iso_pu_bacteria 2643221718 2644651922 90
5 iso_pu_bacteria 2791355253 2793283264 90
6 iso_pu_bacteria 2791355266 2793363448 90
7 3300026095 Ga0207676_10422400 Ga0207676_104224003 91
8 3300006051 Ga0075364_10003243 Ga0075364_100032432 92
9 3300050491 nmdc:mga00v17_85_c1 nmdc:mga00v17_85_c1_15341_15640 92
10 iso_pu_bacteria 2643221610 2644066810 93
11 iso_pu_bacteria 2643221668 2644381255 93
12 iso_pu_bacteria 2643221675 2644417756 93
13 iso_pu_bacteria 2643221680 2644451032 93
14 iso_pu_bacteria 2643221726 2644691749 93
15 3300003323 rootH1_10025473 rootH1_100254732 94
16 3300013307 Ga0157372_11106112 Ga0157372_111061123 94
17 3300048919 Ga0496116_0000601 Ga0496116_0000601_7023_7307 94
18 3300048919 Ga0496116_0001726 Ga0496116_0001726_12191_12475 94
19 3300048920 Ga0496117_0002417 Ga0496117_0002417_9520_9804 94
20 3300048921 Ga0496118_0079213 Ga0496118_0079213_217_501 94
21 3300048921 Ga0496118_0177968 Ga0496118_0177968_232_516 94
22 3300048922 Ga0496119_0011170 Ga0496119_0011170_6553_6837 94
23 3300048923 Ga0496120_0012525 Ga0496120_0012525_4486_4770 94
24 3300048924 Ga0496121_0011301 Ga0496121_0011301_1574_1858 94
25 3300048925 Ga0496122_0010254 Ga0496122_0010254_8227_8511 94
26 3300048925 Ga0496122_0010574 Ga0496122_0010574_8507_8791 94
27 3300048926 Ga0496123_0002390 Ga0496123_0002390_8194_8478 94
28 3300048927 Ga0496124_0010911 Ga0496124_0010911_8421_8705 94
29 3300048927 Ga0496124_0020377 Ga0496124_0020377_3003_3287 94
30 3300048928 Ga0496125_0000182 Ga0496125_0000182_13258_13542 94
31 3300048929 Ga0496126_0158904 Ga0496126_0158904_1080_1364 94
32 3300049776 Ga0501280_000892 Ga0501280_000892_4897_5181 94
33 3300053177 Ga0500636_0088661 Ga0500636_0088661_792_1076 94
34 iso_pu_bacteria 2512875026 2512975102 94
35 iso_pu_bacteria 2513237088 2513598456 94
36 iso_pu_bacteria 2513237089 2513605138 94
37 iso_pu_bacteria 2513237156 2513989293 94
38 iso_pu_bacteria 2513237160 2514007831 94
39 iso_pu_bacteria 2517487022 2517567746 94
40 iso_pu_bacteria 2802428858 2802721039 94
41 iso_pu_bacteria 2802428859 2802728128 94
42 iso_pu_bacteria 2802428860 2802733593 94
43 iso_pu_bacteria 2802428861 2802736662 94
44 iso_pu_bacteria 2802428862 2802746730 94
45 iso_pu_bacteria 2802428863 2802749773 94
46 iso_pu_bacteria 2915980308 2915986716 94
47 iso_pu_bacteria 2916061851 2916064161 94
48 iso_pu_bacteria 2921250672 2921254079 94
49 iso_pu_bacteria 2937029754 2937035490 94
50 iso_pu_bacteria 2937036028 2937039921 94
51 iso_pu_bacteria 2937078374 2937078945 94
52 iso_pu_bacteria 2937084907 2937087480 94
53 iso_pu_bacteria 2957375807 2957376331 94
54 iso_pu_bacteria 2957437181 2957440504 94
55 iso_pu_bacteria 2960591022 2960597373 94
56 iso_pu_bacteria 2960631154 2960636566 94
57 iso_pu_bacteria 2960680706 2960686077 94
58 iso_pu_bacteria 2960693952 2960695816 94
59 iso_pu_bacteria 2967686174 2967690984 94
60 iso_pu_bacteria 2967728569 2967733695 94
61 iso_pu_bacteria 2970026789 2970029037 94
62 iso_pu_bacteria 2970122695 2970125131 94
63 iso_pu_bacteria 2970143518 2970148074 94
64 iso_pu_bacteria 2977530762 2977533379 94
65 iso_pu_bacteria 2977544691 2977548864 94
66 iso_pu_bacteria 8003999396 8004005292 94
67 iso_pu_bacteria 2508501122 2509111906 95
68 iso_pu_bacteria 2509276019 2509378648 95
69 iso_pu_bacteria 2510917026 2511173545 95
70 iso_pu_bacteria 2512047086 2512531268 95
71 iso_pu_bacteria 2513237084 2513573046 95
72 iso_pu_bacteria 2513237085 2513580875 95
73 iso_pu_bacteria 2513237088 2513600616 95
74 iso_pu_bacteria 2513237138 2513869942 95
75 iso_pu_bacteria 2513237140 2513881840 95
76 iso_pu_bacteria 2513237140 2513885917 95
77 iso_pu_bacteria 2513237144 2513914244 95
78 iso_pu_bacteria 2513237146 2513930110 95
79 iso_pu_bacteria 2513237159 2513998923 95
80 iso_pu_bacteria 2513237162 2514024727 95
81 iso_pu_bacteria 2515075009 2515108389 95
82 iso_pu_bacteria 2515075009 2515109929 95
83 iso_pu_bacteria 2515154107 2515611282 95
84 iso_pu_bacteria 2515154107 2515611855 95
85 iso_pu_bacteria 2515154113 2515635675 95
