F466435

General Info

Members Datasets Scaffolds Average Seq Length
585 417 1170 58

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100051650|Ga0068854_1000516503
Length 65
Sequence MARGHTMPVFTFEKISPPVRRAPAATTPKKPRGLISQMIDRVAERRARRALQDERATHRDDKPAE

Samples

Sample ID Description Type Environment
1 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
55 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
56 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
81 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
82 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
83 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
134 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
135 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
136 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
153 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
154 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
155 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
156 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
157 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
158 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
159 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
160 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
161 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
162 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
163 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
188 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
189 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
190 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
191 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
192 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
214 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
215 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
253 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
258 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
259 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
260 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
261 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
262 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
263 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
264 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
265 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
266 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
267 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
268 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
269 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
270 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
271 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
272 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
273 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
274 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
275 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
276 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
277 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
278 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
279 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
280 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
281 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
282 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
283 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
284 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
285 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
286 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
287 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
288 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
289 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
290 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
291 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
292 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
293 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
294 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
295 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
296 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
297 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
298 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
299 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
300 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
301 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
302 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
303 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
304 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
305 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
306 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
307 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
308 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
309 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
310 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
311 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
312 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
313 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
314 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
315 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
316 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
317 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
318 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
319 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
320 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
321 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
322 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
323 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
324 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
325 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
326 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
327 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
328 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
329 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
330 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
331 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
332 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
333 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
334 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
