F466358

General Info

Members Datasets Scaffolds Average Seq Length
584 354 1168 106

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10112458|Ga0157373_101124582
Length 117
Sequence MSPIPWSRAAGGVVLSVRLTPRGSRDSIEGIETFADGRVALKARVRAAPSEGEANTALIRVLAKAVGVPPRNVALISGATSRLKRLMISGDGPTLVAALERLSKTKSRLLWRTVTSR

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
16 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
17 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
101 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
209 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
215 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
216 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
217 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
218 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
219 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
220 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
221 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
225 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
232 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
233 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
236 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
237 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
238 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
239 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
240 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
241 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
242 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
244 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
252 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
253 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
254 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
255 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
256 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
257 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
258 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
259 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
260 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
261 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
262 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
265 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
266 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
267 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
272 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
278 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
279 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
280 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
281 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
282 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
283 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
284 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
285 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
288 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
289 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
290 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
291 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
300 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
301 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
314 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
315 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
316 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
317 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
318 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
321 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
324 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
326 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
327 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
328 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
329 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
330 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
331 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
332 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
333 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
334 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
335 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
336 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
337 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
338 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
339 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
340 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
341 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
342 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
343 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
344 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
345 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
346 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
347 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
348 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
349 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
350 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
351 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
352 2643221736 Bosea sp. Root483D1 Isolate Unclassified
353 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
354 2841917233 Bosea caraganae RCAM04680 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0.68
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.02
Nodule 0.34
Rhizoplane 1.03
Rhizosphere 89.04
Stem 0
Stem Tuber 0
Unclassified 3.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10112458 3300013100 Bacteria 1914
2 JGI24032J14994_101180 3300001430 Bacteria 1171
3 JGI24752J21851_1009722 3300001976 Bacteria 1255
4 JGI24747J21853_1000169 3300001978 Bacteria 3330
5 JGI24739J22299_10001524 3300001989 Bacteria 8748
6 JGI24739J22299_10003887 3300001989 Bacteria 5710
7 JGI24737J22298_10017120 3300001990 Bacteria 2337
8 JGI24743J22301_10008537 3300001991 Bacteria 1798
9 JGI24735J21928_10055399 3300002067 Bacteria 1142
10 JGI24750J21931_1000745 3300002070 Bacteria 4622
11 JGI24745J21846_1000061 3300002073 Bacteria 7701
12 JGI24748J21848_1000185 3300002074 Bacteria 8024
13 JGI24738J21930_10000067 3300002075 Bacteria 21834
14 JGI24749J21850_1001798 3300002076 Bacteria 3033
15 JGI24744J21845_10012664 3300002077 Bacteria 1707
16 JGI24035J26624_1000005 3300002126 Bacteria 14770
17 JGI24035J26624_1000190 3300002126 Bacteria 5699
18 JGI24033J26618_1000613 3300002155 Bacteria 3427
19 JGI24034J26672_10000951 3300002239 Bacteria 3776
20 JGI24742J22300_10000153 3300002244 Bacteria 10167
21 Ga0065712_10130182 3300005290 Bacteria 1555
22 Ga0065715_10008690 3300005293 Bacteria 2691
23 Ga0070658_11241192 3300005327 Bacteria 648
24 Ga0070676_10000332 3300005328 Bacteria 21434
25 Ga0070683_100004171 3300005329 Bacteria 11837
26 Ga0070690_100005079 3300005330 Bacteria 7376
27 Ga0070670_100023341 3300005331 Bacteria 5324
28 Ga0070677_10000258 3300005333 Bacteria 18304
29 Ga0068869_100000510 3300005334 Bacteria 21648
30 Ga0070666_10004570 3300005335 Bacteria 8438
31 Ga0070666_10131556 3300005335 Bacteria 1739
32 Ga0070680_100001476 3300005336 Bacteria 17088
33 Ga0070680_100083665 3300005336 Bacteria 2635
34 Ga0070680_100516411 3300005336 Bacteria 1022
35 Ga0070680_100960408 3300005336 Bacteria 738
36 Ga0070682_100003255 3300005337 Bacteria 9005
37 Ga0070682_101328146 3300005337 Bacteria 612
38 Ga0068868_100000148 3300005338 Bacteria 45833
39 Ga0068868_100026298 3300005338 Bacteria 4434
40 Ga0070660_100001314 3300005339 Bacteria 16922
41 Ga0070660_100080340 3300005339 Bacteria 2558
42 Ga0070689_100014799 3300005340 Bacteria 5675
43 Ga0070691_10035255 3300005341 Bacteria 2355
44 Ga0070691_10887342 3300005341 Bacteria 549
45 Ga0070687_100000318 3300005343 Bacteria 16315