86 iso_pu_bacteria 2515154116 2515661298 95
87 iso_pu_bacteria 2516143018 2516210367 95
88 iso_pu_bacteria 2516653077 2517042912 95
89 iso_pu_bacteria 2517093000 2517099937 95
90 iso_pu_bacteria 2524023207 2524451572 95
91 iso_pu_bacteria 2524023209 2524460891 95
92 iso_pu_bacteria 2524023209 2524462820 95
93 iso_pu_bacteria 2524023209 2524462873 95
94 iso_pu_bacteria 2534681796 2535521024 95
95 iso_pu_bacteria 2558860100 2558864273 95
96 iso_pu_bacteria 2558860100 2558867018 95
97 iso_pu_bacteria 2558860100 2558867705 95
98 iso_pu_bacteria 2582581294 2585205204 95
99 iso_pu_bacteria 2582581304 2585258066 95
100 iso_pu_bacteria 2582581306 2585268306 95
101 iso_pu_bacteria 2585427593 2585841008 95
102 iso_pu_bacteria 2585427594 2585846022 95
103 iso_pu_bacteria 2585427633 2585994095 95
104 iso_pu_bacteria 2599185170 2599413970 95
105 iso_pu_bacteria 2599185210 2599606329 95
106 iso_pu_bacteria 2599185236 2599723326 95
107 iso_pu_bacteria 2615840626 2616310040 95
108 iso_pu_bacteria 2615840626 2616311764 95
109 iso_pu_bacteria 2615840698 2616551460 95
110 iso_pu_bacteria 2643221557 2643806757 95
111 iso_pu_bacteria 2643221558 2643815077 95
112 iso_pu_bacteria 2643221582 2643918125 95
113 iso_pu_bacteria 2643221626 2644147390 95
114 iso_pu_bacteria 2643221634 2644192466 95
115 iso_pu_bacteria 2643221636 2644200551 95
116 iso_pu_bacteria 2643221653 2644300762 95
117 iso_pu_bacteria 2643221719 2644658984 95
118 iso_pu_bacteria 2643221723 2644674462 95
119 iso_pu_bacteria 2657244999 2657686528 95
120 iso_pu_bacteria 2690316117 2692320945 95
121 iso_pu_bacteria 2718218233 2720617069 95
122 iso_pu_bacteria 2738541333 2739037591 95
123 iso_pu_bacteria 2751185821 2753462847 95
124 iso_pu_bacteria 2765235942 2766064446 95
125 iso_pu_bacteria 2775507266 2778176770 95
126 iso_pu_bacteria 2775507266 2778179989 95
127 iso_pu_bacteria 2775507266 2778180295 95
128 iso_pu_bacteria 2791355091 2792623754 95
129 iso_pu_bacteria 2791355091 2792624678 95
130 iso_pu_bacteria 2791355092 2792630013 95
131 iso_pu_bacteria 2791355092 2792630798 95
132 iso_pu_bacteria 2791355094 2792641091 95
133 iso_pu_bacteria 2791355094 2792642043 95
134 iso_pu_bacteria 2791355256 2793298073 95
135 iso_pu_bacteria 2791355263 2793343378 95
136 iso_pu_bacteria 2791355263 2793343569 95
137 iso_pu_bacteria 2791355266 2793363140 95
138 iso_pu_bacteria 2791355266 2793364263 95
139 iso_pu_bacteria 2791355267 2793370592 95
140 iso_pu_bacteria 2802429268 2804750492 95
141 iso_pu_bacteria 2802429605 2805931152 95
142 iso_pu_bacteria 2802429606 2805936954 95
143 iso_pu_bacteria 2802429606 2805937708 95
144 iso_pu_bacteria 2802429633 2806048255 95
145 iso_pu_bacteria 2802429634 2806055723 95
146 iso_pu_bacteria 2802429635 2806062562 95
147 iso_pu_bacteria 2802429636 2806070900 95
148 iso_pu_bacteria 2802429637 2806076288 95
149 iso_pu_bacteria 2818991448 2819612131 95
150 iso_pu_bacteria 2838029111 2838033490 95
151 iso_pu_bacteria 2838029111 2838034522 95
152 iso_pu_bacteria 2838035591 2838042539 95
153 iso_pu_bacteria 2838074704 2838080829 95
154 iso_pu_bacteria 2838661181 2838668383 95
155 iso_pu_bacteria 2838686498 2838691058 95
156 iso_pu_bacteria 2841851746 2841856374 95
157 iso_pu_bacteria 2841864319 2841870173 95
158 iso_pu_bacteria 2842077413 2842083225 95
159 iso_pu_bacteria 2842110456 2842114004 95
160 iso_pu_bacteria 2842110456 2842117296 95
161 iso_pu_bacteria 2842198810 2842202710 95
162 iso_pu_bacteria 2842271015 2842275533 95
163 iso_pu_bacteria 2842285085 2842290219 95
164 iso_pu_bacteria 2842298080 2842302333 95
165 iso_pu_bacteria 2842298080 2842303814 95
166 iso_pu_bacteria 2842317721 2842324049 95
167 iso_pu_bacteria 2842357229 2842363295 95
168 iso_pu_bacteria 2842395702 2842402005 95
169 iso_pu_bacteria 2842402390 2842407953 95
170 iso_pu_bacteria 2842402390 2842408273 95
171 iso_pu_bacteria 2842409023 2842414540 95
172 iso_pu_bacteria 2842409023 2842414635 95
173 iso_pu_bacteria 2842415677 2842421024 95
174 iso_pu_bacteria 2842415677 2842421610 95
175 iso_pu_bacteria 2842475841 2842480239 95