335 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
336 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
337 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
338 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
339 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
340 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
341 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
342 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
343 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
344 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
345 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
346 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
347 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
348 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
349 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
350 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
351 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
352 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
353 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
354 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
355 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
356 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
357 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
358 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
359 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
360 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
361 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
362 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
363 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
364 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
365 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
366 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
367 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
368 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
369 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
370 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
371 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
372 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
373 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
374 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
375 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
376 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
377 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
378 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
379 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
380 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
381 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
382 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
383 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
384 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
385 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
386 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
387 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
388 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
389 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
390 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
391 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
392 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
393 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
394 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
395 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
396 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
397 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
398 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
399 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
400 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
401 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
402 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
403 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
404 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
405 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
406 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
407 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
408 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
409 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
410 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
411 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
412 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
413 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
414 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
415 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
416 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
417 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.09
Metatranscriptomes 0
Isolates 22.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.21
Nodule 20.51
Rhizoplane 7.52
Rhizosphere 45.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068854_100051650 3300005578 Bacteria 2946
2 JGI24739J22299_10178057 3300001989 Bacteria 626
3 JGI25153J46596_10001899 3300003215 Bacteria 12392
4 JGI25153J46596_10003569 3300003215 Bacteria 8658
5 JGI25153J46596_10024393 3300003215 Bacteria 2181
6 JGI25160J50197_1000916 3300003354 Bacteria 15497
7 JGI25161J50226_1025805 3300003374 Bacteria 573
8 Ga0055539_1005368 3300003752 Bacteria 1669
9 Ga0055529_1025211 3300003763 Bacteria 735
10 Ga0055543_1002598 3300004625 Bacteria 5841
11 Ga0065165_1001630 3300005262 Bacteria 22843
12 Ga0065165_1001784 3300005262 Bacteria 21259
13 Ga0065165_1115623 3300005262 Bacteria 655
14 Ga0065712_10728155 3300005290 Bacteria 536
15 Ga0070683_100658061 3300005329 Bacteria 1003
16 Ga0070661_100770764 3300005344 Bacteria 788
17 Ga0070661_101719261 3300005344 Bacteria 532
18 Ga0070668_100054638 3300005347 Bacteria 3080
19 Ga0070668_100062303 3300005347 Bacteria 2889
20 Ga0070669_100399799 3300005353 Bacteria 1124
21 Ga0070669_100591782 3300005353 Bacteria 929
22 Ga0070671_100011785 3300005355 Bacteria 7033
23 Ga0070674_100386354 3300005356 Bacteria 1140
24 Ga0070673_101265975 3300005364 Bacteria 692
25 Ga0070659_100102715 3300005366 Bacteria 2302
26 Ga0070659_100543803 3300005366 Bacteria 994
27 Ga0070667_100025640 3300005367 Bacteria 4903
28 Ga0070700_101471076 3300005441 Bacteria 578
