F466436
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 585 | 262 | 1170 | 104 |
Family's Representative Sequence
| Representative Sequence | 3300005617|Ga0068859_100166107|Ga0068859_1001661072 |
| Length | 128 |
| Sequence | MADPWDLGLGHSLELGAWSLELSIAMTPLVCYLLLSALLFSIGLAGALTRRNAIIVLIGIELMLNAANLNFIAFWRYGEHPETLTGVMFAIFSIGVAAAEAAVGLALIIAVYRHYKTTNLDQVDSMKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 170 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 175 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 184 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 187 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 188 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 189 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 190 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 191 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 192 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 193 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 194 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 238 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 239 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 240 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 246 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 247 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 248 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 249 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 250 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 251 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.03 |
| Rhizosphere | 91.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 36.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068859_100166107 | 3300005617 | Bacteria | 2287 |
| 2 | JGI24743J22301_10027145 | 3300001991 | Bacteria | 1117 |
| 3 | JGI24035J26624_1004190 | 3300002126 | Unclassified | 1366 |
| 4 | JGI24035J26624_1008629 | 3300002126 | Unclassified | 998 |
| 5 | JGI24035J26624_1022848 | 3300002126 | Unclassified | 665 |
| 6 | Ga0065704_10753543 | 3300005289 | Bacteria | 525 |
| 7 | Ga0065712_10178572 | 3300005290 | Bacteria | 1205 |
| 8 | Ga0065712_10491495 | 3300005290 | Bacteria | 648 |
| 9 | Ga0065712_10754884 | 3300005290 | Unclassified | 527 |
| 10 | Ga0065715_10001597 | 3300005293 | Bacteria | 7028 |
| 11 | Ga0065715_10024002 | 3300005293 | Unclassified | 2125 |
| 12 | Ga0065715_10136727 | 3300005293 | Bacteria | 1916 |
| 13 | Ga0065715_10183208 | 3300005293 | Bacteria | 1448 |
| 14 | Ga0065715_10519934 | 3300005293 | Bacteria | 764 |
| 15 | Ga0065715_10878283 | 3300005293 | Unclassified | 582 |
| 16 | Ga0065707_10372418 | 3300005295 | Unclassified | 870 |
| 17 | Ga0065707_10958262 | 3300005295 | Bacteria | 550 |
| 18 | Ga0070658_10214016 | 3300005327 | Bacteria | 1628 |
| 19 | Ga0070658_11910267 | 3300005327 | Unclassified | 513 |
| 20 | Ga0070676_10305136 | 3300005328 | Unclassified | 1080 |
| 21 | Ga0070683_100012298 | 3300005329 | Bacteria | 7434 |
| 22 | Ga0070683_100057618 | 3300005329 | Bacteria | 3609 |
| 23 | Ga0070683_100144620 | 3300005329 | Bacteria | 2253 |
| 24 | Ga0070683_100170395 | 3300005329 | Bacteria | 2066 |
| 25 | Ga0070683_100273086 | 3300005329 | Bacteria | 1608 |
| 26 | Ga0070690_100098562 | 3300005330 | Bacteria | 1934 |
| 27 | Ga0070690_100145467 | 3300005330 | Bacteria | 1612 |
| 28 | Ga0070690_100669578 | 3300005330 | Bacteria | 794 |
| 29 | Ga0070690_101369050 | 3300005330 | Unclassified | 569 |
| 30 | Ga0070670_100905743 | 3300005331 | Unclassified | 800 |
| 31 | Ga0068869_100119508 | 3300005334 | Bacteria | 2014 |
| 32 | Ga0068869_101570938 | 3300005334 | Bacteria | 585 |
| 33 | Ga0070666_10046252 | 3300005335 | Bacteria | 2918 |
| 34 | Ga0070680_100241830 | 3300005336 | Bacteria | 1526 |
| 35 | Ga0070682_100276116 | 3300005337 | Unclassified | 1223 |
| 36 | Ga0068868_100974153 | 3300005338 | Unclassified | 774 |
| 37 | Ga0070660_100069377 | 3300005339 | Bacteria | 2749 |
| 38 | Ga0070660_100264634 | 3300005339 | Unclassified | 1404 |
| 39 | Ga0070660_100646468 | 3300005339 | Unclassified | 885 |
| 40 | Ga0070689_100005561 | 3300005340 | Bacteria | 8621 |
| 41 | Ga0070689_100021875 | 3300005340 | Bacteria | 4766 |
| 42 | Ga0070689_100029214 | 3300005340 | Bacteria | 4171 |
| 43 | Ga0070689_100168731 | 3300005340 | Unclassified | 1772 |
| 44 | Ga0070689_100223732 | 3300005340 | Bacteria | 1545 |
| 45 | Ga0070689_100318212 | 3300005340 | Bacteria | 1299 |
| 46 | Ga0070689_100450691 | 3300005340 | Unclassified | 1095 |
| 47 | Ga0070689_101151388 | 3300005340 | Bacteria | 695 |
| 48 | Ga0070687_100677061 | 3300005343 | Unclassified | 718 |
| 49 | Ga0070687_100699575 | 3300005343 | Unclassified | 708 |
| 50 | Ga0070687_100764788 | 3300005343 | Bacteria | 681 |
| 51 | Ga0070661_100056696 | 3300005344 | Unclassified | 2870 |
| 52 | Ga0070661_101863884 | 3300005344 | Unclassified | 511 |
| 53 | Ga0070692_10386225 | 3300005345 | Bacteria | 880 |
| 54 | Ga0070692_10983100 | 3300005345 | Bacteria | 589 |
| 55 | Ga0070668_100832245 | 3300005347 | Unclassified | 822 |
| 56 | Ga0070675_100002295 | 3300005354 | Bacteria | 14192 |
| 57 | Ga0070675_100021384 | 3300005354 | Bacteria | 5170 |
| 58 | Ga0070675_100208859 | 3300005354 | Bacteria | 1696 |
| 59 | Ga0070675_100704952 | 3300005354 | Bacteria | 919 |
| 60 | Ga0070671_100560697 | 3300005355 | Unclassified | 985 |
| 61 | Ga0070671_101857597 | 3300005355 | Unclassified | 536 |
| 62 | Ga0070674_101225821 | 3300005356 | Unclassified | 667 |
| 63 | Ga0070674_101693213 | 3300005356 | Bacteria | 572 |
| 64 | Ga0070673_100013472 | 3300005364 | Bacteria | 5658 |
| 65 | Ga0070673_102233088 | 3300005364 | Bacteria | 520 |
| 66 | Ga0070688_100080559 | 3300005365 | Bacteria | 2106 |
| 67 | Ga0070688_100091289 | 3300005365 | Bacteria | 1990 |
| 68 | Ga0070688_100102486 | 3300005365 | Bacteria | 1889 |
| 69 | Ga0070688_100198105 | 3300005365 | Unclassified | 1403 |
| 70 | Ga0070688_100239750 | 3300005365 | Unclassified | 1286 |
| 71 | Ga0070688_100365608 | 3300005365 | Bacteria | 1060 |
| 72 | Ga0070688_100616382 | 3300005365 | Bacteria | 832 |
| 73 | Ga0070688_100989886 | 3300005365 | Unclassified | 667 |
| 74 | Ga0070659_100465066 | 3300005366 | Unclassified | 1074 |
| 75 | Ga0070659_101800676 | 3300005366 | Unclassified | 548 |
| 76 | Ga0070667_100557517 | 3300005367 | Unclassified | 1053 |
| 77 | Ga0070703_10351168 | 3300005406 | Bacteria | 629 |
| 78 | Ga0070709_10518569 | 3300005434 | Bacteria | 908 |
| 79 | Ga0070709_11790248 | 3300005434 | Unclassified | 502 |
| 80 | Ga0070714_100011722 | 3300005435 | Bacteria | 6965 |
| 81 | Ga0070714_100136543 | 3300005435 | Bacteria | 2197 |
| 82 | Ga0070714_100349688 | 3300005435 | Bacteria | 1388 |
| 83 | Ga0070713_100002433 | 3300005436 | Bacteria | 12141 |
| 84 | Ga0070713_100033654 | 3300005436 | Bacteria | 4108 |
| 85 | Ga0070713_100197175 | 3300005436 | Bacteria | 1817 |
| 86 | Ga0070713_100361569 | 3300005436 | Bacteria | 1349 |
| 87 | Ga0070713_100500963 | 3300005436 | Bacteria | 1146 |
| 88 | Ga0070713_100738897 | 3300005436 | Unclassified | 941 |
| 89 | Ga0070713_101297880 | 3300005436 | Bacteria | 705 |
| 90 | Ga0070710_10118254 | 3300005437 | Unclassified | 1601 |
| 91 | Ga0070710_10136276 | 3300005437 | Bacteria | 1501 |
| 92 | Ga0070710_10433748 | 3300005437 | Unclassified | 887 |
| 93 | Ga0070701_10027591 | 3300005438 | Bacteria | 2783 |