176 iso_pu_bacteria 2842475841 2842481269 95
177 iso_pu_bacteria 2842482326 2842488243 95
178 iso_pu_bacteria 2842489311 2842494731 95
179 iso_pu_bacteria 2842502639 2842507651 95
180 iso_pu_bacteria 2842502639 2842508146 95
181 iso_pu_bacteria 2842509118 2842513973 95
182 iso_pu_bacteria 2842509118 2842514811 95
183 iso_pu_bacteria 2842521101 2842524148 95
184 iso_pu_bacteria 2844163670 2844164519 95
185 iso_pu_bacteria 2844454524 2844461923 95
186 iso_pu_bacteria 2844454524 2844462249 95
187 iso_pu_bacteria 2847417321 2847421867 95
188 iso_pu_bacteria 2848992105 2848996640 95
189 iso_pu_bacteria 2850079185 2850083353 95
190 iso_pu_bacteria 2852387548 2852392943 95
191 iso_pu_bacteria 2855872281 2855876218 95
192 iso_pu_bacteria 2857516855 2857522883 95
193 iso_pu_bacteria 2857516855 2857524565 95
194 iso_pu_bacteria 2858800743 2858804488 95
195 iso_pu_bacteria 2896384573 2896389603 95
196 iso_pu_bacteria 2899803654 2899804829 95
197 iso_pu_bacteria 2913295892 2913298779 95
198 iso_pu_bacteria 2919100787 2919107359 95
199 iso_pu_bacteria 2920760137 2920762318 95
200 iso_pu_bacteria 2920760137 2920767020 95
201 iso_pu_bacteria 2933016740 2933023045 95
202 iso_pu_bacteria 2933586486 2933589719 95
203 iso_pu_bacteria 2936381700 2936386387 95
204 iso_pu_bacteria 2941499720 2941503550 95
205 iso_pu_bacteria 643692032 643692046 95
206 iso_pu_bacteria 8003570095 8003574980 95
207 iso_pu_bacteria 8003570095 8003575141 95
208 iso_pu_bacteria 8005301065 8005301750 95
209 iso_pu_bacteria 8005395548 8005402181 95
210 iso_pu_bacteria 8005460587 8005465963 95
211 iso_pu_bacteria 8005484373 8005488250 95
212 iso_pu_bacteria 8005542996 8005549964 95
213 iso_pu_bacteria 8005570704 8005571516 95
214 iso_pu_bacteria 8005645114 8005648492 95
215 iso_pu_bacteria 8005682033 8005687156 95
216 iso_pu_bacteria 8005688590 8005689679 95
217 iso_pu_bacteria 8005688590 8005693074 95
218 iso_pu_bacteria 8018163183 8018169614 95
219 iso_pu_bacteria 8018176218 8018179069 95
220 iso_pu_bacteria 8046767195 8046767826 95
221 iso_pu_bacteria 8046767195 8046770037 95
222 iso_pu_bacteria 8056375014 8056377376 95
223 iso_pu_bacteria 8056875544 8056877930 95
224 iso_pu_bacteria 8057575449 8057581439 95
225 iso_pu_bacteria 8057874678 8057880203 95
226 iso_pu_bacteria 2582581308 2585281746 96
227 iso_pu_bacteria 2582581316 2585334820 96
228 iso_pu_bacteria 2585427527 2585534394 96
229 iso_pu_bacteria 2585427608 2585897382 96
230 iso_pu_bacteria 2585427609 2585908927 96
231 iso_pu_bacteria 2585428125 2587984250 96
232 iso_pu_bacteria 2724679232 2725949141 96
233 iso_pu_bacteria 2933586486 2933590022 96
234 3300003775 Ga0055524_1000407 Ga0055524_10004078 97
235 3300025294 Ga0209025_1181875 Ga0209025_11818752 97
236 3300025299 Ga0209256_1000228 Ga0209256_100022855 97
237 3300006946 Ga0079104_1019593 Ga0079104_10195932 98
238 3300006948 Ga0099826_10032287 Ga0099826_100322873 98
239 3300022739 Ga0228711_1026720 Ga0228711_10267202 98
240 3300022740 Ga0228710_1011825 Ga0228710_101182510 98
241 3300027111 Ga0209281_1000348 Ga0209281_100034868 98
242 3300027666 Ga0209282_1000070 Ga0209282_10000707 98
243 3300031967 Ga0315914_1000082 Ga0315914_10000829 98
244 3300033430 Ga0315913_1000028 Ga0315913_10000289 98
245 3300033464 Ga0315915_1000004 Ga0315915_10000049 98
246 3300002773 JGI25152J39213_1001183 JGI25152J39213_10011834 99
247 3300002773 JGI25152J39213_1019991 JGI25152J39213_10199912 99
248 3300002773 JGI25152J39213_1041718 JGI25152J39213_10417182 99
249 3300003187 JGI25151J46595_10001708 JGI25151J46595_100017082 99
250 3300003187 JGI25151J46595_10004310 JGI25151J46595_100043108 99
251 3300003215 JGI25153J46596_10001647 JGI25153J46596_100016472 99
252 3300003215 JGI25153J46596_10003224 JGI25153J46596_100032247 99
253 3300003215 JGI25153J46596_10047369 JGI25153J46596_100473693 99
254 3300003215 JGI25153J46596_10049846 JGI25153J46596_100498462 99
255 3300003215 JGI25153J46596_10097691 JGI25153J46596_100976912 99
256 3300003316 rootH1_10002814 rootH1_1000281430 99