29 Ga0070663_100030983 3300005455 Bacteria 3671
30 Ga0070663_100601702 3300005455 Bacteria 925
31 Ga0070663_101465817 3300005455 Bacteria 606
32 Ga0070678_102226929 3300005456 Bacteria 520
33 Ga0070662_100109984 3300005457 Bacteria 2098
34 Ga0068867_101166554 3300005459 Bacteria 706
35 Ga0070685_11366767 3300005466 Bacteria 543
36 Ga0070684_100004058 3300005535 Bacteria 11084
37 Ga0070693_100208178 3300005547 Bacteria 1275
38 Ga0070665_100076670 3300005548 Bacteria 3350
39 Ga0070665_100495627 3300005548 Bacteria 1233
40 Ga0068855_100189915 3300005563 Bacteria 2318
41 Ga0070664_102009100 3300005564 Bacteria 549
42 Ga0068857_100502909 3300005577 Bacteria 1138
43 Ga0068854_100259561 3300005578 Bacteria 1391
44 Ga0068854_100632939 3300005578 Bacteria 917
45 Ga0068854_101373915 3300005578 Bacteria 638
46 Ga0068856_100499157 3300005614 Bacteria 1238
47 Ga0068856_100647089 3300005614 Bacteria 1078
48 Ga0068852_100004815 3300005616 Bacteria 9587
49 Ga0068852_100666470 3300005616 Bacteria 1049
50 Ga0068852_100873796 3300005616 Bacteria 915
51 Ga0068859_100272128 3300005617 Bacteria 1786
52 Ga0068864_102087793 3300005618 Bacteria 573
53 Ga0068861_100459120 3300005719 Bacteria 1143
54 Ga0068861_100619274 3300005719 Bacteria 996
55 Ga0068863_100424018 3300005841 Bacteria 1304
56 Ga0068863_100873771 3300005841 Bacteria 899
57 Ga0068858_100331844 3300005842 Bacteria 1455
58 Ga0068858_101235729 3300005842 Bacteria 735
59 Ga0068860_100496719 3300005843 Bacteria 1218
60 Ga0068860_100563892 3300005843 Bacteria 1142
61 Ga0068862_101517422 3300005844 Bacteria 676
62 Ga0081540_1024046 3300005983 Bacteria 3545
63 Ga0075365_10052610 3300006038 Bacteria 2694
64 Ga0075365_10617687 3300006038 Bacteria 766
65 Ga0075365_10990501 3300006038 Bacteria 592
66 Ga0075368_10247302 3300006042 Bacteria 761
67 Ga0075363_100039245 3300006048 Bacteria 2491
68 Ga0075364_10119577 3300006051 Bacteria 1763
69 Ga0070715_11092498 3300006163 Bacteria 502
70 Ga0075362_10408351 3300006177 Bacteria 686
71 Ga0075362_10495928 3300006177 Bacteria 624
72 Ga0075367_10278763 3300006178 Bacteria 1051
73 Ga0075369_10103783 3300006186 Bacteria 1277
74 Ga0075366_10636388 3300006195 Bacteria 662
75 Ga0097621_100874457 3300006237 Bacteria 836
76 Ga0097621_101829657 3300006237 Bacteria 579
77 Ga0075370_10015574 3300006353 Bacteria 4073
78 Ga0075370_10209910 3300006353 Bacteria 1149
79 Ga0097620_100272137 3300006931 Bacteria 1786
80 Ga0099824_1004100 3300006942 Bacteria 21098
81 Ga0099822_1064792 3300006943 Bacteria 1127
82 Ga0099823_1050381 3300006944 Bacteria 2566
83 Ga0105240_10066543 3300009093 Bacteria 4469
84 Ga0105245_10060890 3300009098 Bacteria 3401
85 Ga0105245_10430731 3300009098 Bacteria 1324
86 Ga0105245_10948389 3300009098 Bacteria 903
87 Ga0105247_10040296 3300009101 Bacteria 2855
88 Ga0105247_10119030 3300009101 Bacteria 1709
89 Ga0105243_10147587 3300009148 Bacteria 2014
90 Ga0105243_10436904 3300009148 Bacteria 1224
91 Ga0105243_10484016 3300009148 Bacteria 1169
92 Ga0105241_10013912 3300009174 Bacteria 5896
93 Ga0105241_10027359 3300009174 Bacteria 4247
94 Ga0105241_10430405 3300009174 Bacteria 1163
95 Ga0105241_10862558 3300009174 Bacteria 838
96 Ga0105248_10307971 3300009177 Bacteria 1784
97 Ga0105237_10003299 3300009545 Bacteria 19261
98 Ga0105237_10306199 3300009545 Bacteria 1592
99 Ga0105237_10425005 3300009545 Bacteria 1334
100 Ga0105237_10769016 3300009545 Bacteria 970
101 Ga0105238_10181059 3300009551 Bacteria 2084
102 Ga0105249_13299178 3300009553 Bacteria 519
103 Ga0105239_10029629 3300010375 Bacteria 6017
104 Ga0105239_10279635 3300010375 Bacteria 1879
105 Ga0105239_11231604 3300010375 Bacteria 863
106 Ga0105239_11326309 3300010375 Bacteria 830
107 Ga0105239_13321437 3300010375 Bacteria 524
108 Ga0105246_10125696 3300011119 Bacteria 1907
109 Ga0105246_11730675 3300011119 Bacteria 595
110 Ga0157371_10552610 3300013102 Bacteria 853
111 Ga0157369_10247291 3300013105 Bacteria 1862
112 Ga0157374_10349647 3300013296 Bacteria 1469
113 Ga0157374_10564135 3300013296 Bacteria 1147
114 Ga0157378_10322088 3300013297 Bacteria 1502
115 Ga0163162_10948144 3300013306 Bacteria 972
116 Ga0157372_10993296 3300013307 Bacteria 972
117 Ga0157372_11423387 3300013307 Bacteria 799
118 Ga0157375_10075210 3300013308 Bacteria 3401
119 Ga0163163_10111642 3300014325 Bacteria 2763
120 Ga0163163_10165350 3300014325 Bacteria 2258
121 Ga0182008_10490397 3300014497 Bacteria 674
122 Ga0157379_10220995 3300014968 Bacteria 1716
123 Ga0157379_11402683 3300014968 Bacteria 677
124 Ga0157376_10126673 3300014969 Bacteria 2273
125 Ga0157376_10996324 3300014969 Bacteria 860
126 Ga0157376_12104805 3300014969 Bacteria 603
127 Ga0182005_1164009 3300015265 Bacteria 653
128 Ga0214544_1000026 3300021320 Bacteria 161530
129 Ga0214542_1000025 3300021321 Bacteria 183588
130 Ga0214545_1000014 3300021324 Bacteria 183588
131 Ga0214545_1059275 3300021324 Bacteria 628
132 Ga0214545_1067437 3300021324 Bacteria 508
133 Ga0214543_1000034 3300021327 Bacteria 183712
134 Ga0214543_1062614 3300021327 Bacteria 581
135 Ga0209563_102821 3300025230 Bacteria 3788
136 Ga0209677_100778 3300025253 Bacteria 16092
137 Ga0209148_1000516 3300025254 Bacteria 38539
138 Ga0209233_1007518 3300025261 Bacteria 3447
139 Ga0209455_1004171 3300025272 Bacteria 4834
140 Ga0209455_1032233 3300025272 Bacteria 872
141 Ga0209673_1028151 3300025273 Bacteria 1814
142 Ga0209564_1002228 3300025295 Bacteria 16027
143 Ga0209758_1002574 3300025297 Bacteria 18214
144 Ga0209758_1005011 3300025297 Bacteria 10567
145 Ga0209758_1018699 3300025297 Bacteria 3382
146 Ga0209758_1079287 3300025297 Bacteria 1000
147 Ga0209256_1067649 3300025299 Bacteria 812
148 Ga0207426_1001022 3300025302 Bacteria 26892
149 Ga0207426_1001111 3300025302 Bacteria 24708
150 Ga0209257_1022503 3300025304 Bacteria 2246
151 Ga0209257_1048315 3300025304 Bacteria 1218
152 Ga0207692_10418693 3300025898 Bacteria 838
153 Ga0207710_10176963 3300025900 Bacteria 1045
154 Ga0207688_10157982 3300025901 Bacteria 1342
155 Ga0207647_10016511 3300025904 Bacteria 5037
156 Ga0207647_10709442 3300025904 Bacteria 548
157 Ga0207645_10931728 3300025907 Bacteria 590
158 Ga0207654_10019170 3300025911 Bacteria 3605
159 Ga0207654_10092486 3300025911 Bacteria 1847
160 Ga0207695_10000062 3300025913 Bacteria 351979
161 Ga0207671_10003655 3300025914 Bacteria 15185
162 Ga0207671_10029616 3300025914 Bacteria 4087
163 Ga0207671_10549058 3300025914 Bacteria 921