| 94 | Ga0070701_10193214 | 3300005438 | Unclassified | 1199 |
| 95 | Ga0070701_10627163 | 3300005438 | Unclassified | 715 |
| 96 | Ga0070711_100070703 | 3300005439 | Bacteria | 2458 |
| 97 | Ga0070711_100195703 | 3300005439 | Bacteria | 1556 |
| 98 | Ga0070711_100242186 | 3300005439 | Unclassified | 1411 |
| 99 | Ga0070711_100352174 | 3300005439 | Bacteria | 1184 |
| 100 | Ga0070711_101300255 | 3300005439 | Bacteria | 631 |
| 101 | Ga0070711_101997695 | 3300005439 | Unclassified | 510 |
| 102 | Ga0070705_100043333 | 3300005440 | Bacteria | 2578 |
| 103 | Ga0070705_100113590 | 3300005440 | Bacteria | 1735 |
| 104 | Ga0070705_100334844 | 3300005440 | Unclassified | 1098 |
| 105 | Ga0070705_100940622 | 3300005440 | Unclassified | 698 |
| 106 | Ga0070700_100036540 | 3300005441 | Unclassified | 2980 |
| 107 | Ga0070694_100040864 | 3300005444 | Bacteria | 3092 |
| 108 | Ga0070694_100601895 | 3300005444 | Bacteria | 885 |
| 109 | Ga0070708_100428329 | 3300005445 | Bacteria | 1248 |
| 110 | Ga0070708_100472574 | 3300005445 | Bacteria | 1183 |
| 111 | Ga0070663_100562370 | 3300005455 | Unclassified | 955 |
| 112 | Ga0070678_100033230 | 3300005456 | Bacteria | 3579 |
| 113 | Ga0070678_100042379 | 3300005456 | Bacteria | 3234 |
| 114 | Ga0070662_100108599 | 3300005457 | Bacteria | 2110 |
| 115 | Ga0070681_10033474 | 3300005458 | Bacteria | 5159 |
| 116 | Ga0070681_10057951 | 3300005458 | Bacteria | 3854 |
| 117 | Ga0070681_10075697 | 3300005458 | Bacteria | 3326 |
| 118 | Ga0070685_10010338 | 3300005466 | Bacteria | 4846 |
| 119 | Ga0070685_11249784 | 3300005466 | Unclassified | 566 |
| 120 | Ga0070706_100051459 | 3300005467 | Bacteria | 3801 |
| 121 | Ga0070706_100099079 | 3300005467 | Bacteria | 2708 |
| 122 | Ga0070706_100169404 | 3300005467 | Bacteria | 2039 |
| 123 | Ga0070706_100237258 | 3300005467 | Unclassified | 1703 |
| 124 | Ga0070706_100282946 | 3300005467 | Bacteria | 1548 |
| 125 | Ga0070706_100447081 | 3300005467 | Bacteria | 1203 |
| 126 | Ga0070707_100027569 | 3300005468 | Bacteria | 5404 |
| 127 | Ga0070707_100040711 | 3300005468 | Bacteria | 4446 |
| 128 | Ga0070707_100213872 | 3300005468 | Bacteria | 1879 |
| 129 | Ga0070707_100375308 | 3300005468 | Bacteria | 1382 |
| 130 | Ga0070699_100090678 | 3300005518 | Bacteria | 2672 |
| 131 | Ga0070699_100282132 | 3300005518 | Bacteria | 1488 |
| 132 | Ga0070699_101716806 | 3300005518 | Bacteria | 575 |
| 133 | Ga0070679_100092351 | 3300005530 | Unclassified | 3014 |
| 134 | Ga0070679_100376791 | 3300005530 | Bacteria | 1366 |
| 135 | Ga0070684_100004169 | 3300005535 | Bacteria | 10953 |
| 136 | Ga0070684_100023466 | 3300005535 | Bacteria | 5161 |
| 137 | Ga0070684_100132784 | 3300005535 | Unclassified | 2246 |
| 138 | Ga0070684_100322276 | 3300005535 | Unclassified | 1419 |
| 139 | Ga0070684_100570090 | 3300005535 | Bacteria | 1051 |
| 140 | Ga0070697_100656919 | 3300005536 | Unclassified | 924 |
| 141 | Ga0070686_100007844 | 3300005544 | Bacteria | 5967 |
| 142 | Ga0070686_100064116 | 3300005544 | Bacteria | 2382 |
| 143 | Ga0070686_100129981 | 3300005544 | Bacteria | 1740 |
| 144 | Ga0070686_100257741 | 3300005544 | Unclassified | 1277 |
| 145 | Ga0070695_100174600 | 3300005545 | Bacteria | 1518 |
| 146 | Ga0070695_101610969 | 3300005545 | Bacteria | 542 |
| 147 | Ga0070696_100478583 | 3300005546 | Bacteria | 987 |
| 148 | Ga0070693_100066409 | 3300005547 | Unclassified | 2111 |
| 149 | Ga0070665_100183122 | 3300005548 | Bacteria | 2095 |
| 150 | Ga0070665_100237094 | 3300005548 | Bacteria | 1825 |
| 151 | Ga0070665_101380766 | 3300005548 | Unclassified | 714 |
| 152 | Ga0070665_101632511 | 3300005548 | Bacteria | 652 |
| 153 | Ga0070704_100018382 | 3300005549 | Bacteria | 4469 |
| 154 | Ga0070704_100019290 | 3300005549 | Bacteria | 4380 |
| 155 | Ga0070704_100073682 | 3300005549 | Bacteria | 2488 |
| 156 | Ga0070704_100687976 | 3300005549 | Unclassified | 906 |
| 157 | Ga0068855_100446940 | 3300005563 | Unclassified | 1411 |
| 158 | Ga0068855_100482810 | 3300005563 | Unclassified | 1349 |
| 159 | Ga0070664_100051546 | 3300005564 | Unclassified | 3484 |
| 160 | Ga0070664_100417274 | 3300005564 | Bacteria | 1229 |
| 161 | Ga0070664_101319292 | 3300005564 | Unclassified | 682 |
| 162 | Ga0070664_101709313 | 3300005564 | Bacteria | 596 |
| 163 | Ga0068857_100166642 | 3300005577 | Bacteria | 2001 |
| 164 | Ga0068857_100773930 | 3300005577 | Bacteria | 915 |
| 165 | Ga0068857_100956614 | 3300005577 | Unclassified | 823 |
| 166 | Ga0068857_101325736 | 3300005577 | Unclassified | 699 |
| 167 | Ga0068856_100383189 | 3300005614 | Bacteria | 1425 |
| 168 | Ga0068856_101338327 | 3300005614 | Unclassified | 731 |
| 169 | Ga0070702_100771002 | 3300005615 | Unclassified | 741 |
| 170 | Ga0070702_100904636 | 3300005615 | Bacteria | 691 |
| 171 | Ga0068852_102613715 | 3300005616 | Unclassified | 524 |
| 172 | Ga0068859_100102226 | 3300005617 | Unclassified | 2923 |
| 173 | Ga0068859_102652443 | 3300005617 | Bacteria | 551 |
| 174 | Ga0068864_100680289 | 3300005618 | Unclassified | 1004 |
| 175 | Ga0068861_101001488 | 3300005719 | Unclassified | 798 |
| 176 | Ga0068863_100022395 | 3300005841 | Bacteria | 6033 |
| 177 | Ga0068863_100027512 | 3300005841 | Bacteria | 5424 |
| 178 | Ga0068863_100281197 | 3300005841 | Bacteria | 1612 |
| 179 | Ga0068863_100392517 | 3300005841 | Bacteria | 1356 |
| 180 | Ga0068863_100589381 | 3300005841 | Bacteria | 1100 |
| 181 | Ga0068863_101360805 | 3300005841 | Unclassified | 717 |
| 182 | Ga0068863_101565948 | 3300005841 | Bacteria | 668 |
| 183 | Ga0068858_100022010 | 3300005842 | Bacteria | 5953 |
| 184 | Ga0068858_100421802 | 3300005842 | Unclassified | 1283 |
| 185 | Ga0068858_100641735 | 3300005842 | Unclassified | 1031 |
| 186 | Ga0068858_101066781 | 3300005842 | Bacteria | 793 |
| 187 | Ga0068860_100192568 | 3300005843 | Unclassified | 1974 |
| 188 | Ga0068860_100680170 | 3300005843 | Bacteria | 1038 |
| 189 | Ga0068862_100160120 | 3300005844 | Unclassified | 2009 |
| 190 | Ga0081455_10005459 | 3300005937 | Bacteria | 13939 |
| 191 | Ga0081455_10050364 | 3300005937 | Bacteria | 3583 |
| 192 | Ga0081455_10279615 | 3300005937 | Bacteria | 1206 |
| 193 | Ga0081455_10691437 | 3300005937 | Unclassified | 651 |
| 194 | Ga0081540_1029957 | 3300005983 | Bacteria | 3021 |
| 195 | Ga0081540_1071114 | 3300005983 | Bacteria | 1609 |
| 196 | Ga0081539_10042990 | 3300005985 | Bacteria | 2625 |
| 197 | Ga0081539_10158201 | 3300005985 | Bacteria | 1083 |
| 198 | Ga0070717_10856356 | 3300006028 | Unclassified | 827 |
| 199 | Ga0070717_10963032 | 3300006028 | Bacteria | 777 |
| 200 | Ga0070715_10554682 | 3300006163 | Unclassified | 666 |
| 201 | Ga0070716_100020095 | 3300006173 | Bacteria | 3502 |
| 202 | Ga0070716_100044888 | 3300006173 | Bacteria | 2478 |
| 203 | Ga0070716_100190357 | 3300006173 | Bacteria | 1355 |
| 204 | Ga0070712_100259398 | 3300006175 | Unclassified | 1392 |
| 205 | Ga0070712_100454993 | 3300006175 | Unclassified | 1066 |
| 206 | Ga0070712_100533051 | 3300006175 | Bacteria | 988 |
| 207 | Ga0070712_100759436 | 3300006175 | Unclassified | 830 |
| 208 | Ga0070712_101745269 | 3300006175 | Unclassified | 545 |
| 209 | Ga0070712_101808369 | 3300006175 | Unclassified | 535 |
| 210 | Ga0097621_100280986 | 3300006237 | Unclassified | 1465 |
| 211 | Ga0097621_100283188 | 3300006237 | Bacteria | 1460 |
| 212 | Ga0097621_101465767 | 3300006237 | Bacteria | 647 |