46 Ga0070661_100000768 3300005344 Bacteria 23141
47 Ga0070661_100603172 3300005344 Bacteria 888
48 Ga0070692_10011615 3300005345 Bacteria 4047
49 Ga0070668_100093298 3300005347 Bacteria 2375
50 Ga0070669_100003445 3300005353 Bacteria 11403
51 Ga0070675_100001491 3300005354 Bacteria 17261
52 Ga0070671_100003997 3300005355 Bacteria 11616
53 Ga0070674_100001355 3300005356 Bacteria 12909
54 Ga0070673_100000670 3300005364 Bacteria 18859
55 Ga0070688_100031440 3300005365 Bacteria 3193
56 Ga0070659_100001400 3300005366 Bacteria 17383
57 Ga0070667_100002340 3300005367 Bacteria 16596
58 Ga0070667_100063920 3300005367 Bacteria 3121
59 Ga0070703_10013030 3300005406 Bacteria 2357
60 Ga0070709_10594957 3300005434 Bacteria 851
61 Ga0070713_100000838 3300005436 Bacteria 19660
62 Ga0070710_10240498 3300005437 Bacteria 1159
63 Ga0070701_10019659 3300005438 Bacteria 3193
64 Ga0070701_10508520 3300005438 Bacteria 783
65 Ga0070711_100176345 3300005439 Bacteria 1633
66 Ga0070711_100483277 3300005439 Bacteria 1018
67 Ga0070711_100810728 3300005439 Bacteria 794
68 Ga0070711_100814735 3300005439 Unclassified 792
69 Ga0070705_100001500 3300005440 Bacteria 12285
70 Ga0070700_100001568 3300005441 Bacteria 11405
71 Ga0070694_100002175 3300005444 Bacteria 11621
72 Ga0070708_100105830 3300005445 Bacteria 2581
73 Ga0070663_100001857 3300005455 Bacteria 11779
74 Ga0070678_100000391 3300005456 Bacteria 20585
75 Ga0070662_100001285 3300005457 Bacteria 15435
76 Ga0070681_10006791 3300005458 Bacteria 11139
77 Ga0070681_10345834 3300005458 Bacteria 1397
78 Ga0070681_10628403 3300005458 Unclassified 989
79 Ga0070681_10838818 3300005458 Bacteria 837
80 Ga0070681_11225338 3300005458 Bacteria 673
81 Ga0068867_100006925 3300005459 Bacteria 8025
82 Ga0070685_10003877 3300005466 Bacteria 7563
83 Ga0070706_100501772 3300005467 Bacteria 1129
84 Ga0070706_101104809 3300005467 Bacteria 730
85 Ga0070679_100142520 3300005530 Bacteria 2375
86 Ga0070679_100434409 3300005530 Bacteria 1258
87 Ga0070684_100000101 3300005535 Bacteria 55960
88 Ga0070684_100014524 3300005535 Bacteria 6382
89 Ga0070684_100394473 3300005535 Bacteria 1276
90 Ga0070697_100534046 3300005536 Bacteria 1028
91 Ga0068853_100116865 3300005539 Bacteria 2375
92 Ga0068853_100272734 3300005539 Bacteria 1558
93 Ga0070672_100000016 3300005543 Bacteria 71848
94 Ga0070686_100008745 3300005544 Bacteria 5675
95 Ga0070686_100056715 3300005544 Bacteria 2513
96 Ga0070695_100000225 3300005545 Bacteria 27760
97 Ga0070696_100002898 3300005546 Bacteria 11405
98 Ga0070696_100154125 3300005546 Bacteria 1689
99 Ga0070693_100000138 3300005547 Bacteria 32988
100 Ga0070665_100172093 3300005548 Bacteria 2167
101 Ga0070665_100725920 3300005548 Bacteria 1007
102 Ga0070704_100082859 3300005549 Bacteria 2366
103 Ga0070704_101148435 3300005549 Bacteria 707
104 Ga0068855_100023959 3300005563 Bacteria 7308
105 Ga0068855_100129068 3300005563 Bacteria 2888
106 Ga0068855_100245280 3300005563 Bacteria 1999
107 Ga0068855_100350390 3300005563 Bacteria 1626
108 Ga0068855_101321642 3300005563 Bacteria 745
109 Ga0070664_100000067 3300005564 Bacteria 65201
110 Ga0070664_100689178 3300005564 Bacteria 951
111 Ga0068857_100000275 3300005577 Bacteria 35176
112 Ga0068857_100440780 3300005577 Bacteria 1217
113 Ga0068854_100002271 3300005578 Bacteria 11828
114 Ga0068854_100679642 3300005578 Bacteria 887
115 Ga0068854_100725016 3300005578 Bacteria 860
116 Ga0068856_100001016 3300005614 Bacteria 29871
117 Ga0068856_100069733 3300005614 Bacteria 3476
118 Ga0068856_100261375 3300005614 Bacteria 1746
119 Ga0068856_100294679 3300005614 Bacteria 1639
120 Ga0068856_100504801 3300005614 Bacteria 1230
121 Ga0070702_100000175 3300005615 Bacteria 20470
122 Ga0068852_100000611 3300005616 Bacteria 23441
123 Ga0068852_100368501 3300005616 Bacteria 1407
124 Ga0068852_100684544 3300005616 Bacteria 1035
125 Ga0068859_100002948 3300005617 Bacteria 17261
126 Ga0068864_100000234 3300005618 Bacteria 49663