164 Ga0207671_10719157 3300025914 Bacteria 794
165 Ga0207663_11636459 3300025916 Bacteria 518
166 Ga0207649_10667821 3300025920 Bacteria 804
167 Ga0207649_10910445 3300025920 Bacteria 690
168 Ga0207681_10425881 3300025923 Bacteria 1076
169 Ga0207687_10064332 3300025927 Bacteria 2600
170 Ga0207644_10039224 3300025931 Bacteria 3342
171 Ga0207690_10118684 3300025932 Bacteria 1917
172 Ga0207690_10123720 3300025932 Bacteria 1883
173 Ga0207690_10442420 3300025932 Bacteria 1043
174 Ga0207706_10140591 3300025933 Bacteria 2124
175 Ga0207706_11087392 3300025933 Bacteria 669
176 Ga0207709_11748463 3300025935 Bacteria 517
177 Ga0207704_10211145 3300025938 Bacteria 1429
178 Ga0207665_10064802 3300025939 Bacteria 2483
179 Ga0207711_11659734 3300025941 Bacteria 582
180 Ga0207689_10099037 3300025942 Bacteria 2395
181 Ga0207661_11240388 3300025944 Bacteria 686
182 Ga0207679_10117371 3300025945 Bacteria 2112
183 Ga0207667_10272709 3300025949 Bacteria 1729
184 Ga0207651_11164103 3300025960 Bacteria 692
185 Ga0207668_10018525 3300025972 Bacteria 4385
186 Ga0207668_10047403 3300025972 Bacteria 2942
187 Ga0207640_10473510 3300025981 Bacteria 1037
188 Ga0207640_11758312 3300025981 Bacteria 560
189 Ga0207658_12041166 3300025986 Bacteria 521
190 Ga0207677_10273790 3300026023 Bacteria 1382
191 Ga0207703_10225468 3300026035 Bacteria 1677
192 Ga0207639_11816634 3300026041 Bacteria 570
193 Ga0207678_10018655 3300026067 Bacteria 6090
194 Ga0207678_10925479 3300026067 Bacteria 771
195 Ga0207678_11751757 3300026067 Bacteria 545
196 Ga0207702_10221880 3300026078 Bacteria 1762
197 Ga0207702_10721241 3300026078 Bacteria 983
198 Ga0207702_11642795 3300026078 Bacteria 636
199 Ga0207641_10809550 3300026088 Bacteria 927
200 Ga0207641_12031640 3300026088 Bacteria 576
201 Ga0207648_10288439 3300026089 Bacteria 1469
202 Ga0207674_10876825 3300026116 Bacteria 865
203 Ga0207674_11703993 3300026116 Bacteria 598
204 Ga0207675_100283027 3300026118 Bacteria 1611
205 Ga0207683_10135600 3300026121 Bacteria 2216
206 Ga0207698_10453744 3300026142 Bacteria 1238
207 Ga0207698_10611199 3300026142 Bacteria 1076
208 Ga0209389_1000004 3300027296 Bacteria 263759
209 Ga0209389_1000023 3300027296 Bacteria 150730
210 Ga0209589_1000010 3300027357 Bacteria 237657
211 Ga0209489_100011 3300027361 Bacteria 244710
212 Ga0209489_100295 3300027361 Bacteria 87273
213 Ga0209700_100013 3300027363 Bacteria 341906
214 Ga0209813_10222764 3300027866 Bacteria 707
215 Ga0268266_10077392 3300028379 Bacteria 2892
216 Ga0268265_10225204 3300028380 Bacteria 1644
217 Ga0268265_10364673 3300028380 Bacteria 1324
218 Ga0307517_10309875 3300028786 Bacteria 880
219 Ga0307408_100714934 3300031548 Bacteria 902
220 Ga0307510_10028510 3300033180 Bacteria 6375
221 Ga0373935_0155076 3300035692 Bacteria 1557
222 Ga0395900_0546178 3300037418 Bacteria 1104
223 Ga0395898_0527072 3300037466 Bacteria 1123
224 Ga0395898_1132078 3300037466 Bacteria 715
225 Ga0395905_0047609 3300037471 Bacteria 4017
226 Ga0395905_0247773 3300037471 Bacteria 1664
227 Ga0395905_0835304 3300037471 Bacteria 824
228 Ga0436364_1440034 3300037853 Bacteria 1533
229 Ga0395901_0402719 3300038443 Bacteria 1406
230 Ga0395901_0493594 3300038443 Bacteria 1247
231 Ga0436365_1929688 3300039437 Bacteria 783
232 Ga0436363_0039498 3300039450 Bacteria 916
233 Ga0436362_0340829 3300039453 Bacteria 540
234 Ga0451787_489990 3300041441 Bacteria 601
235 Ga0451791_0489622 3300041451 Bacteria 698
236 Ga0451793_0392809 3300041452 Bacteria 2326
237 Ga0451798_0591974 3300041458 Bacteria 1508
238 Ga0451800_1383715 3300041459 Bacteria 661
239 Ga0451802_1290278 3300041460 Bacteria 837
240 Ga0451833_0733013 3300041491 Bacteria 1354
241 Ga0451835_0685053 3300041492 Bacteria 1402
242 Ga0451837_1794711 3300041494 Bacteria 1259
243 Ga0451839_0344966 3300041496 Bacteria 1450
244 Ga0451841_0015782 3300041498 Bacteria 1113
245 Ga0451843_1756696 3300041509 Bacteria 1207
246 Ga0451853_0151450 3300041512 Bacteria 1361
247 Ga0466969_0039228 3300044656 Bacteria 2380
248 Ga0466972_0000598 3300044658 Bacteria 17578
249 Ga0466972_0008379 3300044658 Bacteria 5180
250 Ga0466965_0021526 3300044683 Bacteria 3104
251 Ga0466965_0103885 3300044683 Bacteria 1455
252 Ga0466965_0222474 3300044683 Bacteria 1006
253 Ga0466966_0002704 3300044684 Bacteria 11629
254 Ga0466961_0000149 3300044693 Bacteria 47561
255 Ga0466961_0307737 3300044693 Bacteria 967
256 Ga0466964_0207505 3300044706 Bacteria 944
257 Ga0466968_0540554 3300044735 Bacteria 584
258 Ga0466968_0570665 3300044735 Bacteria 569
259 Ga0466970_0034279 3300044765 Bacteria 2686
260 Ga0466970_0567258 3300044765 Bacteria 657
261 Ga0466960_0122933 3300044901 Bacteria 1361
262 Ga0466960_0681956 3300044901 Bacteria 615
263 Ga0466960_0729214 3300044901 Bacteria 596
264 Ga0466960_0739983 3300044901 Bacteria 592
265 Ga0466959_0001944 3300045049 Bacteria 13011
266 Ga0466959_0244761 3300045049 Bacteria 1238
267 Ga0495590_0264623 3300046457 Bacteria 642
268 Ga0495590_0389987 3300046457 Bacteria 533
269 Ga0495653_0347397 3300046463 Bacteria 955
270 Ga0495582_0849758 3300046473 Bacteria 528
271 Ga0495605_0025935 3300046474 Bacteria 3049
272 Ga0495605_0057622 3300046474 Bacteria 1869
273 Ga0495605_0071321 3300046474 Bacteria 1641
274 Ga0495662_0420855 3300046476 Bacteria 656
275 Ga0495662_0665649 3300046476 Bacteria 508
276 Ga0495664_0055550 3300046477 Bacteria 2356
277 Ga0495584_0493159 3300046491 Bacteria 624
278 Ga0495585_0231710 3300046492 Bacteria 928
279 Ga0495607_0180178 3300046501 Bacteria 1060
280 Ga0495607_0210491 3300046501 Bacteria 957
281 Ga0495583_0233981 3300046506 Bacteria 740
282 Ga0495583_0420406 3300046506 Bacteria 524
283 Ga0495606_0063885 3300046507 Bacteria 2345
284 Ga0495606_0115145 3300046507 Bacteria 1616
285 Ga0495608_0281485 3300046511 Bacteria 1032
286 Ga0495610_0038756 3300046512 Bacteria 2417
287 Ga0495610_0169032 3300046512 Bacteria 918
288 Ga0495620_0060252 3300046515 Bacteria 1583
289 Ga0495620_0314136 3300046515 Bacteria 595
290 Ga0495631_0051637 3300046518 Bacteria 1797
291 Ga0495632_0042001 3300046519 Bacteria 2294
292 Ga0495632_0137922 3300046519 Bacteria 1133
293 Ga0495632_0248772 3300046519 Bacteria 798
294 Ga0495643_0105636 3300046522 Bacteria 1438
295 Ga0495648_0020924 3300046524 Bacteria 4549
296 Ga0495648_0136902 3300046524 Bacteria 1294
297 Ga0495652_0548133 3300046529 Bacteria 795
298 Ga0495654_0239076 3300046530 Bacteria 761