257 3300003320 rootH2_10029723 rootH2_100297239 99
258 3300003320 rootH2_10139809 rootH2_101398094 99
259 3300003322 rootL2_10010387 rootL2_1001038741 99
260 3300003323 rootH1_10076352 rootH1_100763529 99
261 3300003323 rootH1_10207768 rootH1_102077682 99
262 3300003374 JGI25161J50226_1004304 JGI25161J50226_10043045 99
263 3300003771 Ga0055526_1001150 Ga0055526_100115011 99
264 3300003771 Ga0055526_1001750 Ga0055526_100175012 99
265 3300003771 Ga0055526_1005680 Ga0055526_10056806 99
266 3300003771 Ga0055526_1037371 Ga0055526_10373712 99
267 3300003775 Ga0055524_1000369 Ga0055524_100036910 99
268 3300003775 Ga0055524_1003922 Ga0055524_10039224 99
269 3300003775 Ga0055524_1026558 Ga0055524_10265582 99
270 3300003775 Ga0055524_1036550 Ga0055524_10365502 99
271 3300003781 Ga0055536_1003999 Ga0055536_10039995 99
272 3300003781 Ga0055536_1063675 Ga0055536_10636751 99
273 3300003790 Ga0055528_1000039 Ga0055528_100003928 99
274 3300003790 Ga0055528_1010450 Ga0055528_10104504 99
275 3300003790 Ga0055528_1055426 Ga0055528_10554262 99
276 3300003790 Ga0055528_1058154 Ga0055528_10581542 99
277 3300003791 Ga0055530_10008130 Ga0055530_100081305 99
278 3300003791 Ga0055530_10052845 Ga0055530_100528452 99
279 3300003792 Ga0055540_1000094 Ga0055540_1000094115 99
280 3300003792 Ga0055540_1000381 Ga0055540_100038125 99
281 3300003792 Ga0055540_1050520 Ga0055540_10505202 99
282 3300003794 Ga0055531_10000389 Ga0055531_1000038931 99
283 3300003794 Ga0055531_10006353 Ga0055531_100063534 99
284 3300003856 Ga0058692_1000019 Ga0058692_1000019101 99
285 3300003856 Ga0058692_1000019 Ga0058692_1000019238 99
286 3300003856 Ga0058692_1000083 Ga0058692_100008365 99
287 3300005262 Ga0065165_1001497 Ga0065165_100149714 99
288 3300005262 Ga0065165_1001509 Ga0065165_100150923 99
289 3300005262 Ga0065165_1011007 Ga0065165_10110072 99
290 3300005355 Ga0070671_100025248 Ga0070671_1000252482 99
291 3300005455 Ga0070663_100107445 Ga0070663_1001074453 99
292 3300005466 Ga0070685_10844099 Ga0070685_108440991 99
293 3300005578 Ga0068854_101579082 Ga0068854_1015790821 99
294 3300005844 Ga0068862_100994155 Ga0068862_1009941552 99
295 3300006038 Ga0075365_10320722 Ga0075365_103207222 99
296 3300006177 Ga0075362_10519386 Ga0075362_105193862 99
297 3300006177 Ga0075362_10601504 Ga0075362_106015042 99
298 3300006178 Ga0075367_10321964 Ga0075367_103219642 99
299 3300006186 Ga0075369_10313522 Ga0075369_103135222 99
300 3300006195 Ga0075366_10318815 Ga0075366_103188152 99
301 3300006195 Ga0075366_10385299 Ga0075366_103852992 99
302 3300006353 Ga0075370_10080554 Ga0075370_100805543 99
303 3300009011 Ga0105251_10029813 Ga0105251_100298132 99
304 3300009036 Ga0105244_10288922 Ga0105244_102889222 99
305 3300009092 Ga0105250_10026117 Ga0105250_100261172 99
306 3300009101 Ga0105247_10057299 Ga0105247_100572992 99
307 3300009177 Ga0105248_10045733 Ga0105248_100457334 99
308 3300009553 Ga0105249_10331140 Ga0105249_103311402 99
309 3300017792 Ga0163161_10551344 Ga0163161_105513442 99
310 3300017792 Ga0163161_11227831 Ga0163161_112278312 99
311 3300021320 Ga0214544_1000097 Ga0214544_100009752 99
312 3300021320 Ga0214544_1000584 Ga0214544_100058413 99
313 3300021320 Ga0214544_1015545 Ga0214544_10155453 99
314 3300021321 Ga0214542_1000418 Ga0214542_100041865 99
315 3300021321 Ga0214542_1017888 Ga0214542_10178885 99
316 3300021321 Ga0214542_1031313 Ga0214542_10313133 99
317 3300021327 Ga0214543_1000929 Ga0214543_10009292 99
318 3300021327 Ga0214543_1003317 Ga0214543_100331712 99
319 3300021327 Ga0214543_1004049 Ga0214543_10040492 99
320 3300021327 Ga0214543_1038252 Ga0214543_10382523 99
321 3300025245 Ga0207425_1000083 Ga0207425_100008354 99
322 3300025258 Ga0209129_1000098 Ga0209129_1000098131 99
323 3300025258 Ga0209129_1000719 Ga0209129_100071913 99
324 3300025258 Ga0209129_1000821 Ga0209129_10008218 99
325 3300025258 Ga0209129_1014080 Ga0209129_10140802 99
326 3300025273 Ga0209673_1000126 Ga0209673_100012679 99
327 3300025273 Ga0209673_1000161 Ga0209673_100016154 99