127 Ga0068864_100698317 3300005618 Bacteria 991
128 Ga0068866_10002227 3300005718 Bacteria 8040
129 Ga0068861_100044242 3300005719 Bacteria 3347
130 Ga0068870_10000009 3300005840 Bacteria 70353
131 Ga0068863_100001729 3300005841 Bacteria 21634
132 Ga0068863_101606764 3300005841 Bacteria 659
133 Ga0068858_100001059 3300005842 Bacteria 28468
134 Ga0068860_100003167 3300005843 Bacteria 16980
135 Ga0068862_100019397 3300005844 Bacteria 5675
136 Ga0070717_11075688 3300006028 Unclassified 732
137 Ga0075368_10032891 3300006042 Bacteria 2016
138 Ga0075368_10190053 3300006042 Bacteria 867
139 Ga0075368_10242962 3300006042 Bacteria 768
140 Ga0075363_100006871 3300006048 Bacteria 5201
141 Ga0075363_100138096 3300006048 Bacteria 1371
142 Ga0075364_10012554 3300006051 Bacteria 5187
143 Ga0075364_11264338 3300006051 Unclassified 500
144 Ga0070715_10417924 3300006163 Bacteria 749
145 Ga0070716_100264030 3300006173 Bacteria 1179
146 Ga0070712_100032812 3300006175 Bacteria 3508
147 Ga0070712_100039495 3300006175 Bacteria 3230
148 Ga0070712_100089725 3300006175 Bacteria 2249
149 Ga0075362_10005087 3300006177 Bacteria 4782
150 Ga0075367_10002731 3300006178 Bacteria 8159
151 Ga0075367_10013106 3300006178 Bacteria 4444
152 Ga0075367_10043407 3300006178 Bacteria 2633
153 Ga0075367_10187867 3300006178 Bacteria 1289
154 Ga0075369_10137754 3300006186 Bacteria 1112
155 Ga0075369_10493999 3300006186 Bacteria 581
156 Ga0075427_10098987 3300006194 Bacteria 541
157 Ga0075366_10320447 3300006195 Bacteria 950
158 Ga0097621_100006760 3300006237 Bacteria 8145
159 Ga0075370_10124204 3300006353 Bacteria 1504
160 Ga0068871_100000012 3300006358 Bacteria 105267
161 Ga0068871_100078982 3300006358 Bacteria 2722
162 Ga0075428_100144398 3300006844 Bacteria 2587
163 Ga0075433_10013023 3300006852 Bacteria 6744
164 Ga0075434_100147219 3300006871 Bacteria 2375
165 Ga0075429_100116999 3300006880 Bacteria 2330
166 Ga0075429_101204676 3300006880 Bacteria 661
167 Ga0068865_100000355 3300006881 Bacteria 25325
168 Ga0075436_100566274 3300006914 Bacteria 835
169 Ga0097620_100002948 3300006931 Bacteria 17261
170 Ga0075435_100148541 3300007076 Bacteria 1969
171 Ga0105251_10106438 3300009011 Bacteria 1280
172 Ga0105240_10087262 3300009093 Bacteria 3821
173 Ga0105240_10379596 3300009093 Bacteria 1596
174 Ga0105240_11091209 3300009093 Bacteria 850
175 Ga0111539_10256640 3300009094 Bacteria 2036
176 Ga0111539_10437159 3300009094 Bacteria 1523
177 Ga0111539_11252087 3300009094 Bacteria 861
178 Ga0105245_10000301 3300009098 Bacteria 47401
179 Ga0105245_10000409 3300009098 Bacteria 39920
180 Ga0114129_10034402 3300009147 Bacteria 7157
181 Ga0114129_10889233 3300009147 Bacteria 1129
182 Ga0114129_11684522 3300009147 Bacteria 774
183 Ga0105248_10110365 3300009177 Bacteria 3101
184 Ga0105238_10027365 3300009551 Bacteria 5809
185 Ga0105238_10054076 3300009551 Bacteria 4034
186 Ga0105249_11089113 3300009553 Bacteria 869
187 Ga0105249_11835496 3300009553 Bacteria 679
188 Ga0105239_10007939 3300010375 Bacteria 12129
189 Ga0157373_10017947 3300013100 Bacteria 5151
190 Ga0157373_10040211 3300013100 Bacteria 3347
191 Ga0157371_10118038 3300013102 Bacteria 1886
192 Ga0157371_10489795 3300013102 Unclassified 907
193 Ga0157370_10058079 3300013104 Bacteria 3677
194 Ga0157370_10091556 3300013104 Bacteria 2855
195 Ga0157370_10250379 3300013104 Bacteria 1639
196 Ga0157370_10754211 3300013104 Bacteria 887
197 Ga0157369_10164508 3300013105 Bacteria 2340
198 Ga0157369_10596760 3300013105 Bacteria 1140
199 Ga0157369_11194160 3300013105 Bacteria 776
200 Ga0157369_11876966 3300013105 Unclassified 608
201 Ga0157374_11336754 3300013296 Bacteria 739
202 Ga0157378_10000872 3300013297 Bacteria 27839
203 Ga0157378_10950688 3300013297 Bacteria 892
204 Ga0157372_10124519 3300013307 Bacteria 2963
205 Ga0157372_10207504 3300013307 Bacteria 2270
206 Ga0157372_10337909 3300013307 Bacteria 1754
207 Ga0163163_10073611 3300014325 Bacteria 3407
208 Ga0163163_11542999 3300014325 Unclassified 725