299 Ga0495640_0074157 3300046533 Bacteria 2276
300 Ga0495645_0066458 3300046543 Bacteria 2606
301 Ga0495668_0102942 3300046616 Bacteria 1562
302 Ga0495668_0317932 3300046616 Bacteria 854
303 Ga0495668_0375067 3300046616 Bacteria 781
304 Ga0495634_0178645 3300046642 Bacteria 1330
305 Ga0495625_0055046 3300046660 Bacteria 2839
306 Ga0495625_0354802 3300046660 Bacteria 926
307 Ga0495625_0401595 3300046660 Bacteria 856
308 Ga0495625_0698217 3300046660 Bacteria 599
309 Ga0495635_0017204 3300046663 Bacteria 5048
310 Ga0495661_0168010 3300046665 Bacteria 1172
311 Ga0495588_0008023 3300046674 Bacteria 4827
312 Ga0495588_0461787 3300046674 Bacteria 666
313 Ga0495657_0232914 3300046675 Bacteria 1113
314 Ga0495623_0700324 3300046679 Bacteria 519
315 Ga0495646_0098240 3300046680 Bacteria 1682
316 Ga0495646_0409237 3300046680 Bacteria 704
317 Ga0495624_0039999 3300046690 Bacteria 3004
318 Ga0495671_0121014 3300046692 Bacteria 1277
319 Ga0495671_0479386 3300046692 Bacteria 594
320 Ga0495649_0004374 3300046694 Bacteria 9243
321 Ga0495589_0064033 3300046794 Bacteria 1803
322 Ga0495604_0006433 3300047317 Bacteria 9321
323 Ga0495604_0584893 3300047317 Bacteria 717
324 Ga0495676_0140720 3300047321 Bacteria 1730
325 Ga0495676_0181991 3300047321 Bacteria 1472
326 Ga0495680_0293684 3300047322 Bacteria 1143
327 Ga0495683_0086306 3300047323 Bacteria 1525
328 Ga0495687_052155 3300047443 Bacteria 1731
329 Ga0495673_0039043 3300047469 Bacteria 2156
330 Ga0495673_0061447 3300047469 Bacteria 1608
331 Ga0495673_0246078 3300047469 Bacteria 654
332 Ga0495686_0058551 3300047472 Bacteria 2401
333 Ga0495686_0520208 3300047472 Bacteria 624
334 Ga0495593_0023456 3300047673 Bacteria 3430
335 Ga0495602_0582680 3300048088 Bacteria 771
336 Ga0495602_0710632 3300048088 Bacteria 681
337 Ga0495626_0223754 3300048091 Bacteria 764
338 Ga0495626_0281818 3300048091 Bacteria 660
339 Ga0496100_0194496 3300048903 Bacteria 1474
340 Ga0496100_0341313 3300048903 Bacteria 1129
341 Ga0496101_0103077 3300048904 Bacteria 2138
342 Ga0496101_0129178 3300048904 Bacteria 1917
343 Ga0496102_0712351 3300048905 Bacteria 926
344 Ga0496103_0012305 3300048906 Bacteria 5078
345 Ga0496103_0304909 3300048906 Bacteria 1024
346 Ga0496104_0006350 3300048907 Bacteria 10395
347 Ga0496104_0047462 3300048907 Bacteria 4047
348 Ga0496104_0097134 3300048907 Bacteria 2819
349 Ga0496104_1443615 3300048907 Bacteria 591
350 Ga0496105_0001222 3300048908 Bacteria 17908
351 Ga0496105_0036723 3300048908 Bacteria 4037
352 Ga0496105_0123918 3300048908 Bacteria 2130
353 Ga0496106_0024892 3300048909 Bacteria 4451
354 Ga0496106_0514134 3300048909 Bacteria 962
355 Ga0496107_0122815 3300048910 Bacteria 1913
356 Ga0496107_0290531 3300048910 Bacteria 1217
357 Ga0496108_0013475 3300048911 Bacteria 6671
358 Ga0496108_0499753 3300048911 Bacteria 1062
359 Ga0496108_0508478 3300048911 Bacteria 1052
360 Ga0496108_1254865 3300048911 Bacteria 625
361 Ga0496109_0005319 3300048912 Bacteria 10761
362 Ga0496109_0450886 3300048912 Bacteria 1215
363 Ga0496109_1079799 3300048912 Bacteria 740
364 Ga0496110_0066446 3300048913 Bacteria 3189
365 Ga0496110_0093109 3300048913 Bacteria 2697
366 Ga0496111_0346061 3300048914 Bacteria 1100
367 Ga0496111_0367665 3300048914 Bacteria 1064
368 Ga0496112_0008969 3300048915 Bacteria 8978
369 Ga0496112_0177433 3300048915 Bacteria 2095
370 Ga0496112_0617063 3300048915 Bacteria 1016
371 Ga0496113_0114026 3300048916 Bacteria 2107
372 Ga0496113_0316101 3300048916 Bacteria 1251
373 Ga0496113_0331354 3300048916 Bacteria 1220
374 Ga0496114_0077688 3300048917 Bacteria 2799
375 Ga0496115_0343437 3300048918 Bacteria 1218
376 Ga0496115_0362971 3300048918 Bacteria 1180
377 Ga0496116_0036239 3300048919 Bacteria 3455
378 Ga0496116_0100538 3300048919 Bacteria 1729
379 Ga0496117_0058405 3300048920 Bacteria 2672
380 Ga0496117_0441944 3300048920 Bacteria 645
381 Ga0496118_0014787 3300048921 Bacteria 7280
382 Ga0496118_0063384 3300048921 Bacteria 2720
383 Ga0496119_0008125 3300048922 Bacteria 9292
384 Ga0496119_0053978 3300048922 Bacteria 2450
385 Ga0496119_0058321 3300048922 Bacteria 2327
386 Ga0496119_0388863 3300048922 Bacteria 667
387 Ga0496120_0186142 3300048923 Bacteria 1016
388 Ga0496121_0005990 3300048924 Bacteria 15358
389 Ga0496121_0123295 3300048924 Bacteria 1953
390 Ga0496121_0538875 3300048924 Bacteria 732
391 Ga0496122_0096145 3300048925 Bacteria 1999
392 Ga0496123_0454311 3300048926 Bacteria 570
393 Ga0496124_0078288 3300048927 Bacteria 2725
394 Ga0496124_0079063 3300048927 Bacteria 2709
395 Ga0496124_0727524 3300048927 Bacteria 625
396 Ga0496125_0035738 3300048928 Bacteria 4352
397 Ga0496125_0094033 3300048928 Bacteria 2235
398 Ga0496125_0466878 3300048928 Bacteria 719
399 Ga0496126_0101782 3300048929 Bacteria 2512
400 Ga0496126_0171004 3300048929 Bacteria 1851
401 Ga0496126_0539240 3300048929 Bacteria 927
402 Ga0496126_0620442 3300048929 Bacteria 850
403 Ga0495682_0006553 3300049460 Bacteria 4704
404 nmdc:mga03n38_24576_c1 3300050490 Bacteria 2465
405 nmdc:mga03n38_566611_c1 3300050490 Bacteria 644
406 nmdc:mga00v17_254043_c1 3300050491 Bacteria 1140
407 nmdc:mga00v17_362650_c1 3300050491 Bacteria 942
408 nmdc:mga0yw44_23253_c1 3300050492 Bacteria 3489
409 nmdc:mga0yw44_334037_c1 3300050492 Bacteria 1019
410 nmdc:mga0yw44_43120_c1 3300050492 Bacteria 2692
411 nmdc:mga0yw44_45043_c1 3300050492 Bacteria 2643
412 nmdc:mga0k408_248271_c1 3300050493 Bacteria 1063
413 nmdc:mga06z11_250784_c1 3300050494 Bacteria 1042
414 nmdc:mga06z11_26524_c1 3300050494 Bacteria 2758
415 nmdc:mga04h51_295813_c1 3300050495 Bacteria 659
416 nmdc:mga07m45_176058_c1 3300050496 Bacteria 1244
417 nmdc:mga0sz30_165971_c1 3300050516 Bacteria 979
418 nmdc:mga0sz30_369489_c1 3300050516 Bacteria 642
419 nmdc:mga0sz30_483503_c1 3300050516 Bacteria 557
420 nmdc:mga0sz30_8355_c1 3300050516 Bacteria 3907
421 Ga0495619_0958507 3300053085 Bacteria 574
422 Ga0500578_0039537 3300053086 Bacteria 3031
423 Ga0500578_0414162 3300053086 Bacteria 774
424 Ga0500578_0673400 3300053086 Bacteria 560
425 Ga0500643_000435 3300053087 Bacteria 31475
426 Ga0500583_0115984 3300053092 Bacteria 1322
427 Ga0500566_0000185 3300053094 Bacteria 32171
428 Ga0500640_020705 3300053095 Bacteria 2830
429 Ga0500569_217704 3300053109 Bacteria 649
430 Ga0500572_011520 3300053111 Bacteria 2142
431 Ga0500595_009254 3300053119 Bacteria 3982
432 Ga0500608_021482 3300053122 Bacteria 2983
433 Ga0500614_049120 3300053123 Bacteria 1101