328 3300025273 Ga0209673_1001573 Ga0209673_100157314 99
329 3300025273 Ga0209673_1016374 Ga0209673_10163742 99
330 3300025284 Ga0209130_1041637 Ga0209130_10416372 99
331 3300025284 Ga0209130_1047867 Ga0209130_10478672 99
332 3300025292 Ga0209676_1003351 Ga0209676_10033515 99
333 3300025292 Ga0209676_1006418 Ga0209676_10064186 99
334 3300025294 Ga0209025_1000142 Ga0209025_1000142112 99
335 3300025294 Ga0209025_1000532 Ga0209025_100053228 99
336 3300025294 Ga0209025_1001930 Ga0209025_100193013 99
337 3300025294 Ga0209025_1005458 Ga0209025_100545812 99
338 3300025294 Ga0209025_1150797 Ga0209025_11507972 99
339 3300025294 Ga0209025_1168096 Ga0209025_11680962 99
340 3300025295 Ga0209564_1000368 Ga0209564_10003683 99
341 3300025295 Ga0209564_1000450 Ga0209564_100045023 99
342 3300025295 Ga0209564_1001053 Ga0209564_100105327 99
343 3300025295 Ga0209564_1006478 Ga0209564_10064787 99
344 3300025295 Ga0209564_1011104 Ga0209564_10111043 99
345 3300025295 Ga0209564_1041591 Ga0209564_10415912 99
346 3300025297 Ga0209758_1000300 Ga0209758_100030054 99
347 3300025297 Ga0209758_1000396 Ga0209758_100039690 99
348 3300025297 Ga0209758_1001917 Ga0209758_100191711 99
349 3300025297 Ga0209758_1004261 Ga0209758_100426113 99
350 3300025297 Ga0209758_1008506 Ga0209758_10085066 99
351 3300025297 Ga0209758_1008866 Ga0209758_10088663 99
352 3300025297 Ga0209758_1036651 Ga0209758_10366512 99
353 3300025297 Ga0209758_1159156 Ga0209758_11591562 99
354 3300025298 Ga0209050_1003671 Ga0209050_10036716 99
355 3300025298 Ga0209050_1008740 Ga0209050_10087402 99
356 3300025299 Ga0209256_1000613 Ga0209256_100061344 99
357 3300025299 Ga0209256_1000999 Ga0209256_100099910 99
358 3300025299 Ga0209256_1001076 Ga0209256_100107611 99
359 3300025299 Ga0209256_1002109 Ga0209256_10021093 99
360 3300025299 Ga0209256_1003352 Ga0209256_10033522 99
361 3300025299 Ga0209256_1022384 Ga0209256_10223843 99
362 3300025302 Ga0207426_1001108 Ga0207426_100110814 99
363 3300025302 Ga0207426_1002581 Ga0207426_10025818 99
364 3300025302 Ga0207426_1029567 Ga0207426_10295672 99
365 3300025303 Ga0209051_1000032 Ga0209051_1000032241 99
366 3300025303 Ga0209051_1000132 Ga0209051_100013229 99
367 3300025303 Ga0209051_1004297 Ga0209051_10042977 99
368 3300025303 Ga0209051_1011693 Ga0209051_10116932 99
369 3300025303 Ga0209051_1034883 Ga0209051_10348831 99
370 3300025304 Ga0209257_1000209 Ga0209257_1000209110 99
371 3300025304 Ga0209257_1001963 Ga0209257_100196320 99
372 3300025304 Ga0209257_1016877 Ga0209257_10168772 99
373 3300025304 Ga0209257_1099421 Ga0209257_10994212 99
374 3300025904 Ga0207647_10255943 Ga0207647_102559433 99
375 3300025935 Ga0207709_10899768 Ga0207709_108997682 99
376 3300025941 Ga0207711_10111913 Ga0207711_101119133 99
377 3300026067 Ga0207678_10295517 Ga0207678_102955172 99
378 3300027312 Ga0209371_1000107 Ga0209371_100010728 99
379 3300027312 Ga0209371_1000251 Ga0209371_100025115 99
380 3300027312 Ga0209371_1051965 Ga0209371_10519652 99
381 3300028379 Ga0268266_11602663 Ga0268266_116026631 99
382 3300028380 Ga0268265_10873481 Ga0268265_108734812 99
383 3300028794 Ga0307515_10058270 Ga0307515_100582706 99
384 3300028794 Ga0307515_10291777 Ga0307515_102917772 99
385 3300030500 Ga0268256_1000093 Ga0268256_100009328 99
386 3300030500 Ga0268256_1001634 Ga0268256_10016342 99
387 3300030500 Ga0268256_1058368 Ga0268256_10583682 99
388 3300031456 Ga0307513_10014116 Ga0307513_100141168 99
389 3300031456 Ga0307513_10075160 Ga0307513_100751602 99
390 3300031548 Ga0307408_100369520 Ga0307408_1003695202 99
391 3300031548 Ga0307408_100546227 Ga0307408_1005462271 99
392 3300031649 Ga0307514_10182934 Ga0307514_101829342 99
393 3300031901 Ga0307406_10480992 Ga0307406_104809922 99
394 3300031911 Ga0307412_11627558 Ga0307412_116275581 99
395 3300033180 Ga0307510_10004792 Ga0307510_100047928 99
396 3300035083 Ga0373926_0063757 Ga0373926_0063757_166_465 99
397 3300035695 Ga0373927_0001245 Ga0373927_0001245_7449_7748 99
398 3300037068 Ga0373925_0000579 Ga0373925_0000579_28297_28596 99
399 3300037312 Ga0395899_0684984 Ga0395899_0684984_215_514 99