| 213 | Ga0068871_100051337 | 3300006358 | Bacteria | 3338 |
| 214 | Ga0068871_100161261 | 3300006358 | Bacteria | 1918 |
| 215 | Ga0068871_100284403 | 3300006358 | Bacteria | 1447 |
| 216 | Ga0068871_100680462 | 3300006358 | Bacteria | 941 |
| 217 | Ga0068871_102301300 | 3300006358 | Unclassified | 514 |
| 218 | Ga0075428_101026157 | 3300006844 | Bacteria | 873 |
| 219 | Ga0075428_101027198 | 3300006844 | Bacteria | 872 |
| 220 | Ga0075431_100398940 | 3300006847 | Unclassified | 1377 |
| 221 | Ga0075433_10420951 | 3300006852 | Viruses | 1178 |
| 222 | Ga0075434_100681927 | 3300006871 | Unclassified | 1045 |
| 223 | Ga0075434_101217591 | 3300006871 | Bacteria | 765 |
| 224 | Ga0075434_101859389 | 3300006871 | Unclassified | 608 |
| 225 | Ga0075429_101375452 | 3300006880 | Viruses | 615 |
| 226 | Ga0075436_100700503 | 3300006914 | Unclassified | 750 |
| 227 | Ga0097620_100102222 | 3300006931 | Unclassified | 2923 |
| 228 | Ga0097620_100140791 | 3300006931 | Bacteria | 2486 |
| 229 | Ga0097620_100166107 | 3300006931 | Bacteria | 2287 |
| 230 | Ga0097620_100356974 | 3300006931 | Bacteria | 1556 |
| 231 | Ga0097620_102653617 | 3300006931 | Bacteria | 551 |
| 232 | Ga0099795_10167114 | 3300007788 | Unclassified | 911 |
| 233 | Ga0105240_10156929 | 3300009093 | Bacteria | 2705 |
| 234 | Ga0105240_10359494 | 3300009093 | Bacteria | 1650 |
| 235 | Ga0105240_11142418 | 3300009093 | Bacteria | 827 |
| 236 | Ga0105240_11233102 | 3300009093 | Unclassified | 791 |
| 237 | Ga0105240_11744314 | 3300009093 | Unclassified | 649 |
| 238 | Ga0111539_10027560 | 3300009094 | Bacteria | 6939 |
| 239 | Ga0111539_10060065 | 3300009094 | Bacteria | 4506 |
| 240 | Ga0111539_10135725 | 3300009094 | Bacteria | 2881 |
| 241 | Ga0111539_10549486 | 3300009094 | Bacteria | 1345 |
| 242 | Ga0111539_12128777 | 3300009094 | Unclassified | 651 |
| 243 | Ga0111539_13452521 | 3300009094 | Bacteria | 508 |
| 244 | Ga0105245_10113798 | 3300009098 | Bacteria | 2520 |
| 245 | Ga0105245_11400808 | 3300009098 | Unclassified | 749 |
| 246 | Ga0114129_10153888 | 3300009147 | Bacteria | 3146 |
| 247 | Ga0114129_10249865 | 3300009147 | Bacteria | 2381 |
| 248 | Ga0114129_10589481 | 3300009147 | Unclassified | 1442 |
| 249 | Ga0114129_12193135 | 3300009147 | Unclassified | 665 |
| 250 | Ga0114129_12303310 | 3300009147 | Bacteria | 646 |
| 251 | Ga0105243_11522980 | 3300009148 | Bacteria | 693 |
| 252 | Ga0105241_10027672 | 3300009174 | Bacteria | 4223 |
| 253 | Ga0105241_10199823 | 3300009174 | Bacteria | 1669 |
| 254 | Ga0105241_11349607 | 3300009174 | Bacteria | 681 |
| 255 | Ga0105242_10273814 | 3300009176 | Bacteria | 1530 |
| 256 | Ga0105242_10330293 | 3300009176 | Unclassified | 1402 |
| 257 | Ga0105242_10475149 | 3300009176 | Unclassified | 1183 |
| 258 | Ga0105242_11617811 | 3300009176 | Bacteria | 682 |
| 259 | Ga0105248_10393683 | 3300009177 | Unclassified | 1560 |
| 260 | Ga0105248_10437403 | 3300009177 | Bacteria | 1473 |
| 261 | Ga0105238_10222939 | 3300009551 | Unclassified | 1862 |
| 262 | Ga0105238_10462876 | 3300009551 | Bacteria | 1266 |
| 263 | Ga0105238_10638138 | 3300009551 | Bacteria | 1074 |
| 264 | Ga0105238_11077916 | 3300009551 | Unclassified | 826 |
| 265 | Ga0105238_11207041 | 3300009551 | Unclassified | 781 |
| 266 | Ga0105238_12645902 | 3300009551 | Unclassified | 538 |
| 267 | Ga0105238_12787984 | 3300009551 | Unclassified | 525 |
| 268 | Ga0105249_10060185 | 3300009553 | Bacteria | 3483 |
| 269 | Ga0105249_11463595 | 3300009553 | Bacteria | 755 |
| 270 | Ga0105249_11869794 | 3300009553 | Unclassified | 673 |
| 271 | Ga0099796_10263031 | 3300010159 | Unclassified | 720 |
| 272 | Ga0105239_10190980 | 3300010375 | Bacteria | 2292 |
| 273 | Ga0105239_10328666 | 3300010375 | Bacteria | 1724 |
| 274 | Ga0105239_10644182 | 3300010375 | Bacteria | 1210 |
| 275 | Ga0105239_11310316 | 3300010375 | Bacteria | 835 |
| 276 | Ga0105239_12215621 | 3300010375 | Bacteria | 639 |
| 277 | Ga0105246_10139917 | 3300011119 | Unclassified | 1819 |
| 278 | Ga0105246_11445149 | 3300011119 | Unclassified | 643 |
| 279 | Ga0157371_10295953 | 3300013102 | Unclassified | 1171 |
| 280 | Ga0157371_10885592 | 3300013102 | Unclassified | 676 |
| 281 | Ga0157370_10046392 | 3300013104 | Bacteria | 4166 |
| 282 | Ga0157370_10215742 | 3300013104 | Bacteria | 1778 |
| 283 | Ga0157370_10332639 | 3300013104 | Unclassified | 1400 |
| 284 | Ga0157369_10289551 | 3300013105 | Bacteria | 1705 |
| 285 | Ga0157369_10764533 | 3300013105 | Bacteria | 993 |
| 286 | Ga0157369_10805068 | 3300013105 | Unclassified | 965 |
| 287 | Ga0157374_10025062 | 3300013296 | Bacteria | 5352 |
| 288 | Ga0157374_10329435 | 3300013296 | Bacteria | 1514 |
| 289 | Ga0157374_10337043 | 3300013296 | Unclassified | 1497 |
| 290 | Ga0157374_10348338 | 3300013296 | Unclassified | 1471 |
| 291 | Ga0157374_10912884 | 3300013296 | Bacteria | 896 |
| 292 | Ga0157374_11701373 | 3300013296 | Unclassified | 655 |
| 293 | Ga0157374_12488972 | 3300013296 | Unclassified | 545 |
| 294 | Ga0157374_12936378 | 3300013296 | Unclassified | 504 |
| 295 | Ga0157378_10005719 | 3300013297 | Bacteria | 10883 |
| 296 | Ga0157378_10092172 | 3300013297 | Unclassified | 2756 |
| 297 | Ga0157378_10242733 | 3300013297 | Bacteria | 1721 |
| 298 | Ga0157378_11140274 | 3300013297 | Bacteria | 818 |
| 299 | Ga0157378_12436715 | 3300013297 | Unclassified | 575 |
| 300 | Ga0163162_10610502 | 3300013306 | Unclassified | 1216 |
| 301 | Ga0163162_11099913 | 3300013306 | Bacteria | 900 |
| 302 | Ga0163162_11122150 | 3300013306 | Unclassified | 891 |
| 303 | Ga0163162_11809443 | 3300013306 | Bacteria | 698 |
| 304 | Ga0163162_12555504 | 3300013306 | Bacteria | 587 |
| 305 | Ga0157372_10358029 | 3300013307 | Bacteria | 1700 |
| 306 | Ga0157372_10560763 | 3300013307 | Bacteria | 1331 |
| 307 | Ga0157372_10657801 | 3300013307 | Bacteria | 1220 |
| 308 | Ga0157375_10000203 | 3300013308 | Bacteria | 55131 |
| 309 | Ga0157375_10077429 | 3300013308 | Unclassified | 3355 |
| 310 | Ga0157375_10180731 | 3300013308 | Bacteria | 2261 |
| 311 | Ga0157375_11901379 | 3300013308 | Unclassified | 706 |
| 312 | Ga0157375_11937245 | 3300013308 | Unclassified | 700 |
| 313 | Ga0163163_10000140 | 3300014325 | Bacteria | 74966 |
| 314 | Ga0163163_10220802 | 3300014325 | Bacteria | 1944 |
| 315 | Ga0163163_10366718 | 3300014325 | Bacteria | 1497 |
| 316 | Ga0163163_11079330 | 3300014325 | Bacteria | 866 |
| 317 | Ga0163163_11360807 | 3300014325 | Unclassified | 772 |
| 318 | Ga0157380_12445962 | 3300014326 | Bacteria | 588 |
| 319 | Ga0182008_10068189 | 3300014497 | Bacteria | 1751 |
| 320 | Ga0157377_10101074 | 3300014745 | Unclassified | 1718 |
| 321 | Ga0157377_10294694 | 3300014745 | Bacteria | 1068 |
| 322 | Ga0157377_10595562 | 3300014745 | Unclassified | 788 |
| 323 | Ga0157377_11429993 | 3300014745 | Unclassified | 547 |
| 324 | Ga0157379_10013800 | 3300014968 | Bacteria | 7080 |
| 325 | Ga0157376_10022379 | 3300014969 | Bacteria | 4926 |
| 326 | Ga0157376_10114114 | 3300014969 | Bacteria | 2383 |
| 327 | Ga0157376_11363203 | 3300014969 | Unclassified | 740 |
| 328 | Ga0157376_11416285 | 3300014969 | Unclassified | 727 |
| 329 | Ga0157376_12344188 | 3300014969 | Unclassified | 573 |
| 330 | Ga0182005_1056223 | 3300015265 | Unclassified | 1072 |
| 331 | Ga0163161_10162350 | 3300017792 | Unclassified | 1704 |
| 332 | Ga0163161_10393107 | 3300017792 | Unclassified | 1110 |