434 Ga0500618_012840 3300053125 Bacteria 2182
435 Ga0500626_093136 3300053128 Bacteria 1321
436 Ga0500642_0000140 3300053130 Bacteria 32282
437 Ga0500559_0045897 3300053136 Bacteria 1914
438 Ga0500564_207162 3300053138 Bacteria 801
439 Ga0500603_272644 3300053150 Bacteria 546
440 Ga0500604_0168081 3300053151 Bacteria 749
441 Ga0500619_066483 3300053154 Bacteria 1193
442 Ga0500620_003064 3300053155 Bacteria 3507
443 Ga0500633_0180634 3300053160 Bacteria 791
444 Ga0500634_0135993 3300053161 Bacteria 1172
445 Ga0500638_023787 3300053162 Bacteria 2915
446 Ga0500638_238774 3300053162 Bacteria 740
447 Ga0500636_0000112 3300053177 Bacteria 42041
448 Ga0500649_069768 3300053722 Bacteria 1452
449 Ga0500552_101270 3300053733 Bacteria 547
450 Ga0500601_000076 3300053737 Bacteria 20083
451 Ga0500661_003733 3300055283 Bacteria 2858
452 2507510998 2507262055 Bacteria 8048963
453 2508544818 2508501009 Bacteria 7784016
454 2508696956 2508501042 Bacteria 8719808
455 2511394092 2511231028 Bacteria 8046582
456 2513623472 2513237092 Bacteria 8341956
457 2513637482 2513237094 Bacteria 8789602
458 2513649669 2513237095 Bacteria 8976980
459 2513701420 2513237102 Bacteria 7703324
460 2513874638 2513237139 Bacteria 8737671
461 2515625450 2515154112 Bacteria 8294334
462 2517100577 2517093001 Bacteria 9002274
463 2524438199 2524023205 Bacteria 8918781
464 2528849833 2528768022 Bacteria 10457665
465 2617377849 2617270741 Bacteria 8201522
466 2745076919 2744054633 Bacteria 8678936
467 2805916635 2802429603 Bacteria 8777136
468 2818238140 2816332527 Bacteria 8933356
469 2824677244 2824671348 Bacteria 8369588
470 2824683850 2824679649 Bacteria 8248951
471 2824693698 2824687955 Bacteria 8360029
472 2824702231 2824696289 Bacteria 8335049
473 2824710915 2824704595 Bacteria 9667483
474 2824737062 2824732956 Bacteria 7810675
475 2824750510 2824746037 Bacteria 7911610
476 2824761821 2824753945 Bacteria 9787441
477 2824772297 2824763712 Bacteria 9792355
478 2838127882 2838122688 Bacteria 8803140
479 2841943175 2841941048 Bacteria 8688029
480 2841956196 2841949485 Bacteria 8680857
481 2841960233 2841957949 Bacteria 8652217
482 2841968184 2841966195 Bacteria 8673214
483 2841976606 2841974524 Bacteria 8931498
484 2841987979 2841983080 Bacteria 8395090
485 2844316929 2844315083 Bacteria 8138177
486 2847938550 2847930680 Bacteria 9342022
487 2849081516 2849076700 Bacteria 7039503
488 2874597735 2874590934 Bacteria 8299676
489 2874615802 2874612657 Bacteria 8252029
490 2874630641 2874628541 Bacteria 8630250
491 2874651265 2874645413 Bacteria 8214782
492 2876762416 2876761206 Bacteria 10111113
493 2876776335 2876771140 Bacteria 8287509
494 2876820903 2876818435 Bacteria 8274608
495 2879081802 2879074833 Bacteria 8279565
496 2879086206 2879083081 Bacteria 8587928
497 2879130517 2879127579 Bacteria 8294491
498 2879146403 2879142872 Bacteria 8267021
499 2881370666 2881364244 Bacteria 7710352
500 2881672698 2881665667 Bacteria 8175609
501 2885366950 2885366525 Bacteria 8326213
502 2885413446 2885409591 Bacteria 9235467
503 2888381538 2888378607 Bacteria 9652610
504 2888389102 2888388044 Bacteria 7304136
505 2903733978 2903727486 Bacteria 8281579
506 2904719213 2904711408 Bacteria 9771557
507 2906604595 2906602504 Bacteria 8295279
508 2906651062 2906643746 Bacteria 8722424
509 2908782096 2908775508 Bacteria 8092255
510 2922393860 2922393267 Bacteria 8285685
511 2932785920 2932784394 Bacteria 9704911
512 2932798300 2932794094 Bacteria 7915132
513 2932804096 2932801729 Bacteria 7987968
514 2932817291 2932809354 Bacteria 9135765
515 2932826888 2932818245 Bacteria 9955613
516 2932830964 2932828146 Bacteria 9745859
517 2933581511 2933577622 Bacteria 9116884
518 2935612764 2935608549 Bacteria 8203142
519 2935621029 2935616580 Bacteria 9032984
520 2935640105 2935638405 Bacteria 10015038
521 2935655440 2935648319 Bacteria 8801166
522 2935664259 2935656913 Bacteria 8965014
523 2935667056 2935665750 Bacteria 9571747
524 2935680300 2935675223 Bacteria 9928132
525 2935690189 2935684952 Bacteria 9590419
526 2935699726 2935694250 Bacteria 9291695
527 2935704812 2935703347 Bacteria 10242284
528 2935718115 2935713505 Bacteria 9608509
529 2935726735 2935722832 Bacteria 9608746
530 2935735504 2935732158 Bacteria 9706831
531 2935745225 2935741537 Bacteria 9707219
532 2935755200 2935750917 Bacteria 9590372
533 2935762284 2935760218 Bacteria 9817913
534 2935803786 2935801545 Bacteria 9301974
535 2935811702 2935810662 Bacteria 9401221
536 2935824254 2935819856 Bacteria 8261050
537 2935829588 2935827899 Bacteria 10038562
538 2935843078 2935837841 Bacteria 9454360
539 2935852600 2935847175 Bacteria 8228321
540 2935858836 2935855204 Bacteria 9035059
541 2935866766 2935864058 Bacteria 9784707
542 2935876897 2935873716 Bacteria 9632195
543 2935884098 2935883170 Bacteria 7964738
544 2935912254 2935908558 Bacteria 8568796
545 2935924072 2935916978 Bacteria 9113783
546 2935929283 2935926038 Bacteria 8601059
547 2935935914 2935934488 Bacteria 8602579
548 2935950422 2935942939 Bacteria 8599779
549 2935957420 2935951376 Bacteria 8602333
550 2935962057 2935959822 Bacteria 7869783
551 2935968451 2935967501 Bacteria 8603075
552 2935976639 2935975950 Bacteria 8347125
553 2935987917 2935984226 Bacteria 8302647
554 2935993466 2935992306 Bacteria 9802711
555 2936004361 2936002035 Bacteria 9362176
556 2936018329 2936011229 Bacteria 8801034
557 2936026908 2936019824 Bacteria 8804134
558 2936035728 2936028420 Bacteria 8965941
559 2936038284 2936037263 Bacteria 9446081
560 2936053807 2936046547 Bacteria 8903709
561 2936058621 2936055302 Bacteria 8785755
562 2940561520 2940556831 Bacteria 9590747
563 2941533710 2941531003 Bacteria 7653939
564 2941544302 2941538514 Bacteria 9402094
565 3005485684 3005483717 Bacteria 7877331
566 3005507138 3005506211 Bacteria 6943378
567 3005594506 3005587118 Bacteria 7794411
568 3005596562 3005594810 Bacteria 8716512
569 3005712630 3005710791 Bacteria 7622528
570 3005719691 3005718088 Bacteria 8283608
571 8016516421 8016511872 Bacteria 9921665
572 8016633834 8016630954 Bacteria 9217207
573 8017060116 8017057580 Bacteria 10023680
574 8019579628 8019576017 Bacteria 10049540
575 8019587337 8019586578 Bacteria 10212056
576 8019604004 8019597564 Bacteria 10041141
577 8019614526 8019608314 Bacteria 10042931
578 8019625153 8019619141 Bacteria 9218857
579 8019637027 8019629233 Bacteria 8687553