400 3300037418 Ga0395900_0464342 Ga0395900_0464342_215_514 99
401 3300037466 Ga0395898_0000840 Ga0395898_0000840_24955_25254 99
402 3300037471 Ga0395905_0004538 Ga0395905_0004538_5296_5595 99
403 3300038443 Ga0395901_0000132 Ga0395901_0000132_78175_78474 99
404 3300041404 Ga0439436_0004799 Ga0439436_0004799_3520_3819 99
405 3300041405 Ga0439438_048465 Ga0439438_048465_331_630 99
406 3300041407 Ga0439447_106120 Ga0439447_106120_133_432 99
407 3300041411 Ga0439466_0156386 Ga0439466_0156386_296_595 99
408 3300041413 Ga0439465_0000118 Ga0439465_0000118_6888_7187 99
409 3300041413 Ga0439465_0001766 Ga0439465_0001766_362_661 99
410 3300041413 Ga0439465_0046970 Ga0439465_0046970_593_892 99
411 3300041413 Ga0439465_0162128 Ga0439465_0162128_453_752 99
412 3300041452 Ga0451793_0879669 Ga0451793_0879669_335_634 99
413 3300041458 Ga0451798_0684008 Ga0451798_0684008_465_764 99
414 3300041491 Ga0451833_0186191 Ga0451833_0186191_79_378 99
415 3300041491 Ga0451833_0377058 Ga0451833_0377058_1495_1794 99
416 3300041491 Ga0451833_0858088 Ga0451833_0858088_4718_5017 99
417 3300041491 Ga0451833_1293279 Ga0451833_1293279_140_466 99
418 3300041492 Ga0451835_0100703 Ga0451835_0100703_161_460 99
419 3300041492 Ga0451835_0104935 Ga0451835_0104935_1013_1312 99
420 3300041492 Ga0451835_1242391 Ga0451835_1242391_3717_4016 99
421 3300041494 Ga0451837_0165450 Ga0451837_0165450_873_1172 99
422 3300041494 Ga0451837_0249402 Ga0451837_0249402_240_539 99
423 3300041494 Ga0451837_0629808 Ga0451837_0629808_346_672 99
424 3300041494 Ga0451837_1458164 Ga0451837_1458164_157_456 99
425 3300041496 Ga0451839_0352628 Ga0451839_0352628_3130_3429 99
426 3300041496 Ga0451839_1460354 Ga0451839_1460354_276_575 99
427 3300041496 Ga0451839_1571223 Ga0451839_1571223_216_515 99
428 3300041498 Ga0451841_0110022 Ga0451841_0110022_4804_5103 99
429 3300041498 Ga0451841_0176674 Ga0451841_0176674_134_433 99
430 3300041501 Ga0451845_0361663 Ga0451845_0361663_3528_3827 99
431 3300041501 Ga0451845_0715021 Ga0451845_0715021_555_854 99
432 3300041503 Ga0451847_0075758 Ga0451847_0075758_1137_1436 99
433 3300041503 Ga0451847_0206364 Ga0451847_0206364_4796_5095 99
434 3300041505 Ga0451849_0181325 Ga0451849_0181325_8973_9272 99
435 3300041505 Ga0451849_0692168 Ga0451849_0692168_1301_1600 99
436 3300041505 Ga0451849_1136831 Ga0451849_1136831_194_493 99
437 3300041505 Ga0451849_1311520 Ga0451849_1311520_1939_2238 99
438 3300041505 Ga0451849_1313199 Ga0451849_1313199_278_577 99
439 3300041505 Ga0451849_1476207 Ga0451849_1476207_2830_3129 99
440 3300041507 Ga0451851_0003572 Ga0451851_0003572_9097_9396 99
441 3300041507 Ga0451851_0545725 Ga0451851_0545725_368_667 99
442 3300041509 Ga0451843_0163406 Ga0451843_0163406_1217_1516 99
443 3300041509 Ga0451843_0286922 Ga0451843_0286922_1173_1472 99
444 3300041509 Ga0451843_1204107 Ga0451843_1204107_217_516 99
445 3300041511 Ga0451855_0138740 Ga0451855_0138740_213_512 99
446 3300041511 Ga0451855_0302858 Ga0451855_0302858_79_378 99
447 3300041511 Ga0451855_1291389 Ga0451855_1291389_1862_2161 99
448 3300041512 Ga0451853_0334798 Ga0451853_0334798_1995_2294 99
449 3300041512 Ga0451853_1298236 Ga0451853_1298236_146_445 99
450 3300041512 Ga0451853_2245295 Ga0451853_2245295_45_344 99
451 3300042007 Ga0439449_0054969 Ga0439449_0054969_674_973 99
452 3300042007 Ga0439449_0059762 Ga0439449_0059762_449_748 99
453 3300042007 Ga0439449_0254279 Ga0439449_0254279_247_546 99
454 3300042010 Ga0439452_088965 Ga0439452_088965_339_638 99
455 3300042015 Ga0439462_0071524 Ga0439462_0071524_424_723 99
456 3300042015 Ga0439462_0145536 Ga0439462_0145536_264_563 99
457 3300046453 Ga0495627_010666 Ga0495627_010666_1030_1332 99
458 3300046460 Ga0495638_0007091 Ga0495638_0007091_3007_3306 99
459 3300046471 Ga0495650_0159915 Ga0495650_0159915_422_724 99
460 3300046474 Ga0495605_0054976 Ga0495605_0054976_1465_1764 99
461 3300046492 Ga0495585_0002471 Ga0495585_0002471_3606_3905 99
462 3300046492 Ga0495585_0037727 Ga0495585_0037727_713_1012 99