| 333 | Ga0207666_1000938 | 3300025271 | Bacteria | 3457 |
| 334 | Ga0207666_1032048 | 3300025271 | Unclassified | 807 |
| 335 | Ga0207673_1002458 | 3300025290 | Bacteria | 2115 |
| 336 | Ga0207673_1024244 | 3300025290 | Unclassified | 828 |
| 337 | Ga0207697_10000206 | 3300025315 | Bacteria | 31683 |
| 338 | Ga0207697_10012177 | 3300025315 | Bacteria | 3615 |
| 339 | Ga0207697_10096929 | 3300025315 | Unclassified | 1254 |
| 340 | Ga0207692_10024146 | 3300025898 | Bacteria | 2822 |
| 341 | Ga0207688_10115120 | 3300025901 | Unclassified | 1564 |
| 342 | Ga0207680_10220489 | 3300025903 | Bacteria | 1300 |
| 343 | Ga0207647_10071082 | 3300025904 | Bacteria | 2100 |
| 344 | Ga0207685_10138781 | 3300025905 | Unclassified | 1088 |
| 345 | Ga0207699_10168808 | 3300025906 | Bacteria | 1462 |
| 346 | Ga0207699_10560089 | 3300025906 | Unclassified | 830 |
| 347 | Ga0207645_10063179 | 3300025907 | Bacteria | 2366 |
| 348 | Ga0207705_10242474 | 3300025909 | Bacteria | 1373 |
| 349 | Ga0207684_10050049 | 3300025910 | Bacteria | 3544 |
| 350 | Ga0207684_10053631 | 3300025910 | Bacteria | 3422 |
| 351 | Ga0207684_10203436 | 3300025910 | Bacteria | 1708 |
| 352 | Ga0207684_10938100 | 3300025910 | Unclassified | 726 |
| 353 | Ga0207654_10145102 | 3300025911 | Bacteria | 1518 |
| 354 | Ga0207707_10096510 | 3300025912 | Bacteria | 2583 |
| 355 | Ga0207693_10027963 | 3300025915 | Bacteria | 4457 |
| 356 | Ga0207693_10215695 | 3300025915 | Bacteria | 1508 |
| 357 | Ga0207693_10603139 | 3300025915 | Unclassified | 855 |
| 358 | Ga0207693_10620162 | 3300025915 | Unclassified | 841 |
| 359 | Ga0207663_10126349 | 3300025916 | Bacteria | 1760 |
| 360 | Ga0207663_10199763 | 3300025916 | Bacteria | 1441 |
| 361 | Ga0207663_10739474 | 3300025916 | Unclassified | 781 |
| 362 | Ga0207663_10975132 | 3300025916 | Bacteria | 679 |
| 363 | Ga0207660_10151570 | 3300025917 | Bacteria | 1781 |
| 364 | Ga0207662_10178197 | 3300025918 | Bacteria | 1366 |
| 365 | Ga0207662_10295620 | 3300025918 | Bacteria | 1075 |
| 366 | Ga0207657_10047323 | 3300025919 | Bacteria | 3762 |
| 367 | Ga0207657_10226764 | 3300025919 | Unclassified | 1495 |
| 368 | Ga0207657_10247771 | 3300025919 | Bacteria | 1421 |
| 369 | Ga0207657_11398047 | 3300025919 | Unclassified | 526 |
| 370 | Ga0207649_10017303 | 3300025920 | Bacteria | 4085 |
| 371 | Ga0207652_10125161 | 3300025921 | Bacteria | 2289 |
| 372 | Ga0207646_10070072 | 3300025922 | Bacteria | 3132 |
| 373 | Ga0207646_10108091 | 3300025922 | Bacteria | 2495 |
| 374 | Ga0207646_11279238 | 3300025922 | Unclassified | 641 |
| 375 | Ga0207694_11231548 | 3300025924 | Unclassified | 633 |
| 376 | Ga0207659_10005785 | 3300025926 | Bacteria | 7533 |
| 377 | Ga0207659_10459693 | 3300025926 | Unclassified | 1073 |
| 378 | Ga0207700_10024567 | 3300025928 | Bacteria | 4172 |
| 379 | Ga0207700_10798376 | 3300025928 | Unclassified | 844 |
| 380 | Ga0207700_10959072 | 3300025928 | Bacteria | 765 |
| 381 | Ga0207644_10167956 | 3300025931 | Bacteria | 1710 |
| 382 | Ga0207644_10519916 | 3300025931 | Bacteria | 983 |
| 383 | Ga0207644_11271707 | 3300025931 | Unclassified | 618 |
| 384 | Ga0207690_11045110 | 3300025932 | Unclassified | 680 |
| 385 | Ga0207706_10083933 | 3300025933 | Bacteria | 2800 |
| 386 | Ga0207670_10001771 | 3300025936 | Bacteria | 11296 |
| 387 | Ga0207670_10272879 | 3300025936 | Bacteria | 1315 |
| 388 | Ga0207670_10361230 | 3300025936 | Unclassified | 1152 |
| 389 | Ga0207704_10404844 | 3300025938 | Unclassified | 1078 |
| 390 | Ga0207665_10038303 | 3300025939 | Bacteria | 3192 |
| 391 | Ga0207665_10114322 | 3300025939 | Bacteria | 1900 |
| 392 | Ga0207711_10256109 | 3300025941 | Bacteria | 1608 |
| 393 | Ga0207689_10277699 | 3300025942 | Unclassified | 1387 |
| 394 | Ga0207661_10003724 | 3300025944 | Bacteria | 10625 |
| 395 | Ga0207661_10020552 | 3300025944 | Bacteria | 4937 |
| 396 | Ga0207661_10978230 | 3300025944 | Unclassified | 779 |
| 397 | Ga0207679_10152006 | 3300025945 | Bacteria | 1885 |
| 398 | Ga0207679_10158402 | 3300025945 | Bacteria | 1851 |
| 399 | Ga0207679_10862184 | 3300025945 | Unclassified | 827 |
| 400 | Ga0207651_10030004 | 3300025960 | Bacteria | 3456 |
| 401 | Ga0207651_10198608 | 3300025960 | Bacteria | 1605 |
| 402 | Ga0207712_11889428 | 3300025961 | Bacteria | 535 |
| 403 | Ga0207668_10351319 | 3300025972 | Bacteria | 1233 |
| 404 | Ga0207668_11571318 | 3300025972 | Bacteria | 594 |
| 405 | Ga0207640_10552896 | 3300025981 | Unclassified | 967 |
| 406 | Ga0207677_11660734 | 3300026023 | Bacteria | 592 |
| 407 | Ga0207703_10014277 | 3300026035 | Bacteria | 6195 |
| 408 | Ga0207678_10124429 | 3300026067 | Bacteria | 2200 |
| 409 | Ga0207708_10118287 | 3300026075 | Bacteria | 2063 |
| 410 | Ga0207702_10366633 | 3300026078 | Bacteria | 1382 |
| 411 | Ga0207702_10450223 | 3300026078 | Bacteria | 1249 |
| 412 | Ga0207641_10012336 | 3300026088 | Bacteria | 7012 |
| 413 | Ga0207641_10147630 | 3300026088 | Bacteria | 2127 |
| 414 | Ga0207676_11709811 | 3300026095 | Unclassified | 627 |
| 415 | Ga0207676_12107559 | 3300026095 | Unclassified | 562 |
| 416 | Ga0207674_10744953 | 3300026116 | Unclassified | 946 |
| 417 | Ga0207675_100064142 | 3300026118 | Bacteria | 3433 |
| 418 | Ga0207683_10020924 | 3300026121 | Bacteria | 5599 |
| 419 | Ga0207683_10081949 | 3300026121 | Unclassified | 2865 |
| 420 | Ga0268266_10111278 | 3300028379 | Bacteria | 2426 |
| 421 | Ga0268266_10157176 | 3300028379 | Bacteria | 2054 |
| 422 | Ga0268266_11010441 | 3300028379 | Unclassified | 805 |
| 423 | Ga0268266_11340875 | 3300028379 | Unclassified | 691 |
| 424 | Ga0268264_10104756 | 3300028381 | Bacteria | 2466 |
| 425 | Ga0265338_10086585 | 3300028800 | Bacteria | 2606 |
| 426 | Ga0265320_10076694 | 3300031240 | Bacteria | 1566 |
| 427 | Ga0373944_0347418 | 3300035089 | Unclassified | 564 |
| 428 | Ga0373923_0072196 | 3300035111 | Bacteria | 1484 |
| 429 | Ga0373945_0072661 | 3300035116 | Bacteria | 1305 |
| 430 | Ga0373953_0035650 | 3300035117 | Bacteria | 1956 |
| 431 | Ga0373957_0090465 | 3300035120 | Bacteria | 1216 |
| 432 | Ga0373943_0014103 | 3300035170 | Bacteria | 3614 |
| 433 | Ga0373943_0412918 | 3300035170 | Unclassified | 781 |
| 434 | Ga0373946_0097207 | 3300035171 | Unclassified | 1314 |
| 435 | Ga0373955_0094946 | 3300035172 | Bacteria | 1705 |
| 436 | Ga0373955_0117660 | 3300035172 | Bacteria | 1542 |
| 437 | Ga0373935_0708093 | 3300035692 | Unclassified | 741 |
| 438 | Ga0373935_1465741 | 3300035692 | Unclassified | 511 |
| 439 | Ga0373933_0307390 | 3300035724 | Bacteria | 1027 |
| 440 | Ga0373933_0545505 | 3300035724 | Bacteria | 761 |
| 441 | Ga0373947_0025840 | 3300035725 | Bacteria | 3426 |
| 442 | Ga0373947_0247847 | 3300035725 | Unclassified | 1177 |
| 443 | Ga0373937_0043777 | 3300036401 | Bacteria | 4088 |
| 444 | Ga0373937_0078942 | 3300036401 | Bacteria | 3042 |
| 445 | Ga0373937_0153784 | 3300036401 | Bacteria | 2155 |
| 446 | Ga0373937_0308388 | 3300036401 | Unclassified | 1497 |
| 447 | Ga0373937_1068217 | 3300036401 | Bacteria | 756 |
| 448 | Ga0373925_0483104 | 3300037068 | Bacteria | 1016 |
| 449 | Ga0373925_1315974 | 3300037068 | Unclassified | 593 |
| 450 | Ga0436362_0144313 | 3300039453 | Unclassified | 1448 |
| 451 | Ga0451800_0040728 | 3300041459 | Bacteria | 1441 |
| 452 | Ga0451807_2215386 | 3300041486 | Bacteria | 658 |
| 453 | Ga0451835_1255956 | 3300041492 | Unclassified | 680 |
| 454 | Ga0451841_0836650 | 3300041498 | Bacteria | 557 |