580 8019642576 8019638758 Bacteria 9062356
581 8019674428 8019668869 Bacteria 8791617
582 8019681675 8019678201 Bacteria 8863603
583 8019694100 8019687851 Bacteria 8712826
584 8055749152 8055742211 Bacteria 9226248
585 8056970001 8056967851 Bacteria 9038162
586 Ga0068854_100051650
587 JGI24739J22299_10178057
588 JGI25153J46596_10001899
589 JGI25153J46596_10003569
590 JGI25153J46596_10024393
591 JGI25160J50197_1000916
592 JGI25161J50226_1025805
593 Ga0055539_1005368
594 Ga0055529_1025211
595 Ga0055543_1002598
596 Ga0065165_1001630
597 Ga0065165_1001784
598 Ga0065165_1115623
599 Ga0065712_10728155
600 Ga0070683_100658061
601 Ga0070661_100770764
602 Ga0070661_101719261
603 Ga0070668_100054638
604 Ga0070668_100062303
605 Ga0070669_100399799
606 Ga0070669_100591782
607 Ga0070671_100011785
608 Ga0070674_100386354
609 Ga0070673_101265975
610 Ga0070659_100102715
611 Ga0070659_100543803
612 Ga0070667_100025640
613 Ga0070700_101471076
614 Ga0070663_100030983
615 Ga0070663_100601702
616 Ga0070663_101465817
617 Ga0070678_102226929
618 Ga0070662_100109984
619 Ga0068867_101166554
620 Ga0070685_11366767
621 Ga0070684_100004058
622 Ga0070693_100208178
623 Ga0070665_100076670
624 Ga0070665_100495627
625 Ga0068855_100189915
626 Ga0070664_102009100
627 Ga0068857_100502909
628 Ga0068854_100259561
629 Ga0068854_100632939
630 Ga0068854_101373915
631 Ga0068856_100499157
632 Ga0068856_100647089
633 Ga0068852_100004815
634 Ga0068852_100666470
635 Ga0068852_100873796
636 Ga0068859_100272128
637 Ga0068864_102087793
638 Ga0068861_100459120
639 Ga0068861_100619274
640 Ga0068863_100424018
641 Ga0068863_100873771
642 Ga0068858_100331844
643 Ga0068858_101235729
644 Ga0068860_100496719
645 Ga0068860_100563892
646 Ga0068862_101517422
647 Ga0081540_1024046
648 Ga0075365_10052610
649 Ga0075365_10617687
650 Ga0075365_10990501
651 Ga0075368_10247302
652 Ga0075363_100039245
653 Ga0075364_10119577
654 Ga0070715_11092498
655 Ga0075362_10408351
656 Ga0075362_10495928
657 Ga0075367_10278763
658 Ga0075369_10103783
659 Ga0075366_10636388
660 Ga0097621_100874457
661 Ga0097621_101829657
662 Ga0075370_10015574
663 Ga0075370_10209910
664 Ga0097620_100272137
665 Ga0099824_1004100
666 Ga0099822_1064792
667 Ga0099823_1050381
668 Ga0105240_10066543
669 Ga0105245_10060890
670 Ga0105245_10430731
671 Ga0105245_10948389
672 Ga0105247_10040296
673 Ga0105247_10119030
674 Ga0105243_10147587
675 Ga0105243_10436904
676 Ga0105243_10484016
677 Ga0105241_10013912
678 Ga0105241_10027359
679 Ga0105241_10430405
680 Ga0105241_10862558
681 Ga0105248_10307971
682 Ga0105237_10003299
683 Ga0105237_10306199
684 Ga0105237_10425005
685 Ga0105237_10769016
686 Ga0105238_10181059
687 Ga0105249_13299178
688 Ga0105239_10029629
689 Ga0105239_10279635
690 Ga0105239_11231604
691 Ga0105239_11326309
692 Ga0105239_13321437
693 Ga0105246_10125696
694 Ga0105246_11730675
695 Ga0157371_10552610
696 Ga0157369_10247291
697 Ga0157374_10349647
698 Ga0157374_10564135
699 Ga0157378_10322088
700 Ga0163162_10948144
701 Ga0157372_10993296
702 Ga0157372_11423387
703 Ga0157375_10075210
704 Ga0163163_10111642
705 Ga0163163_10165350
706 Ga0182008_10490397
707 Ga0157379_10220995
708 Ga0157379_11402683
709 Ga0157376_10126673
710 Ga0157376_10996324
711 Ga0157376_12104805
712 Ga0182005_1164009
713 Ga0214544_1000026
714 Ga0214542_1000025
715 Ga0214545_1000014
716 Ga0214545_1059275
717 Ga0214545_1067437
718 Ga0214543_1000034
719 Ga0214543_1062614
720 Ga0209563_102821
721 Ga0209677_100778
722 Ga0209148_1000516
723 Ga0209233_1007518
724 Ga0209455_1004171
725 Ga0209455_1032233
726 Ga0209673_1028151
727 Ga0209564_1002228
728 Ga0209758_1002574
729 Ga0209758_1005011
730 Ga0209758_1018699
731 Ga0209758_1079287
732 Ga0209256_1067649
733 Ga0207426_1001022
734 Ga0207426_1001111
735 Ga0209257_1022503
736 Ga0209257_1048315
737 Ga0207692_10418693
738 Ga0207710_10176963
739 Ga0207688_10157982
740 Ga0207647_10016511
741 Ga0207647_10709442
742 Ga0207645_10931728
743 Ga0207654_10019170
744 Ga0207654_10092486
745 Ga0207695_10000062
746 Ga0207671_10003655
747 Ga0207671_10029616
748 Ga0207671_10549058
749 Ga0207671_10719157
750 Ga0207663_11636459
751 Ga0207649_10667821
752 Ga0207649_10910445
753 Ga0207681_10425881
754 Ga0207687_10064332
755 Ga0207644_10039224
756 Ga0207690_10118684
757 Ga0207690_10123720
758 Ga0207690_10442420
759 Ga0207706_10140591
760 Ga0207706_11087392
761 Ga0207709_11748463
762 Ga0207704_10211145
763 Ga0207665_10064802
764 Ga0207711_11659734
765 Ga0207689_10099037
766 Ga0207661_11240388
767 Ga0207679_10117371
768 Ga0207667_10272709
769 Ga0207651_11164103
770 Ga0207668_10018525
771 Ga0207668_10047403
772 Ga0207640_10473510
773 Ga0207640_11758312
774 Ga0207658_12041166
775 Ga0207677_10273790
776 Ga0207703_10225468
777 Ga0207639_11816634
778 Ga0207678_10018655
779 Ga0207678_10925479
780 Ga0207678_11751757
781 Ga0207702_10221880
782 Ga0207702_10721241
783 Ga0207702_11642795
784 Ga0207641_10809550
785 Ga0207641_12031640
786 Ga0207648_10288439
787 Ga0207674_10876825
788 Ga0207674_11703993
789 Ga0207675_100283027
790 Ga0207683_10135600
791 Ga0207698_10453744
792 Ga0207698_10611199
793 Ga0209389_1000004
794 Ga0209389_1000023
795 Ga0209589_1000010
796 Ga0209489_100011
797 Ga0209489_100295
798 Ga0209700_100013
799 Ga0209813_10222764
800 Ga0268266_10077392
801 Ga0268265_10225204
802 Ga0268265_10364673
803 Ga0307517_10309875
804 Ga0307408_100714934
805 Ga0307510_10028510
806 Ga0373935_0155076
807 Ga0395900_0546178
808 Ga0395898_0527072
809 Ga0395898_1132078
810 Ga0395905_0047609
811 Ga0395905_0247773
812 Ga0395905_0835304
813 Ga0436364_1440034
814 Ga0395901_0402719
815 Ga0395901_0493594
816 Ga0436365_1929688
817 Ga0436363_0039498
818 Ga0436362_0340829
819 Ga0451787_489990
820 Ga0451791_0489622
821 Ga0451793_0392809
822 Ga0451798_0591974
823 Ga0451800_1383715
824 Ga0451802_1290278
825 Ga0451833_0733013
826 Ga0451835_0685053
827 Ga0451837_1794711
828 Ga0451839_0344966
829 Ga0451841_0015782
830 Ga0451843_1756696
831 Ga0451853_0151450
832 Ga0466969_0039228
833 Ga0466972_0000598
834 Ga0466972_0008379
835 Ga0466965_0021526
836 Ga0466965_0103885
837 Ga0466965_0222474
838 Ga0466966_0002704
839 Ga0466961_0000149
840 Ga0466961_0307737
841 Ga0466964_0207505
842 Ga0466968_0540554
843 Ga0466968_0570665
844 Ga0466970_0034279
845 Ga0466970_0567258
846 Ga0466960_0122933
847 Ga0466960_0681956
848 Ga0466960_0729214
849 Ga0466960_0739983
850 Ga0466959_0001944
851 Ga0466959_0244761
852 Ga0495590_0264623