463 3300046500 Ga0495596_0020036 Ga0495596_0020036_771_1070 99
464 3300046501 Ga0495607_0059013 Ga0495607_0059013_910_1212 99
465 3300046501 Ga0495607_0203550 Ga0495607_0203550_635_934 99
466 3300046501 Ga0495607_0350850 Ga0495607_0350850_324_623 99
467 3300046506 Ga0495583_0012955 Ga0495583_0012955_834_1133 99
468 3300046506 Ga0495583_0141675 Ga0495583_0141675_154_456 99
469 3300046507 Ga0495606_0017129 Ga0495606_0017129_364_663 99
470 3300046512 Ga0495610_0022958 Ga0495610_0022958_1524_1826 99
471 3300046512 Ga0495610_0140817 Ga0495610_0140817_601_900 99
472 3300046512 Ga0495610_0155411 Ga0495610_0155411_545_844 99
473 3300046513 Ga0495616_0070499 Ga0495616_0070499_465_764 99
474 3300046515 Ga0495620_0000107 Ga0495620_0000107_43662_43964 99
475 3300046515 Ga0495620_0001213 Ga0495620_0001213_5610_5909 99
476 3300046515 Ga0495620_0344642 Ga0495620_0344642_88_387 99
477 3300046518 Ga0495631_0001797 Ga0495631_0001797_6322_6621 99
478 3300046518 Ga0495631_0196051 Ga0495631_0196051_341_640 99
479 3300046519 Ga0495632_0011639 Ga0495632_0011639_379_678 99
480 3300046520 Ga0495637_0006745 Ga0495637_0006745_1762_2064 99
481 3300046520 Ga0495637_0117152 Ga0495637_0117152_693_992 99
482 3300046522 Ga0495643_0003041 Ga0495643_0003041_9701_10000 99
483 3300046524 Ga0495648_0030894 Ga0495648_0030894_958_1257 99
484 3300046525 Ga0495663_0159475 Ga0495663_0159475_291_590 99
485 3300046530 Ga0495654_0004327 Ga0495654_0004327_4995_5297 99
486 3300046538 Ga0495609_0007882 Ga0495609_0007882_4229_4531 99
487 3300046557 Ga0495622_0329725 Ga0495622_0329725_347_649 99
488 3300046558 Ga0495633_0012813 Ga0495633_0012813_3775_4074 99
489 3300046558 Ga0495633_0031063 Ga0495633_0031063_535_834 99
490 3300046558 Ga0495633_0504524 Ga0495633_0504524_162_461 99
491 3300046615 Ga0495656_0020493 Ga0495656_0020493_822_1121 99
492 3300046616 Ga0495668_0042877 Ga0495668_0042877_875_1174 99
493 3300046648 Ga0495611_0144159 Ga0495611_0144159_346_645 99
494 3300046660 Ga0495625_0004571 Ga0495625_0004571_3020_3319 99
495 3300046660 Ga0495625_0011236 Ga0495625_0011236_468_767 99
496 3300046660 Ga0495625_0018841 Ga0495625_0018841_2617_2916 99
497 3300046660 Ga0495625_0057994 Ga0495625_0057994_2242_2541 99
498 3300046660 Ga0495625_0143335 Ga0495625_0143335_278_580 99
499 3300046665 Ga0495661_0400498 Ga0495661_0400498_149_451 99
500 3300046674 Ga0495588_0016014 Ga0495588_0016014_1406_1708 99
501 3300046674 Ga0495588_0036095 Ga0495588_0036095_223_525 99
502 3300046674 Ga0495588_0086832 Ga0495588_0086832_1049_1348 99
503 3300046674 Ga0495588_0364812 Ga0495588_0364812_20_319 99
504 3300046691 Ga0495670_0050275 Ga0495670_0050275_552_851 99
505 3300046692 Ga0495671_0002228 Ga0495671_0002228_1552_1854 99
506 3300046692 Ga0495671_0166133 Ga0495671_0166133_310_609 99
507 3300046692 Ga0495671_0243608 Ga0495671_0243608_191_490 99
508 3300046694 Ga0495649_0040391 Ga0495649_0040391_2122_2421 99
509 3300046694 Ga0495649_0059852 Ga0495649_0059852_1216_1515 99
510 3300046809 Ga0495600_0957550 Ga0495600_0957550_50_352 99
511 3300046810 Ga0495660_0111281 Ga0495660_0111281_454_753 99
512 3300047443 Ga0495687_027851 Ga0495687_027851_1362_1661 99
513 3300047443 Ga0495687_032729 Ga0495687_032729_513_812 99
514 3300047446 Ga0495679_109075 Ga0495679_109075_88_387 99
515 3300047470 Ga0495681_0008822 Ga0495681_0008822_41_340 99
516 3300047470 Ga0495681_0055527 Ga0495681_0055527_514_816 99
517 3300047470 Ga0495681_0080431 Ga0495681_0080431_761_1060 99
518 3300047472 Ga0495686_0054389 Ga0495686_0054389_1163_1462 99
519 3300047472 Ga0495686_0344089 Ga0495686_0344089_106_405 99
520 3300048090 Ga0495615_0087130 Ga0495615_0087130_261_560 99
521 3300048090 Ga0495615_0292930 Ga0495615_0292930_191_490 99
522 3300048903 Ga0496100_0152488 Ga0496100_0152488_1328_1627 99
523 3300048905 Ga0496102_0098274 Ga0496102_0098274_457_756 99
524 3300048906 Ga0496103_0297945 Ga0496103_0297945_569_868 99
525 3300048907 Ga0496104_0016015 Ga0496104_0016015_1717_2016 99
526 3300048908 Ga0496105_0000087 Ga0496105_0000087_58408_58707 99