| 455 | Ga0451849_1259619 | 3300041505 | Unclassified | 734 |
| 456 | Ga0439451_017074 | 3300042009 | Bacteria | 1462 |
| 457 | Ga0439455_0002782 | 3300042012 | Bacteria | 3243 |
| 458 | Ga0439440_0151815 | 3300042993 | Unclassified | 664 |
| 459 | Ga0466965_0458185 | 3300044683 | Bacteria | 711 |
| 460 | Ga0466964_0044899 | 3300044706 | Bacteria | 1797 |
| 461 | Ga0453684_0025663 | 3300044712 | Bacteria | 8548 |
| 462 | Ga0451576_0534840 | 3300045051 | Unclassified | 1231 |
| 463 | Ga0466967_0365697 | 3300045976 | Bacteria | 1398 |
| 464 | Ga0495603_0373632 | 3300046455 | Unclassified | 818 |
| 465 | Ga0495651_0430737 | 3300046462 | Bacteria | 856 |
| 466 | Ga0495653_0198128 | 3300046463 | Bacteria | 1365 |
| 467 | Ga0495653_0836866 | 3300046463 | Unclassified | 551 |
| 468 | Ga0495580_0546444 | 3300046472 | Bacteria | 770 |
| 469 | Ga0495582_0180475 | 3300046473 | Unclassified | 1203 |
| 470 | Ga0495662_0173678 | 3300046476 | Unclassified | 1062 |
| 471 | Ga0495662_0500783 | 3300046476 | Unclassified | 596 |
| 472 | Ga0495664_0251835 | 3300046477 | Bacteria | 1068 |
| 473 | Ga0495618_0209805 | 3300046514 | Bacteria | 1231 |
| 474 | Ga0495618_0520928 | 3300046514 | Bacteria | 715 |
| 475 | Ga0495618_0725659 | 3300046514 | Bacteria | 583 |
| 476 | Ga0495628_0009283 | 3300046516 | Bacteria | 8405 |
| 477 | Ga0495628_0170214 | 3300046516 | Bacteria | 1652 |
| 478 | Ga0495628_0207312 | 3300046516 | Bacteria | 1475 |
| 479 | Ga0495630_0045260 | 3300046517 | Unclassified | 3288 |
| 480 | Ga0495630_0447130 | 3300046517 | Unclassified | 990 |
| 481 | Ga0495630_1468507 | 3300046517 | Bacteria | 512 |
| 482 | Ga0495652_0034860 | 3300046529 | Bacteria | 4383 |
| 483 | Ga0495652_0060831 | 3300046529 | Bacteria | 3190 |
| 484 | Ga0495652_0210316 | 3300046529 | Bacteria | 1469 |
| 485 | Ga0495665_0189009 | 3300046531 | Unclassified | 1069 |
| 486 | Ga0495640_0390012 | 3300046533 | Unclassified | 856 |
| 487 | Ga0495586_0008084 | 3300046535 | Bacteria | 5611 |
| 488 | Ga0495587_0059804 | 3300046536 | Bacteria | 2235 |
| 489 | Ga0495587_0061229 | 3300046536 | Unclassified | 2206 |
| 490 | Ga0495598_0191434 | 3300046537 | Unclassified | 735 |
| 491 | Ga0495597_0404826 | 3300046542 | Unclassified | 519 |
| 492 | Ga0495645_0000747 | 3300046543 | Bacteria | 22238 |
| 493 | Ga0495645_0943318 | 3300046543 | Unclassified | 510 |
| 494 | Ga0495667_0026013 | 3300046559 | Bacteria | 3942 |
| 495 | Ga0495667_0373654 | 3300046559 | Bacteria | 899 |
| 496 | Ga0495634_0173857 | 3300046642 | Bacteria | 1352 |
| 497 | Ga0495635_0169733 | 3300046663 | Bacteria | 1484 |
| 498 | Ga0495657_0191007 | 3300046675 | Bacteria | 1252 |
| 499 | Ga0495657_0288183 | 3300046675 | Bacteria | 981 |
| 500 | Ga0495657_0330566 | 3300046675 | Bacteria | 904 |
| 501 | Ga0495599_0004172 | 3300046678 | Bacteria | 8528 |
| 502 | Ga0495623_0011284 | 3300046679 | Bacteria | 5780 |
| 503 | Ga0495646_0003872 | 3300046680 | Bacteria | 9357 |
| 504 | Ga0495658_0196682 | 3300046683 | Bacteria | 1255 |
| 505 | Ga0495669_0163916 | 3300046684 | Unclassified | 1056 |
| 506 | Ga0495613_0088847 | 3300046689 | Bacteria | 2239 |
| 507 | Ga0495600_0149660 | 3300046809 | Bacteria | 1512 |
| 508 | Ga0495581_0569032 | 3300047315 | Unclassified | 657 |
| 509 | Ga0495604_0026018 | 3300047317 | Bacteria | 4660 |
| 510 | Ga0495604_0151435 | 3300047317 | Unclassified | 1648 |
| 511 | Ga0495674_0081284 | 3300047319 | Bacteria | 2780 |
| 512 | Ga0495674_0253331 | 3300047319 | Bacteria | 1448 |
| 513 | Ga0495674_0443804 | 3300047319 | Bacteria | 1043 |
| 514 | Ga0495676_0405668 | 3300047321 | Bacteria | 904 |
| 515 | Ga0495680_0123127 | 3300047322 | Unclassified | 1913 |
| 516 | Ga0495680_0168257 | 3300047322 | Bacteria | 1588 |
| 517 | Ga0495683_0483135 | 3300047323 | Unclassified | 505 |
| 518 | Ga0495675_0023590 | 3300047444 | Bacteria | 3921 |
| 519 | Ga0495684_0019162 | 3300047471 | Bacteria | 5268 |
| 520 | Ga0495684_0305186 | 3300047471 | Unclassified | 1142 |
| 521 | Ga0495684_0523861 | 3300047471 | Bacteria | 811 |
| 522 | Ga0495684_0929479 | 3300047471 | Bacteria | 558 |
| 523 | Ga0495684_1065308 | 3300047471 | Unclassified | 509 |
| 524 | Ga0495602_0528046 | 3300048088 | Bacteria | 821 |
| 525 | Ga0496100_0089323 | 3300048903 | Bacteria | 2099 |
| 526 | Ga0496100_0298068 | 3300048903 | Unclassified | 1206 |
| 527 | Ga0496100_0958649 | 3300048903 | Unclassified | 673 |
| 528 | Ga0496101_0101698 | 3300048904 | Bacteria | 2152 |
| 529 | Ga0496101_0860245 | 3300048904 | Unclassified | 714 |
| 530 | Ga0496102_0287031 | 3300048905 | Bacteria | 1551 |
| 531 | Ga0496102_0410030 | 3300048905 | Unclassified | 1273 |
| 532 | Ga0496102_0606955 | 3300048905 | Unclassified | 1017 |
| 533 | Ga0496102_1255510 | 3300048905 | Unclassified | 660 |
| 534 | Ga0496103_0096646 | 3300048906 | Unclassified | 1867 |
| 535 | Ga0496103_0421335 | 3300048906 | Unclassified | 857 |
| 536 | Ga0496104_0346498 | 3300048907 | Bacteria | 1398 |
| 537 | Ga0496104_0479630 | 3300048907 | Bacteria | 1155 |
| 538 | Ga0496104_1354603 | 3300048907 | Unclassified | 615 |
| 539 | Ga0496105_0043026 | 3300048908 | Bacteria | 3725 |
| 540 | Ga0496105_0175290 | 3300048908 | Bacteria | 1757 |
| 541 | Ga0496105_0640354 | 3300048908 | Bacteria | 821 |
| 542 | Ga0496106_0144358 | 3300048909 | Bacteria | 1874 |
| 543 | Ga0496106_0540966 | 3300048909 | Unclassified | 935 |
| 544 | Ga0496106_0634486 | 3300048909 | Unclassified | 854 |
| 545 | Ga0496107_0093092 | 3300048910 | Bacteria | 2204 |
| 546 | Ga0496107_0300793 | 3300048910 | Bacteria | 1194 |
| 547 | Ga0496108_0358863 | 3300048911 | Unclassified | 1272 |
| 548 | Ga0496108_0606135 | 3300048911 | Bacteria | 954 |
| 549 | Ga0496108_1261188 | 3300048911 | Unclassified | 623 |
| 550 | Ga0496109_0010495 | 3300048912 | Bacteria | 7915 |
| 551 | Ga0496109_0195588 | 3300048912 | Bacteria | 1900 |
| 552 | Ga0496109_0272234 | 3300048912 | Bacteria | 1595 |
| 553 | Ga0496109_0831671 | 3300048912 | Unclassified | 861 |
| 554 | Ga0496110_0570971 | 3300048913 | Unclassified | 1027 |
| 555 | Ga0496111_0258845 | 3300048914 | Bacteria | 1291 |
| 556 | Ga0496111_0705231 | 3300048914 | Unclassified | 734 |
| 557 | Ga0496112_0061882 | 3300048915 | Bacteria | 3691 |
| 558 | Ga0496112_0129082 | 3300048915 | Bacteria | 2499 |
| 559 | Ga0496112_0135110 | 3300048915 | Unclassified | 2437 |
| 560 | Ga0496112_0199969 | 3300048915 | Bacteria | 1958 |
| 561 | Ga0496112_0446944 | 3300048915 | Bacteria | 1230 |
| 562 | Ga0496113_0174078 | 3300048916 | Bacteria | 1705 |
| 563 | Ga0496113_0493699 | 3300048916 | Bacteria | 983 |
| 564 | Ga0496114_0027322 | 3300048917 | Bacteria | 4673 |
| 565 | Ga0496114_0062242 | 3300048917 | Bacteria | 3123 |
| 566 | Ga0496114_0689240 | 3300048917 | Unclassified | 897 |
| 567 | Ga0496115_0000589 | 3300048918 | Bacteria | 27866 |
| 568 | Ga0496115_0007739 | 3300048918 | Bacteria | 7923 |
| 569 | Ga0496115_0284293 | 3300048918 | Bacteria | 1358 |
| 570 | Ga0501033_0124634 | 3300049570 | Bacteria | 1868 |
| 571 | Ga0501034_0675528 | 3300049571 | Bacteria | 933 |
| 572 | nmdc:mga05p37_30333_c1 | 3300050507 | Bacteria | 6597 |
| 573 | nmdc:mga09592_1239994_c1 | 3300050508 | Viruses | 615 |
| 574 | nmdc:mga0n895_774791_c1 | 3300050512 | Viruses | 951 |
| 575 | nmdc:mga08x19_669709_c1 | 3300050514 | Unclassified | 736 |
| 576 | nmdc:mga0a205_705635_c1 | 3300050515 | Unclassified | 858 |