853 Ga0495590_0389987
854 Ga0495653_0347397
855 Ga0495582_0849758
856 Ga0495605_0025935
857 Ga0495605_0057622
858 Ga0495605_0071321
859 Ga0495662_0420855
860 Ga0495662_0665649
861 Ga0495664_0055550
862 Ga0495584_0493159
863 Ga0495585_0231710
864 Ga0495607_0180178
865 Ga0495607_0210491
866 Ga0495583_0233981
867 Ga0495583_0420406
868 Ga0495606_0063885
869 Ga0495606_0115145
870 Ga0495608_0281485
871 Ga0495610_0038756
872 Ga0495610_0169032
873 Ga0495620_0060252
874 Ga0495620_0314136
875 Ga0495631_0051637
876 Ga0495632_0042001
877 Ga0495632_0137922
878 Ga0495632_0248772
879 Ga0495643_0105636
880 Ga0495648_0020924
881 Ga0495648_0136902
882 Ga0495652_0548133
883 Ga0495654_0239076
884 Ga0495640_0074157
885 Ga0495645_0066458
886 Ga0495668_0102942
887 Ga0495668_0317932
888 Ga0495668_0375067
889 Ga0495634_0178645
890 Ga0495625_0055046
891 Ga0495625_0354802
892 Ga0495625_0401595
893 Ga0495625_0698217
894 Ga0495635_0017204
895 Ga0495661_0168010
896 Ga0495588_0008023
897 Ga0495588_0461787
898 Ga0495657_0232914
899 Ga0495623_0700324
900 Ga0495646_0098240
901 Ga0495646_0409237
902 Ga0495624_0039999
903 Ga0495671_0121014
904 Ga0495671_0479386
905 Ga0495649_0004374
906 Ga0495589_0064033
907 Ga0495604_0006433
908 Ga0495604_0584893
909 Ga0495676_0140720
910 Ga0495676_0181991
911 Ga0495680_0293684
912 Ga0495683_0086306
913 Ga0495687_052155
914 Ga0495673_0039043
915 Ga0495673_0061447
916 Ga0495673_0246078
917 Ga0495686_0058551
918 Ga0495686_0520208
919 Ga0495593_0023456
920 Ga0495602_0582680
921 Ga0495602_0710632
922 Ga0495626_0223754
923 Ga0495626_0281818
924 Ga0496100_0194496
925 Ga0496100_0341313
926 Ga0496101_0103077
927 Ga0496101_0129178
928 Ga0496102_0712351
929 Ga0496103_0012305
930 Ga0496103_0304909
931 Ga0496104_0006350
932 Ga0496104_0047462
933 Ga0496104_0097134
934 Ga0496104_1443615
935 Ga0496105_0001222
936 Ga0496105_0036723
937 Ga0496105_0123918
938 Ga0496106_0024892
939 Ga0496106_0514134
940 Ga0496107_0122815
941 Ga0496107_0290531
942 Ga0496108_0013475
943 Ga0496108_0499753
944 Ga0496108_0508478
945 Ga0496108_1254865
946 Ga0496109_0005319
947 Ga0496109_0450886
948 Ga0496109_1079799
949 Ga0496110_0066446
950 Ga0496110_0093109
951 Ga0496111_0346061
952 Ga0496111_0367665
953 Ga0496112_0008969
954 Ga0496112_0177433
955 Ga0496112_0617063
956 Ga0496113_0114026
957 Ga0496113_0316101
958 Ga0496113_0331354
959 Ga0496114_0077688
960 Ga0496115_0343437
961 Ga0496115_0362971
962 Ga0496116_0036239
963 Ga0496116_0100538
964 Ga0496117_0058405
965 Ga0496117_0441944
966 Ga0496118_0014787
967 Ga0496118_0063384
968 Ga0496119_0008125
969 Ga0496119_0053978
970 Ga0496119_0058321
971 Ga0496119_0388863
972 Ga0496120_0186142
973 Ga0496121_0005990
974 Ga0496121_0123295
975 Ga0496121_0538875
976 Ga0496122_0096145
977 Ga0496123_0454311
978 Ga0496124_0078288
979 Ga0496124_0079063
980 Ga0496124_0727524
981 Ga0496125_0035738
982 Ga0496125_0094033
983 Ga0496125_0466878
984 Ga0496126_0101782
985 Ga0496126_0171004
986 Ga0496126_0539240
987 Ga0496126_0620442
988 Ga0495682_0006553
989 nmdc:mga03n38_24576_c1
990 nmdc:mga03n38_566611_c1
991 nmdc:mga00v17_254043_c1
992 nmdc:mga00v17_362650_c1
993 nmdc:mga0yw44_23253_c1
994 nmdc:mga0yw44_334037_c1
995 nmdc:mga0yw44_43120_c1
996 nmdc:mga0yw44_45043_c1
997 nmdc:mga0k408_248271_c1
998 nmdc:mga06z11_250784_c1
999 nmdc:mga06z11_26524_c1
1000 nmdc:mga04h51_295813_c1
1001 nmdc:mga07m45_176058_c1
1002 nmdc:mga0sz30_165971_c1
1003 nmdc:mga0sz30_369489_c1
1004 nmdc:mga0sz30_483503_c1
1005 nmdc:mga0sz30_8355_c1
1006 Ga0495619_0958507
1007 Ga0500578_0039537
1008 Ga0500578_0414162
1009 Ga0500578_0673400
1010 Ga0500643_000435
1011 Ga0500583_0115984
1012 Ga0500566_0000185
1013 Ga0500640_020705
1014 Ga0500569_217704
1015 Ga0500572_011520
1016 Ga0500595_009254
1017 Ga0500608_021482
1018 Ga0500614_049120
1019 Ga0500618_012840
1020 Ga0500626_093136
1021 Ga0500642_0000140
1022 Ga0500559_0045897
1023 Ga0500564_207162
1024 Ga0500603_272644
1025 Ga0500604_0168081
1026 Ga0500619_066483
1027 Ga0500620_003064
1028 Ga0500633_0180634
1029 Ga0500634_0135993
1030 Ga0500638_023787
1031 Ga0500638_238774
1032 Ga0500636_0000112
1033 Ga0500649_069768
1034 Ga0500552_101270
1035 Ga0500601_000076
1036 Ga0500661_003733
1037 2507510998
1038 2508544818
1039 2508696956
1040 2511394092
1041 2513623472
1042 2513637482
1043 2513649669
1044 2513701420
1045 2513874638
1046 2515625450
1047 2517100577
1048 2524438199
1049 2528849833
1050 2617377849
1051 2745076919
1052 2805916635
1053 2818238140
1054 2824677244
1055 2824683850
1056 2824693698
1057 2824702231
1058 2824710915
1059 2824737062
1060 2824750510
1061 2824761821
1062 2824772297
1063 2838127882
1064 2841943175
1065 2841956196
1066 2841960233
1067 2841968184
1068 2841976606
1069 2841987979
1070 2844316929
1071 2847938550
1072 2849081516
1073 2874597735
1074 2874615802
1075 2874630641
1076 2874651265
1077 2876762416
1078 2876776335
1079 2876820903
1080 2879081802
1081 2879086206
1082 2879130517
1083 2879146403
1084 2881370666
1085 2881672698
1086 2885366950
1087 2885413446
1088 2888381538
1089 2888389102
1090 2903733978
1091 2904719213
1092 2906604595
1093 2906651062
1094 2908782096
1095 2922393860
1096 2932785920
1097 2932798300
1098 2932804096
1099 2932817291
1100 2932826888
1101 2932830964
1102 2933581511
1103 2935612764
1104 2935621029
1105 2935640105
1106 2935655440
1107 2935664259
1108 2935667056
1109 2935680300
1110 2935690189
1111 2935699726
1112 2935704812
1113 2935718115
1114 2935726735
1115 2935735504
1116 2935745225
1117 2935755200
1118 2935762284
1119 2935803786
1120 2935811702
1121 2935824254
1122 2935829588
1123 2935843078
1124 2935852600
1125 2935858836
1126 2935866766
1127 2935876897
1128 2935884098
1129 2935912254
1130 2935924072
1131 2935929283
1132 2935935914
1133 2935950422
1134 2935957420
1135 2935962057
1136 2935968451
1137 2935976639
1138 2935987917
1139 2935993466
1140 2936004361
1141 2936018329
1142 2936026908
1143 2936035728
1144 2936038284
1145 2936053807
1146 2936058621
1147 2940561520
1148 2941533710
1149 2941544302
1150 3005485684
1151 3005507138
1152 3005594506
1153 3005596562
1154 3005712630
1155 3005719691
1156 8016516421
1157 8016633834
1158 8017060116
1159 8019579628
1160 8019587337
1161 8019604004
1162 8019614526
1163 8019625153
1164 8019637027
1165 8019642576
1166 8019674428
1167 8019681675
1168 8019694100
1169 8055749152
1170 8056970001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map