527 3300048909 Ga0496106_0235010 Ga0496106_0235010_1065_1364 99
528 3300048910 Ga0496107_0292682 Ga0496107_0292682_509_808 99
529 3300048912 Ga0496109_0026714 Ga0496109_0026714_1179_1478 99
530 3300048919 Ga0496116_0038702 Ga0496116_0038702_1886_2185 99
531 3300048920 Ga0496117_0093904 Ga0496117_0093904_1113_1412 99
532 3300048922 Ga0496119_0000569 Ga0496119_0000569_7823_8122 99
533 3300048922 Ga0496119_0020439 Ga0496119_0020439_4507_4806 99
534 3300048922 Ga0496119_0498274 Ga0496119_0498274_149_448 99
535 3300048923 Ga0496120_0020913 Ga0496120_0020913_3178_3477 99
536 3300048924 Ga0496121_0191439 Ga0496121_0191439_277_576 99
537 3300048924 Ga0496121_0487923 Ga0496121_0487923_353_652 99
538 3300048924 Ga0496121_0725498 Ga0496121_0725498_239_538 99
539 3300048924 Ga0496121_0725780 Ga0496121_0725780_216_515 99
540 3300048925 Ga0496122_0005173 Ga0496122_0005173_11237_11536 99
541 3300048925 Ga0496122_0061402 Ga0496122_0061402_532_831 99
542 3300048926 Ga0496123_0114871 Ga0496123_0114871_1056_1355 99
543 3300048927 Ga0496124_0018666 Ga0496124_0018666_5410_5709 99
544 3300048927 Ga0496124_0027146 Ga0496124_0027146_2983_3282 99
545 3300048929 Ga0496126_0001273 Ga0496126_0001273_13317_13616 99
546 3300048929 Ga0496126_0055713 Ga0496126_0055713_2233_2532 99
547 3300049459 Ga0495678_096969 Ga0495678_096969_602_901 99
548 3300049460 Ga0495682_0163967 Ga0495682_0163967_144_443 99
549 3300049569 Ga0501032_0388342 Ga0501032_0388342_100_399 99
550 3300049570 Ga0501033_0000054 Ga0501033_0000054_76601_76900 99
551 3300049570 Ga0501033_0077354 Ga0501033_0077354_2082_2381 99
552 3300049571 Ga0501034_0054016 Ga0501034_0054016_3065_3364 99
553 3300049571 Ga0501034_0170044 Ga0501034_0170044_830_1129 99
554 3300049572 Ga0501036_1235131 Ga0501036_1235131_297_596 99
555 3300049822 Ga0501035_0001626 Ga0501035_0001626_14372_14671 99
556 3300049822 Ga0501035_0668635 Ga0501035_0668635_267_566 99
557 3300049823 Ga0501044_0438234 Ga0501044_0438234_739_1038 99
558 3300050489 nmdc:mga03683_69828_c1 nmdc:mga03683_69828_c1_381_680 99
559 3300050492 nmdc:mga0yw44_446206_c1 nmdc:mga0yw44_446206_c1_166_465 99
560 3300050493 nmdc:mga0k408_78177_c1 nmdc:mga0k408_78177_c1_296_595 99
561 3300050494 nmdc:mga06z11_278895_c1 nmdc:mga06z11_278895_c1_273_587 99
562 3300050496 nmdc:mga07m45_23918_c2 nmdc:mga07m45_23918_c2_1428_1727 99
563 3300050516 nmdc:mga0sz30_155921_c1 nmdc:mga0sz30_155921_c1_326_625 99
564 3300050516 nmdc:mga0sz30_196157_c1 nmdc:mga0sz30_196157_c1_269_568 99
565 3300053079 Ga0500610_0131126 Ga0500610_0131126_336_638 99
566 3300053087 Ga0500643_058119 Ga0500643_058119_565_864 99
567 3300053104 Ga0500556_0314621 Ga0500556_0314621_274_576 99
568 3300053105 Ga0500557_001176 Ga0500557_001176_2511_2810 99
569 3300053117 Ga0500593_159323 Ga0500593_159323_295_594 99
570 3300053118 Ga0500594_0001801 Ga0500594_0001801_3645_3944 99
571 3300053118 Ga0500594_0022369 Ga0500594_0022369_42_344 99
572 3300053125 Ga0500618_000097 Ga0500618_000097_32033_32332 99
573 3300053125 Ga0500618_008258 Ga0500618_008258_1406_1708 99
574 3300053134 Ga0500658_0287227 Ga0500658_0287227_373_672 99
575 3300053136 Ga0500559_0408854 Ga0500559_0408854_113_412 99
576 3300053137 Ga0500561_0060087 Ga0500561_0060087_249_551 99
577 3300053140 Ga0500573_0003603 Ga0500573_0003603_2746_3048 99
578 3300053152 Ga0500606_044720 Ga0500606_044720_893_1192 99
579 3300053153 Ga0500616_0000438 Ga0500616_0000438_46278_46577 99
580 3300053156 Ga0500622_0000278 Ga0500622_0000278_16844_17143 99
581 3300053177 Ga0500636_0000231 Ga0500636_0000231_18195_18494 99
582 3300053177 Ga0500636_0017031 Ga0500636_0017031_3597_3899 99
583 3300053177 Ga0500636_0132696 Ga0500636_0132696_108_410 99
584 3300053177 Ga0500636_0136935 Ga0500636_0136935_386_685 99
585 3300053727 Ga0500611_253049 Ga0500611_253049_89_388 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05101

VirB3

Type IV secretory pathway, VirB3-like protein

18

106

0.88

Feature Viewer

pLDDT pTM Quality
76.54 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map