| 577 | nmdc:mga0a205_840924_c1 | 3300050515 | Viruses | 765 |
| 578 | Ga0495601_0000684 | 3300053077 | Bacteria | 18153 |
| 579 | Ga0495612_0499354 | 3300053078 | Unclassified | 558 |
| 580 | Ga0495655_0087339 | 3300053083 | Unclassified | 903 |
| 581 | Ga0495595_0421008 | 3300053084 | Bacteria | 678 |
| 582 | Ga0495619_0065036 | 3300053085 | Bacteria | 2432 |
| 583 | Ga0495619_0238834 | 3300053085 | Bacteria | 1259 |
| 584 | Ga0495619_0333896 | 3300053085 | Bacteria | 1049 |
| 585 | Ga0495619_0763347 | 3300053085 | Bacteria | 655 |
| 586 | Ga0068859_100166107 | |||
| 587 | JGI24743J22301_10027145 | |||
| 588 | JGI24035J26624_1004190 | |||
| 589 | JGI24035J26624_1008629 | |||
| 590 | JGI24035J26624_1022848 | |||
| 591 | Ga0065704_10753543 | |||
| 592 | Ga0065712_10178572 | |||
| 593 | Ga0065712_10491495 | |||
| 594 | Ga0065712_10754884 | |||
| 595 | Ga0065715_10001597 | |||
| 596 | Ga0065715_10024002 | |||
| 597 | Ga0065715_10136727 | |||
| 598 | Ga0065715_10183208 | |||
| 599 | Ga0065715_10519934 | |||
| 600 | Ga0065715_10878283 | |||
| 601 | Ga0065707_10372418 | |||
| 602 | Ga0065707_10958262 | |||
| 603 | Ga0070658_10214016 | |||
| 604 | Ga0070658_11910267 | |||
| 605 | Ga0070676_10305136 | |||
| 606 | Ga0070683_100012298 | |||
| 607 | Ga0070683_100057618 | |||
| 608 | Ga0070683_100144620 | |||
| 609 | Ga0070683_100170395 | |||
| 610 | Ga0070683_100273086 | |||
| 611 | Ga0070690_100098562 | |||
| 612 | Ga0070690_100145467 | |||
| 613 | Ga0070690_100669578 | |||
| 614 | Ga0070690_101369050 | |||
| 615 | Ga0070670_100905743 | |||
| 616 | Ga0068869_100119508 | |||
| 617 | Ga0068869_101570938 | |||
| 618 | Ga0070666_10046252 | |||
| 619 | Ga0070680_100241830 | |||
| 620 | Ga0070682_100276116 | |||
| 621 | Ga0068868_100974153 | |||
| 622 | Ga0070660_100069377 | |||
| 623 | Ga0070660_100264634 | |||
| 624 | Ga0070660_100646468 | |||
| 625 | Ga0070689_100005561 | |||
| 626 | Ga0070689_100021875 | |||
| 627 | Ga0070689_100029214 | |||
| 628 | Ga0070689_100168731 | |||
| 629 | Ga0070689_100223732 | |||
| 630 | Ga0070689_100318212 | |||
| 631 | Ga0070689_100450691 | |||
| 632 | Ga0070689_101151388 | |||
| 633 | Ga0070687_100677061 | |||
| 634 | Ga0070687_100699575 | |||
| 635 | Ga0070687_100764788 | |||
| 636 | Ga0070661_100056696 | |||
| 637 | Ga0070661_101863884 | |||
| 638 | Ga0070692_10386225 | |||
| 639 | Ga0070692_10983100 | |||
| 640 | Ga0070668_100832245 | |||
| 641 | Ga0070675_100002295 | |||
| 642 | Ga0070675_100021384 | |||
| 643 | Ga0070675_100208859 | |||
| 644 | Ga0070675_100704952 | |||
| 645 | Ga0070671_100560697 | |||
| 646 | Ga0070671_101857597 | |||
| 647 | Ga0070674_101225821 | |||
| 648 | Ga0070674_101693213 | |||
| 649 | Ga0070673_100013472 | |||
| 650 | Ga0070673_102233088 | |||
| 651 | Ga0070688_100080559 | |||
| 652 | Ga0070688_100091289 | |||
| 653 | Ga0070688_100102486 | |||
| 654 | Ga0070688_100198105 | |||
| 655 | Ga0070688_100239750 | |||
| 656 | Ga0070688_100365608 | |||
| 657 | Ga0070688_100616382 | |||
| 658 | Ga0070688_100989886 | |||
| 659 | Ga0070659_100465066 | |||
| 660 | Ga0070659_101800676 | |||
| 661 | Ga0070667_100557517 | |||
| 662 | Ga0070703_10351168 | |||
| 663 | Ga0070709_10518569 | |||
| 664 | Ga0070709_11790248 | |||
| 665 | Ga0070714_100011722 | |||
| 666 | Ga0070714_100136543 | |||
| 667 | Ga0070714_100349688 | |||
| 668 | Ga0070713_100002433 | |||
| 669 | Ga0070713_100033654 | |||
| 670 | Ga0070713_100197175 | |||
| 671 | Ga0070713_100361569 | |||
| 672 | Ga0070713_100500963 | |||
| 673 | Ga0070713_100738897 | |||
| 674 | Ga0070713_101297880 | |||
| 675 | Ga0070710_10118254 | |||
| 676 | Ga0070710_10136276 | |||
| 677 | Ga0070710_10433748 | |||
| 678 | Ga0070701_10027591 | |||
| 679 | Ga0070701_10193214 | |||
| 680 | Ga0070701_10627163 | |||
| 681 | Ga0070711_100070703 | |||
| 682 | Ga0070711_100195703 | |||
| 683 | Ga0070711_100242186 | |||
| 684 | Ga0070711_100352174 | |||
| 685 | Ga0070711_101300255 | |||
| 686 | Ga0070711_101997695 | |||
| 687 | Ga0070705_100043333 | |||
| 688 | Ga0070705_100113590 | |||
| 689 | Ga0070705_100334844 | |||
| 690 | Ga0070705_100940622 | |||
| 691 | Ga0070700_100036540 | |||
| 692 | Ga0070694_100040864 | |||
| 693 | Ga0070694_100601895 | |||
| 694 | Ga0070708_100428329 | |||
| 695 | Ga0070708_100472574 | |||
| 696 | Ga0070663_100562370 | |||
| 697 | Ga0070678_100033230 | |||
| 698 | Ga0070678_100042379 | |||
| 699 | Ga0070662_100108599 | |||
| 700 | Ga0070681_10033474 | |||
| 701 | Ga0070681_10057951 | |||
| 702 | Ga0070681_10075697 | |||
| 703 | Ga0070685_10010338 | |||
| 704 | Ga0070685_11249784 | |||
| 705 | Ga0070706_100051459 | |||
| 706 | Ga0070706_100099079 | |||
| 707 | Ga0070706_100169404 | |||
| 708 | Ga0070706_100237258 | |||
| 709 | Ga0070706_100282946 | |||
| 710 | Ga0070706_100447081 | |||
| 711 | Ga0070707_100027569 | |||
| 712 | Ga0070707_100040711 | |||
| 713 | Ga0070707_100213872 | |||
| 714 | Ga0070707_100375308 | |||
| 715 | Ga0070699_100090678 | |||
| 716 | Ga0070699_100282132 | |||
| 717 | Ga0070699_101716806 | |||
| 718 | Ga0070679_100092351 | |||
| 719 | Ga0070679_100376791 | |||
| 720 | Ga0070684_100004169 | |||
| 721 | Ga0070684_100023466 | |||
| 722 | Ga0070684_100132784 | |||
| 723 | Ga0070684_100322276 | |||
| 724 | Ga0070684_100570090 | |||
| 725 | Ga0070697_100656919 | |||
| 726 | Ga0070686_100007844 | |||
| 727 | Ga0070686_100064116 | |||
| 728 | Ga0070686_100129981 | |||
| 729 | Ga0070686_100257741 | |||
| 730 | Ga0070695_100174600 | |||
| 731 | Ga0070695_101610969 | |||
| 732 | Ga0070696_100478583 | |||
| 733 | Ga0070693_100066409 | |||
| 734 | Ga0070665_100183122 | |||
| 735 | Ga0070665_100237094 | |||
| 736 | Ga0070665_101380766 | |||
| 737 | Ga0070665_101632511 | |||
| 738 | Ga0070704_100018382 | |||
| 739 | Ga0070704_100019290 | |||
| 740 | Ga0070704_100073682 | |||
| 741 | Ga0070704_100687976 | |||
| 742 | Ga0068855_100446940 | |||
| 743 | Ga0068855_100482810 | |||
| 744 | Ga0070664_100051546 | |||
| 745 | Ga0070664_100417274 | |||
| 746 | Ga0070664_101319292 | |||
| 747 | Ga0070664_101709313 | |||
| 748 | Ga0068857_100166642 | |||
| 749 | Ga0068857_100773930 | |||
| 750 | Ga0068857_100956614 | |||
| 751 | Ga0068857_101325736 | |||
| 752 | Ga0068856_100383189 | |||
| 753 | Ga0068856_101338327 | |||
| 754 | Ga0070702_100771002 | |||
| 755 | Ga0070702_100904636 | |||
| 756 | Ga0068852_102613715 | |||
| 757 | Ga0068859_100102226 | |||
| 758 | Ga0068859_102652443 | |||
| 759 | Ga0068864_100680289 | |||
| 760 | Ga0068861_101001488 | |||
| 761 | Ga0068863_100022395 | |||
| 762 | Ga0068863_100027512 | |||
| 763 | Ga0068863_100281197 | |||
| 764 | Ga0068863_100392517 | |||
| 765 | Ga0068863_100589381 | |||
| 766 | Ga0068863_101360805 | |||
| 767 | Ga0068863_101565948 | |||
| 768 | Ga0068858_100022010 | |||
| 769 | Ga0068858_100421802 | |||
| 770 | Ga0068858_100641735 | |||
| 771 | Ga0068858_101066781 | |||
| 772 | Ga0068860_100192568 | |||
| 773 | Ga0068860_100680170 | |||
| 774 | Ga0068862_100160120 | |||
| 775 | Ga0081455_10005459 | |||
| 776 | Ga0081455_10050364 | |||
| 777 | Ga0081455_10279615 | |||
| 778 | Ga0081455_10691437 | |||
| 779 | Ga0081540_1029957 | |||
| 780 | Ga0081540_1071114 | |||
| 781 | Ga0081539_10042990 | |||
| 782 | Ga0081539_10158201 | |||
| 783 | Ga0070717_10856356 | |||
| 784 | Ga0070717_10963032 | |||
| 785 | Ga0070715_10554682 | |||
| 786 | Ga0070716_100020095 | |||
| 787 | Ga0070716_100044888 | |||