209 Ga0157380_10166780 3300014326 Bacteria 1920
210 Ga0157380_11188566 3300014326 Bacteria 806
211 Ga0157379_10368390 3300014968 Bacteria 1317
212 Ga0163161_10000499 3300017792 Bacteria 32280
213 Ga0163161_11538491 3300017792 Unclassified 585
214 Ga0206356_10685283 3300020070 Bacteria 920
215 Ga0206354_11087048 3300020081 Bacteria 1219
216 Ga0206353_10987334 3300020082 Bacteria 1940
217 Ga0206353_11998300 3300020082 Bacteria 990
218 Ga0213874_10031547 3300021377 Bacteria 1534
219 Ga0213876_10234752 3300021384 Unclassified 975
220 Ga0207666_1000313 3300025271 Bacteria 6754
221 Ga0207673_1000072 3300025290 Bacteria 8779
222 Ga0209025_1064390 3300025294 Bacteria 1347
223 Ga0207697_10000252 3300025315 Bacteria 29548
224 Ga0207696_1188180 3300025711 Bacteria 544
225 Ga0207655_1067414 3300025728 Bacteria 1347
226 Ga0207653_10005170 3300025885 Bacteria 4080
227 Ga0207682_10000029 3300025893 Bacteria 57930
228 Ga0207642_10000639 3300025899 Bacteria 10739
229 Ga0207710_10002176 3300025900 Bacteria 9215
230 Ga0207688_10000020 3300025901 Bacteria 51200
231 Ga0207680_10001555 3300025903 Bacteria 10815
232 Ga0207680_10139892 3300025903 Bacteria 1604
233 Ga0207647_10266221 3300025904 Bacteria 980
234 Ga0207699_10153857 3300025906 Bacteria 1524
235 Ga0207645_10000108 3300025907 Bacteria 61630
236 Ga0207645_10300188 3300025907 Bacteria 1069
237 Ga0207643_10000044 3300025908 Bacteria 82217
238 Ga0207684_10334163 3300025910 Bacteria 1305
239 Ga0207654_10004211 3300025911 Bacteria 7261
240 Ga0207707_10002475 3300025912 Bacteria 16630
241 Ga0207707_10098156 3300025912 Bacteria 2561
242 Ga0207707_10137962 3300025912 Bacteria 2132
243 Ga0207707_10652259 3300025912 Bacteria 887
244 Ga0207695_10086754 3300025913 Bacteria 3155
245 Ga0207695_10116086 3300025913 Bacteria 2651
246 Ga0207693_10005608 3300025915 Bacteria 10436
247 Ga0207693_10071211 3300025915 Bacteria 2720
248 Ga0207693_10120847 3300025915 Bacteria 2057
249 Ga0207663_10331988 3300025916 Bacteria 1146
250 Ga0207663_10332248 3300025916 Bacteria 1145
251 Ga0207663_10513681 3300025916 Bacteria 932
252 Ga0207663_11382206 3300025916 Unclassified 567
253 Ga0207660_10000543 3300025917 Bacteria 25357
254 Ga0207660_10070734 3300025917 Bacteria 2537
255 Ga0207660_10178723 3300025917 Bacteria 1647
256 Ga0207662_10005777 3300025918 Bacteria 6621
257 Ga0207662_10181600 3300025918 Bacteria 1354
258 Ga0207657_10016668 3300025919 Bacteria 7080
259 Ga0207657_10103241 3300025919 Bacteria 2363
260 Ga0207649_10000057 3300025920 Bacteria 102314
261 Ga0207649_10447528 3300025920 Bacteria 974
262 Ga0207652_10013118 3300025921 Bacteria 6709
263 Ga0207652_10097079 3300025921 Bacteria 2597
264 Ga0207652_10225704 3300025921 Bacteria 1688
265 Ga0207681_10001187 3300025923 Bacteria 16757
266 Ga0207694_10071927 3300025924 Bacteria 2703
267 Ga0207694_10121062 3300025924 Bacteria 2090
268 Ga0207694_10320122 3300025924 Bacteria 1280
269 Ga0207694_10813330 3300025924 Bacteria 789
270 Ga0207694_11711713 3300025924 Unclassified 529
271 Ga0207650_10001534 3300025925 Bacteria 16557
272 Ga0207659_10000028 3300025926 Bacteria 130804
273 Ga0207659_10615059 3300025926 Bacteria 927
274 Ga0207659_10732481 3300025926 Bacteria 847
275 Ga0207687_10000061 3300025927 Bacteria 84113
276 Ga0207687_10016589 3300025927 Bacteria 4838
277 Ga0207700_10698915 3300025928 Bacteria 905
278 Ga0207644_10000194 3300025931 Bacteria 43567
279 Ga0207690_10000225 3300025932 Bacteria 42706
280 Ga0207706_10118069 3300025933 Bacteria 2333
281 Ga0207706_10234050 3300025933 Bacteria 1606
282 Ga0207686_10007051 3300025934 Bacteria 6046
283 Ga0207686_10057225 3300025934 Bacteria 2454
284 Ga0207709_10000291 3300025935 Bacteria 56621
285 Ga0207669_10000019 3300025937 Bacteria 111630
286 Ga0207704_10000438 3300025938 Bacteria 18608
287 Ga0207665_10105265 3300025939 Bacteria 1975
288 Ga0207691_10001047 3300025940 Bacteria 27463
289 Ga0207691_10344642 3300025940 Bacteria 1275