| 788 | Ga0070716_100190357 | |||
| 789 | Ga0070712_100259398 | |||
| 790 | Ga0070712_100454993 | |||
| 791 | Ga0070712_100533051 | |||
| 792 | Ga0070712_100759436 | |||
| 793 | Ga0070712_101745269 | |||
| 794 | Ga0070712_101808369 | |||
| 795 | Ga0097621_100280986 | |||
| 796 | Ga0097621_100283188 | |||
| 797 | Ga0097621_101465767 | |||
| 798 | Ga0068871_100051337 | |||
| 799 | Ga0068871_100161261 | |||
| 800 | Ga0068871_100284403 | |||
| 801 | Ga0068871_100680462 | |||
| 802 | Ga0068871_102301300 | |||
| 803 | Ga0075428_101026157 | |||
| 804 | Ga0075428_101027198 | |||
| 805 | Ga0075431_100398940 | |||
| 806 | Ga0075433_10420951 | |||
| 807 | Ga0075434_100681927 | |||
| 808 | Ga0075434_101217591 | |||
| 809 | Ga0075434_101859389 | |||
| 810 | Ga0075429_101375452 | |||
| 811 | Ga0075436_100700503 | |||
| 812 | Ga0097620_100102222 | |||
| 813 | Ga0097620_100140791 | |||
| 814 | Ga0097620_100166107 | |||
| 815 | Ga0097620_100356974 | |||
| 816 | Ga0097620_102653617 | |||
| 817 | Ga0099795_10167114 | |||
| 818 | Ga0105240_10156929 | |||
| 819 | Ga0105240_10359494 | |||
| 820 | Ga0105240_11142418 | |||
| 821 | Ga0105240_11233102 | |||
| 822 | Ga0105240_11744314 | |||
| 823 | Ga0111539_10027560 | |||
| 824 | Ga0111539_10060065 | |||
| 825 | Ga0111539_10135725 | |||
| 826 | Ga0111539_10549486 | |||
| 827 | Ga0111539_12128777 | |||
| 828 | Ga0111539_13452521 | |||
| 829 | Ga0105245_10113798 | |||
| 830 | Ga0105245_11400808 | |||
| 831 | Ga0114129_10153888 | |||
| 832 | Ga0114129_10249865 | |||
| 833 | Ga0114129_10589481 | |||
| 834 | Ga0114129_12193135 | |||
| 835 | Ga0114129_12303310 | |||
| 836 | Ga0105243_11522980 | |||
| 837 | Ga0105241_10027672 | |||
| 838 | Ga0105241_10199823 | |||
| 839 | Ga0105241_11349607 | |||
| 840 | Ga0105242_10273814 | |||
| 841 | Ga0105242_10330293 | |||
| 842 | Ga0105242_10475149 | |||
| 843 | Ga0105242_11617811 | |||
| 844 | Ga0105248_10393683 | |||
| 845 | Ga0105248_10437403 | |||
| 846 | Ga0105238_10222939 | |||
| 847 | Ga0105238_10462876 | |||
| 848 | Ga0105238_10638138 | |||
| 849 | Ga0105238_11077916 | |||
| 850 | Ga0105238_11207041 | |||
| 851 | Ga0105238_12645902 | |||
| 852 | Ga0105238_12787984 | |||
| 853 | Ga0105249_10060185 | |||
| 854 | Ga0105249_11463595 | |||
| 855 | Ga0105249_11869794 | |||
| 856 | Ga0099796_10263031 | |||
| 857 | Ga0105239_10190980 | |||
| 858 | Ga0105239_10328666 | |||
| 859 | Ga0105239_10644182 | |||
| 860 | Ga0105239_11310316 | |||
| 861 | Ga0105239_12215621 | |||
| 862 | Ga0105246_10139917 | |||
| 863 | Ga0105246_11445149 | |||
| 864 | Ga0157371_10295953 | |||
| 865 | Ga0157371_10885592 | |||
| 866 | Ga0157370_10046392 | |||
| 867 | Ga0157370_10215742 | |||
| 868 | Ga0157370_10332639 | |||
| 869 | Ga0157369_10289551 | |||
| 870 | Ga0157369_10764533 | |||
| 871 | Ga0157369_10805068 | |||
| 872 | Ga0157374_10025062 | |||
| 873 | Ga0157374_10329435 | |||
| 874 | Ga0157374_10337043 | |||
| 875 | Ga0157374_10348338 | |||
| 876 | Ga0157374_10912884 | |||
| 877 | Ga0157374_11701373 | |||
| 878 | Ga0157374_12488972 | |||
| 879 | Ga0157374_12936378 | |||
| 880 | Ga0157378_10005719 | |||
| 881 | Ga0157378_10092172 | |||
| 882 | Ga0157378_10242733 | |||
| 883 | Ga0157378_11140274 | |||
| 884 | Ga0157378_12436715 | |||
| 885 | Ga0163162_10610502 | |||
| 886 | Ga0163162_11099913 | |||
| 887 | Ga0163162_11122150 | |||
| 888 | Ga0163162_11809443 | |||
| 889 | Ga0163162_12555504 | |||
| 890 | Ga0157372_10358029 | |||
| 891 | Ga0157372_10560763 | |||
| 892 | Ga0157372_10657801 | |||
| 893 | Ga0157375_10000203 | |||
| 894 | Ga0157375_10077429 | |||
| 895 | Ga0157375_10180731 | |||
| 896 | Ga0157375_11901379 | |||
| 897 | Ga0157375_11937245 | |||
| 898 | Ga0163163_10000140 | |||
| 899 | Ga0163163_10220802 | |||
| 900 | Ga0163163_10366718 | |||
| 901 | Ga0163163_11079330 | |||
| 902 | Ga0163163_11360807 | |||
| 903 | Ga0157380_12445962 | |||
| 904 | Ga0182008_10068189 | |||
| 905 | Ga0157377_10101074 | |||
| 906 | Ga0157377_10294694 | |||
| 907 | Ga0157377_10595562 | |||
| 908 | Ga0157377_11429993 | |||
| 909 | Ga0157379_10013800 | |||
| 910 | Ga0157376_10022379 | |||
| 911 | Ga0157376_10114114 | |||
| 912 | Ga0157376_11363203 | |||
| 913 | Ga0157376_11416285 | |||
| 914 | Ga0157376_12344188 | |||
| 915 | Ga0182005_1056223 | |||
| 916 | Ga0163161_10162350 | |||
| 917 | Ga0163161_10393107 | |||
| 918 | Ga0207666_1000938 | |||
| 919 | Ga0207666_1032048 | |||
| 920 | Ga0207673_1002458 | |||
| 921 | Ga0207673_1024244 | |||
| 922 | Ga0207697_10000206 | |||
| 923 | Ga0207697_10012177 | |||
| 924 | Ga0207697_10096929 | |||
| 925 | Ga0207692_10024146 | |||
| 926 | Ga0207688_10115120 | |||
| 927 | Ga0207680_10220489 | |||
| 928 | Ga0207647_10071082 | |||
| 929 | Ga0207685_10138781 | |||
| 930 | Ga0207699_10168808 | |||
| 931 | Ga0207699_10560089 | |||
| 932 | Ga0207645_10063179 | |||
| 933 | Ga0207705_10242474 | |||
| 934 | Ga0207684_10050049 | |||
| 935 | Ga0207684_10053631 | |||
| 936 | Ga0207684_10203436 | |||
| 937 | Ga0207684_10938100 | |||
| 938 | Ga0207654_10145102 | |||
| 939 | Ga0207707_10096510 | |||
| 940 | Ga0207693_10027963 | |||
| 941 | Ga0207693_10215695 | |||
| 942 | Ga0207693_10603139 | |||
| 943 | Ga0207693_10620162 | |||
| 944 | Ga0207663_10126349 | |||
| 945 | Ga0207663_10199763 | |||
| 946 | Ga0207663_10739474 | |||
| 947 | Ga0207663_10975132 | |||
| 948 | Ga0207660_10151570 | |||
| 949 | Ga0207662_10178197 | |||
| 950 | Ga0207662_10295620 | |||
| 951 | Ga0207657_10047323 | |||
| 952 | Ga0207657_10226764 | |||
| 953 | Ga0207657_10247771 | |||
| 954 | Ga0207657_11398047 | |||
| 955 | Ga0207649_10017303 | |||
| 956 | Ga0207652_10125161 | |||
| 957 | Ga0207646_10070072 | |||
| 958 | Ga0207646_10108091 | |||
| 959 | Ga0207646_11279238 | |||
| 960 | Ga0207694_11231548 | |||
| 961 | Ga0207659_10005785 | |||
| 962 | Ga0207659_10459693 | |||
| 963 | Ga0207700_10024567 | |||
| 964 | Ga0207700_10798376 | |||
| 965 | Ga0207700_10959072 | |||
| 966 | Ga0207644_10167956 | |||
| 967 | Ga0207644_10519916 | |||
| 968 | Ga0207644_11271707 | |||
| 969 | Ga0207690_11045110 | |||
| 970 | Ga0207706_10083933 | |||
| 971 | Ga0207670_10001771 | |||
| 972 | Ga0207670_10272879 | |||
| 973 | Ga0207670_10361230 | |||
| 974 | Ga0207704_10404844 | |||
| 975 | Ga0207665_10038303 | |||
| 976 | Ga0207665_10114322 | |||
| 977 | Ga0207711_10256109 | |||
| 978 | Ga0207689_10277699 | |||
| 979 | Ga0207661_10003724 | |||
| 980 | Ga0207661_10020552 | |||
| 981 | Ga0207661_10978230 | |||
| 982 | Ga0207679_10152006 | |||
| 983 | Ga0207679_10158402 | |||
| 984 | Ga0207679_10862184 | |||
| 985 | Ga0207651_10030004 | |||
| 986 | Ga0207651_10198608 | |||
| 987 | Ga0207712_11889428 | |||
| 988 | Ga0207668_10351319 | |||
| 989 | Ga0207668_11571318 | |||
| 990 | Ga0207640_10552896 | |||
| 991 | Ga0207677_11660734 | |||
| 992 | Ga0207703_10014277 | |||
| 993 | Ga0207678_10124429 | |||
| 994 | Ga0207708_10118287 | |||
| 995 | Ga0207702_10366633 | |||
| 996 | Ga0207702_10450223 | |||
| 997 | Ga0207641_10012336 | |||
| 998 | Ga0207641_10147630 | |||
| 999 | Ga0207676_11709811 | |||
| 1000 | Ga0207676_12107559 | |||
| 1001 | Ga0207674_10744953 | |||
| 1002 | Ga0207675_100064142 | |||
| 1003 | Ga0207683_10020924 | |||
| 1004 | Ga0207683_10081949 | |||
| 1005 | Ga0268266_10111278 | |||
| 1006 | Ga0268266_10157176 | |||
| 1007 | Ga0268266_11010441 | |||
| 1008 | Ga0268266_11340875 | |||
| 1009 | Ga0268264_10104756 | |||