290 Ga0207711_10044822 3300025941 Bacteria 3777
291 Ga0207711_10358972 3300025941 Bacteria 1350
292 Ga0207689_10001160 3300025942 Bacteria 25357
293 Ga0207661_10000126 3300025944 Bacteria 48665
294 Ga0207661_10227435 3300025944 Bacteria 1651
295 Ga0207661_10451198 3300025944 Bacteria 1171
296 Ga0207679_10000026 3300025945 Bacteria 200073
297 Ga0207679_10942314 3300025945 Bacteria 791
298 Ga0207667_10018494 3300025949 Bacteria 7812
299 Ga0207667_10106775 3300025949 Bacteria 2888
300 Ga0207667_10169337 3300025949 Bacteria 2245
301 Ga0207667_10185331 3300025949 Bacteria 2137
302 Ga0207667_10530043 3300025949 Bacteria 1192
303 Ga0207651_10001232 3300025960 Bacteria 11489
304 Ga0207651_10015252 3300025960 Bacteria 4461
305 Ga0207712_10002654 3300025961 Bacteria 11451
306 Ga0207712_10724938 3300025961 Bacteria 869
307 Ga0207668_10000049 3300025972 Bacteria 99391
308 Ga0207668_10610707 3300025972 Bacteria 951
309 Ga0207668_11181989 3300025972 Bacteria 687
310 Ga0207640_10001994 3300025981 Bacteria 11014
311 Ga0207640_10569363 3300025981 Bacteria 955
312 Ga0207640_10724364 3300025981 Bacteria 855
313 Ga0207658_10001093 3300025986 Bacteria 21888
314 Ga0207658_10655824 3300025986 Bacteria 946
315 Ga0207677_10000229 3300026023 Bacteria 44154
316 Ga0207677_10008203 3300026023 Bacteria 5817
317 Ga0207677_10713413 3300026023 Bacteria 891
318 Ga0207703_10012519 3300026035 Bacteria 6612
319 Ga0207639_10002735 3300026041 Bacteria 11838
320 Ga0207639_10146516 3300026041 Bacteria 1973
321 Ga0207639_11349954 3300026041 Bacteria 669
322 Ga0207678_10000403 3300026067 Bacteria 39172
323 Ga0207708_10090192 3300026075 Bacteria 2363
324 Ga0207702_10001378 3300026078 Bacteria 24247
325 Ga0207702_10034279 3300026078 Bacteria 4243
326 Ga0207702_10110054 3300026078 Bacteria 2447
327 Ga0207702_10117776 3300026078 Bacteria 2372
328 Ga0207702_10285067 3300026078 Bacteria 1563
329 Ga0207641_10033694 3300026088 Bacteria 4255
330 Ga0207648_10001244 3300026089 Bacteria 28553
331 Ga0207676_10000672 3300026095 Bacteria 27349
332 Ga0207676_10650525 3300026095 Bacteria 1017
333 Ga0207674_10001968 3300026116 Bacteria 26001
334 Ga0207674_10111655 3300026116 Bacteria 2707
335 Ga0207675_100132497 3300026118 Bacteria 2363
336 Ga0207683_10000034 3300026121 Bacteria 101817
337 Ga0207698_10042171 3300026142 Bacteria 3406
338 Ga0207698_10082670 3300026142 Bacteria 2597
339 Ga0207698_10256100 3300026142 Bacteria 1605
340 Ga0209995_1061382 3300027471 Bacteria 640
341 Ga0209982_1009437 3300027552 Bacteria 1441
342 Ga0210002_1000151 3300027617 Bacteria 10314
343 Ga0210002_1012409 3300027617 Bacteria 1324
344 Ga0209971_1023980 3300027682 Bacteria 1456
345 Ga0209998_10008252 3300027717 Bacteria 2160
346 Ga0209998_10040113 3300027717 Bacteria 1061
347 Ga0209813_10297277 3300027866 Unclassified 626
348 Ga0209974_10018966 3300027876 Bacteria 2281
349 Ga0207428_10000352 3300027907 Bacteria 59444
350 Ga0207428_10115953 3300027907 Bacteria 2057
351 Ga0268266_10111381 3300028379 Bacteria 2425
352 Ga0268266_11275943 3300028379 Bacteria 710
353 Ga0268265_10000410 3300028380 Bacteria 45939
354 Ga0268264_10001567 3300028381 Bacteria 21210
355 Ga0265338_10012159 3300028800 Bacteria 9836
356 Ga0265330_10294703 3300031235 Bacteria 683
357 Ga0265332_10045404 3300031238 Bacteria 1893
358 Ga0265325_10000141 3300031241 Bacteria 50291
359 Ga0265325_10011173 3300031241 Bacteria 5167
360 Ga0265325_10057627 3300031241 Bacteria 1981
361 Ga0265329_10031091 3300031242 Bacteria 1736
362 Ga0265340_10001519 3300031247 Bacteria 13312
363 Ga0265340_10092350 3300031247 Bacteria 1413
364 Ga0265340_10100726 3300031247 Bacteria 1343
365 Ga0265340_10141316 3300031247 Bacteria 1101
366 Ga0265339_10015808 3300031249 Bacteria 4515
367 Ga0265339_10052139 3300031249 Bacteria 2229
368 Ga0265339_10110594 3300031249 Bacteria 1421
369 Ga0265339_10209330 3300031249 Bacteria 958
370 Ga0265331_10035482 3300031250 Bacteria 2454
371 Ga0265316_10087704 3300031344 Bacteria 2377
372 Ga0265316_10089960 3300031344 Bacteria 2342
373 Ga0265316_10344969 3300031344 Bacteria 1079
374 Ga0307408_101228124 3300031548 Bacteria 700
375 Ga0265313_10007607 3300031595 Bacteria 7354
376 Ga0265313_10013161 3300031595 Bacteria 4986
377 Ga0316575_10179362 3300031665 Bacteria 879
378 Ga0265314_10005096 3300031711 Bacteria 11967
379 Ga0265314_10053215 3300031711 Bacteria 2809
380 Ga0265314_10290211 3300031711 Bacteria 922
381 Ga0265342_10000034 3300031712 Bacteria 145074
382 Ga0307412_11449461 3300031911 Bacteria 623
383 Ga0307409_101428992 3300031995 Bacteria 718
384 Ga0307416_103702084 3300032002 Bacteria 512
385 Ga0316583_10000300 3300032133 Bacteria 13878
386 Ga0373948_0079212 3300034817 Bacteria 747
387 Ga0373923_0039425 3300035111 Bacteria 1940
388 Ga0373936_0426553 3300035113 Bacteria 611
389 Ga0373941_0205667 3300035115 Bacteria 750
390 Ga0373945_0306821 3300035116 Bacteria 681
391 Ga0373954_0171716 3300035118 Bacteria 1062
392 Ga0373956_0545572 3300035119 Bacteria 553
393 Ga0373957_0002239 3300035120 Bacteria 5477
394 Ga0373943_0122472 3300035170 Bacteria 1383
395 Ga0373955_0009848 3300035172 Bacteria 4495
396 Ga0373955_0422161 3300035172 Bacteria 811
397 Ga0373924_0023927 3300035410 Bacteria 2402
398 Ga0373933_0036726 3300035724 Bacteria 2870
399 Ga0373933_0040475 3300035724 Bacteria 2746
400 Ga0373933_0103089 3300035724 Bacteria 1772
401 Ga0373933_0481130 3300035724 Unclassified 813
402 Ga0373947_1071746 3300035725 Bacteria 549
403 Ga0373937_0010799 3300036401 Bacteria 7994
404 Ga0373937_0054560 3300036401 Bacteria 3668
405 Ga0373937_0060851 3300036401 Bacteria 3470
406 Ga0373937_0133441 3300036401 Bacteria 2320
407 Ga0373937_0404056 3300036401 Bacteria 1296
408 Ga0373925_0037718 3300037068 Bacteria 3569
409 Ga0436364_0170184 3300037853 Bacteria 944
410 Ga0436364_1337763 3300037853 Bacteria 1936
411 Ga0395901_1308035 3300038443 Bacteria 686
412 Ga0436365_0318789 3300039437 Bacteria 1586
413 Ga0436365_1171355 3300039437 Bacteria 2283
414 Ga0436365_1422081 3300039437 Bacteria 3254
415 Ga0436363_0538156 3300039450 Bacteria 2000
416 Ga0439453_0003663 3300041408 Bacteria 2227
417 Ga0451837_0279224 3300041494 Bacteria 547
418 Ga0451853_3046910 3300041512 Unclassified 545
419 Ga0439437_059374 3300042000 Bacteria 517
420 Ga0439448_0078123 3300042005 Bacteria 1109
421 Ga0439448_0292059 3300042005 Bacteria 578
422 Ga0439455_0024384 3300042012 Bacteria 1463
423 Ga0439455_0185635 3300042012 Bacteria 599
424 Ga0439463_114136 3300042016 Bacteria 697
425 Ga0439435_0015264 3300042436 Bacteria 1909
426 Ga0439435_0105945 3300042436 Bacteria 868
427 Ga0439444_0194053 3300042437 Bacteria 509
428 Ga0439464_0041388 3300042439 Bacteria 1314
429 Ga0439464_0051758 3300042439 Bacteria 1189
430 Ga0439440_0013450 3300042993 Bacteria 1756
431 Ga0439440_0226896 3300042993 Bacteria 562
432 Ga0495592_0000513 3300046454 Bacteria 28143
433 Ga0495592_0114842 3300046454 Bacteria 1901
434 Ga0495592_0169782 3300046454 Bacteria 1495
435 Ga0495629_0413402 3300046459 Bacteria 916
436 Ga0495651_0027931 3300046462 Bacteria 4398
437 Ga0495651_0041623 3300046462 Bacteria 3568
438 Ga0495651_0204633 3300046462 Bacteria 1379
439 Ga0495664_0346375 3300046477 Bacteria 895
440 Ga0495585_0368949 3300046492 Bacteria 695
441 Ga0495608_0029859 3300046511 Bacteria 3695
442 Ga0495608_0089225 3300046511 Bacteria 1996
443 Ga0495618_0104308 3300046514 Bacteria 1815
444 Ga0495620_0218837 3300046515 Bacteria 729
445 Ga0495628_0011083 3300046516 Bacteria 7628
446 Ga0495628_0086999 3300046516 Bacteria 2423
447 Ga0495652_0028963 3300046529 Bacteria 4865
448 Ga0495587_0108616 3300046536 Bacteria 1595
449 Ga0495587_0232640 3300046536 Bacteria 1038
450 Ga0495645_0001151 3300046543 Bacteria 17952
451 Ga0495667_0009093 3300046559 Bacteria 6747
452 Ga0495667_0027764 3300046559 Bacteria 3811
453 Ga0495634_0186518 3300046642 Bacteria 1296
454 Ga0495635_0055805 3300046663 Bacteria 2721