| 1010 | Ga0265338_10086585 | |||
| 1011 | Ga0265320_10076694 | |||
| 1012 | Ga0373944_0347418 | |||
| 1013 | Ga0373923_0072196 | |||
| 1014 | Ga0373945_0072661 | |||
| 1015 | Ga0373953_0035650 | |||
| 1016 | Ga0373957_0090465 | |||
| 1017 | Ga0373943_0014103 | |||
| 1018 | Ga0373943_0412918 | |||
| 1019 | Ga0373946_0097207 | |||
| 1020 | Ga0373955_0094946 | |||
| 1021 | Ga0373955_0117660 | |||
| 1022 | Ga0373935_0708093 | |||
| 1023 | Ga0373935_1465741 | |||
| 1024 | Ga0373933_0307390 | |||
| 1025 | Ga0373933_0545505 | |||
| 1026 | Ga0373947_0025840 | |||
| 1027 | Ga0373947_0247847 | |||
| 1028 | Ga0373937_0043777 | |||
| 1029 | Ga0373937_0078942 | |||
| 1030 | Ga0373937_0153784 | |||
| 1031 | Ga0373937_0308388 | |||
| 1032 | Ga0373937_1068217 | |||
| 1033 | Ga0373925_0483104 | |||
| 1034 | Ga0373925_1315974 | |||
| 1035 | Ga0436362_0144313 | |||
| 1036 | Ga0451800_0040728 | |||
| 1037 | Ga0451807_2215386 | |||
| 1038 | Ga0451835_1255956 | |||
| 1039 | Ga0451841_0836650 | |||
| 1040 | Ga0451849_1259619 | |||
| 1041 | Ga0439451_017074 | |||
| 1042 | Ga0439455_0002782 | |||
| 1043 | Ga0439440_0151815 | |||
| 1044 | Ga0466965_0458185 | |||
| 1045 | Ga0466964_0044899 | |||
| 1046 | Ga0453684_0025663 | |||
| 1047 | Ga0451576_0534840 | |||
| 1048 | Ga0466967_0365697 | |||
| 1049 | Ga0495603_0373632 | |||
| 1050 | Ga0495651_0430737 | |||
| 1051 | Ga0495653_0198128 | |||
| 1052 | Ga0495653_0836866 | |||
| 1053 | Ga0495580_0546444 | |||
| 1054 | Ga0495582_0180475 | |||
| 1055 | Ga0495662_0173678 | |||
| 1056 | Ga0495662_0500783 | |||
| 1057 | Ga0495664_0251835 | |||
| 1058 | Ga0495618_0209805 | |||
| 1059 | Ga0495618_0520928 | |||
| 1060 | Ga0495618_0725659 | |||
| 1061 | Ga0495628_0009283 | |||
| 1062 | Ga0495628_0170214 | |||
| 1063 | Ga0495628_0207312 | |||
| 1064 | Ga0495630_0045260 | |||
| 1065 | Ga0495630_0447130 | |||
| 1066 | Ga0495630_1468507 | |||
| 1067 | Ga0495652_0034860 | |||
| 1068 | Ga0495652_0060831 | |||
| 1069 | Ga0495652_0210316 | |||
| 1070 | Ga0495665_0189009 | |||
| 1071 | Ga0495640_0390012 | |||
| 1072 | Ga0495586_0008084 | |||
| 1073 | Ga0495587_0059804 | |||
| 1074 | Ga0495587_0061229 | |||
| 1075 | Ga0495598_0191434 | |||
| 1076 | Ga0495597_0404826 | |||
| 1077 | Ga0495645_0000747 | |||
| 1078 | Ga0495645_0943318 | |||
| 1079 | Ga0495667_0026013 | |||
| 1080 | Ga0495667_0373654 | |||
| 1081 | Ga0495634_0173857 | |||
| 1082 | Ga0495635_0169733 | |||
| 1083 | Ga0495657_0191007 | |||
| 1084 | Ga0495657_0288183 | |||
| 1085 | Ga0495657_0330566 | |||
| 1086 | Ga0495599_0004172 | |||
| 1087 | Ga0495623_0011284 | |||
| 1088 | Ga0495646_0003872 | |||
| 1089 | Ga0495658_0196682 | |||
| 1090 | Ga0495669_0163916 | |||
| 1091 | Ga0495613_0088847 | |||
| 1092 | Ga0495600_0149660 | |||
| 1093 | Ga0495581_0569032 | |||
| 1094 | Ga0495604_0026018 | |||
| 1095 | Ga0495604_0151435 | |||
| 1096 | Ga0495674_0081284 | |||
| 1097 | Ga0495674_0253331 | |||
| 1098 | Ga0495674_0443804 | |||
| 1099 | Ga0495676_0405668 | |||
| 1100 | Ga0495680_0123127 | |||
| 1101 | Ga0495680_0168257 | |||
| 1102 | Ga0495683_0483135 | |||
| 1103 | Ga0495675_0023590 | |||
| 1104 | Ga0495684_0019162 | |||
| 1105 | Ga0495684_0305186 | |||
| 1106 | Ga0495684_0523861 | |||
| 1107 | Ga0495684_0929479 | |||
| 1108 | Ga0495684_1065308 | |||
| 1109 | Ga0495602_0528046 | |||
| 1110 | Ga0496100_0089323 | |||
| 1111 | Ga0496100_0298068 | |||
| 1112 | Ga0496100_0958649 | |||
| 1113 | Ga0496101_0101698 | |||
| 1114 | Ga0496101_0860245 | |||
| 1115 | Ga0496102_0287031 | |||
| 1116 | Ga0496102_0410030 | |||
| 1117 | Ga0496102_0606955 | |||
| 1118 | Ga0496102_1255510 | |||
| 1119 | Ga0496103_0096646 | |||
| 1120 | Ga0496103_0421335 | |||
| 1121 | Ga0496104_0346498 | |||
| 1122 | Ga0496104_0479630 | |||
| 1123 | Ga0496104_1354603 | |||
| 1124 | Ga0496105_0043026 | |||
| 1125 | Ga0496105_0175290 | |||
| 1126 | Ga0496105_0640354 | |||
| 1127 | Ga0496106_0144358 | |||
| 1128 | Ga0496106_0540966 | |||
| 1129 | Ga0496106_0634486 | |||
| 1130 | Ga0496107_0093092 | |||
| 1131 | Ga0496107_0300793 | |||
| 1132 | Ga0496108_0358863 | |||
| 1133 | Ga0496108_0606135 | |||
| 1134 | Ga0496108_1261188 | |||
| 1135 | Ga0496109_0010495 | |||
| 1136 | Ga0496109_0195588 | |||
| 1137 | Ga0496109_0272234 | |||
| 1138 | Ga0496109_0831671 | |||
| 1139 | Ga0496110_0570971 | |||
| 1140 | Ga0496111_0258845 | |||
| 1141 | Ga0496111_0705231 | |||
| 1142 | Ga0496112_0061882 | |||
| 1143 | Ga0496112_0129082 | |||
| 1144 | Ga0496112_0135110 | |||
| 1145 | Ga0496112_0199969 | |||
| 1146 | Ga0496112_0446944 | |||
| 1147 | Ga0496113_0174078 | |||
| 1148 | Ga0496113_0493699 | |||
| 1149 | Ga0496114_0027322 | |||
| 1150 | Ga0496114_0062242 | |||
| 1151 | Ga0496114_0689240 | |||
| 1152 | Ga0496115_0000589 | |||
| 1153 | Ga0496115_0007739 | |||
| 1154 | Ga0496115_0284293 | |||
| 1155 | Ga0501033_0124634 | |||
| 1156 | Ga0501034_0675528 | |||
| 1157 | nmdc:mga05p37_30333_c1 | |||
| 1158 | nmdc:mga09592_1239994_c1 | |||
| 1159 | nmdc:mga0n895_774791_c1 | |||
| 1160 | nmdc:mga08x19_669709_c1 | |||
| 1161 | nmdc:mga0a205_705635_c1 | |||
| 1162 | nmdc:mga0a205_840924_c1 | |||
| 1163 | Ga0495601_0000684 | |||
| 1164 | Ga0495612_0499354 | |||
| 1165 | Ga0495655_0087339 | |||
| 1166 | Ga0495595_0421008 | |||
| 1167 | Ga0495619_0065036 | |||
| 1168 | Ga0495619_0238834 | |||
| 1169 | Ga0495619_0333896 | |||
| 1170 | Ga0495619_0763347 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7wg5-assembly1.cif.gz_E | cyclic electron transport supercomplex ndh-psi from arabidopsis | 0.8483 | 4 | 90 |
| 8e9g-assembly1.cif.gz_J | mycobacterial respiratory complex i with both quinone positions modelled | 0.842 | 1 | 86 |
| 7a24-assembly1.cif.gz_K | assembly intermediate of the plant mitochondrial complex i | 0.8383 | 5 | 89 |
| 8bef-assembly1.cif.gz_K | cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci membrane core) | 0.8382 | 4 | 89 |
| 7wff-assembly1.cif.gz_E | subcomplexes b,m and l in the cylic electron transfer supercomplex ndh-psi from arabidopsis | 0.8348 | 4 | 90 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A2P2CLH7_4_99_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8609 | 8 | 89 | 1.10.287.3510 |
| af_Q6R9N1_4_99_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.86 | 8 | 89 | 1.10.287.3510 |
| 6nbxE00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8306 | 5 | 90 | 1.10.287.3510 |
| 4heaS00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.829 | 8 | 90 | 1.10.287.3510 |
| af_Q58706_15_126_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8173 | 8 | 92 | 1.10.287.3510 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P5XYL7-F1-model_v4 | NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) | 0.9028 | 2 | 89 |
GO:0005886
GO:0030964 GO:0042773 GO:0048038 GO:0050136 |
| AF-A0A535R061-F1-model_v4 | NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) | 0.8917 | 4 | 92 |
GO:0005886
GO:0030964 GO:0042773 GO:0048038 GO:0050136 |
| AF-A0A7C4MWT7-F1-model_v4 | NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) | 0.8916 | 5 | 90 |
GO:0005886
GO:0030964 GO:0042773 GO:0048038 GO:0050136 |
| AF-A0A536KJL0-F1-model_v4 | NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) | 0.8873 | 1 | 90 |
GO:0005886
GO:0042773 GO:0048038 GO:0050136 |
| AF-A0A7C6B0Z6-F1-model_v4 | NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) | 0.8868 | 5 | 89 |
GO:0005886
GO:0030964 GO:0042773 GO:0048038 GO:0050136 |