455 Ga0495635_0251920 3300046663 Bacteria 1190
456 Ga0495657_0009329 3300046675 Bacteria 7447
457 Ga0495657_0174451 3300046675 Bacteria 1322
458 Ga0495599_0018304 3300046678 Bacteria 4365
459 Ga0495623_0017571 3300046679 Bacteria 4620
460 Ga0495646_0329126 3300046680 Bacteria 803
461 Ga0495658_0864352 3300046683 Bacteria 578
462 Ga0495600_0091426 3300046809 Bacteria 1985
463 Ga0495581_0726645 3300047315 Unclassified 572
464 Ga0495604_0010832 3300047317 Bacteria 7242
465 Ga0495604_0125615 3300047317 Bacteria 1850
466 Ga0495674_0071150 3300047319 Bacteria 3004
467 Ga0495674_0157003 3300047319 Bacteria 1905
468 Ga0495680_0010622 3300047322 Bacteria 8210
469 Ga0495680_0039787 3300047322 Bacteria 3748
470 Ga0495680_0415992 3300047322 Bacteria 926
471 Ga0495675_0189120 3300047444 Bacteria 1257
472 Ga0495681_0320859 3300047470 Bacteria 595
473 Ga0495684_0070264 3300047471 Bacteria 2662
474 Ga0495593_0396634 3300047673 Bacteria 690
475 Ga0495602_0064510 3300048088 Bacteria 3166
476 Ga0495602_0308210 3300048088 Bacteria 1156
477 Ga0496101_0477483 3300048904 Bacteria 984
478 Ga0496104_0000067 3300048907 Bacteria 108556
479 Ga0496105_0000130 3300048908 Bacteria 50576
480 Ga0496112_0350705 3300048915 Bacteria 1418
481 Ga0496113_0868929 3300048916 Bacteria 714
482 Ga0496115_1347548 3300048918 Bacteria 529
483 Ga0496117_0087304 3300048920 Bacteria 2022
484 Ga0496121_0771199 3300048924 Unclassified 569
485 Ga0496122_0025304 3300048925 Bacteria 5158
486 Ga0496123_0063954 3300048926 Bacteria 2347
487 Ga0501031_0601136 3300049568 Bacteria 708
488 Ga0501032_0111987 3300049569 Bacteria 1806
489 Ga0501033_1138896 3300049570 Bacteria 518
490 Ga0501033_1152813 3300049570 Unclassified 514
491 Ga0501034_0044836 3300049571 Bacteria 4470
492 Ga0501034_0064592 3300049571 Bacteria 3674
493 Ga0501034_0082021 3300049571 Bacteria 3227
494 Ga0501034_1016574 3300049571 Bacteria 712
495 Ga0501036_0811732 3300049572 Bacteria 770
496 Ga0501037_0163867 3300049573 Bacteria 1584
497 Ga0501037_0785923 3300049573 Bacteria 629
498 Ga0501038_0059454 3300049574 Bacteria 3274
499 Ga0501038_1242190 3300049574 Bacteria 540
500 Ga0501040_0535428 3300049576 Bacteria 845
501 Ga0501042_0531523 3300049578 Bacteria 854
502 Ga0501047_0005174 3300049581 Bacteria 12241
503 Ga0501047_0159179 3300049581 Bacteria 2130
504 Ga0501047_0882441 3300049581 Bacteria 708
505 Ga0501048_0702677 3300049582 Bacteria 726
506 Ga0501069_0513563 3300049585 Bacteria 715
507 Ga0501069_0749121 3300049585 Bacteria 590
508 Ga0501070_0011451 3300049586 Bacteria 7494
509 Ga0501070_0054294 3300049586 Bacteria 3323
510 Ga0501070_0186365 3300049586 Bacteria 1707
511 Ga0501070_0207521 3300049586 Bacteria 1609
512 Ga0501071_0038623 3300049587 Bacteria 3412
513 Ga0501072_1263028 3300049588 Bacteria 573
514 Ga0501073_0011637 3300049589 Bacteria 6428
515 Ga0501073_0041041 3300049589 Bacteria 3270
516 Ga0501073_0324520 3300049589 Bacteria 1063
517 Ga0501074_0339129 3300049590 Bacteria 1067
518 Ga0501074_0463108 3300049590 Bacteria 898
519 Ga0501074_1305680 3300049590 Bacteria 508
520 Ga0501076_0482049 3300049592 Unclassified 1022
521 Ga0501076_0550456 3300049592 Bacteria 951
522 Ga0501077_0180698 3300049593 Bacteria 1341
523 Ga0501079_0121128 3300049741 Bacteria 2035
524 Ga0501080_0299549 3300049742 Bacteria 1458
525 Ga0501080_0300825 3300049742 Bacteria 1455
526 Ga0501080_0827116 3300049742 Bacteria 811
527 Ga0501083_0074974 3300049744 Bacteria 2247
528 Ga0501083_0224230 3300049744 Bacteria 1224
529 Ga0501083_0241113 3300049744 Bacteria 1177
530 Ga0501083_0242459 3300049744 Bacteria 1173
531 Ga0501083_0516193 3300049744 Bacteria 778
532 Ga0501035_0227444 3300049822 Bacteria 1591
533 Ga0501035_0437205 3300049822 Bacteria 1084
534 Ga0501044_0052223 3300049823 Bacteria 4213
535 Ga0501044_0128910 3300049823 Bacteria 2525
536 Ga0501044_1062076 3300049823 Bacteria 680
537 nmdc:mga03683_134205_c1 3300050489 Bacteria 1109
538 nmdc:mga03683_136481_c1 3300050489 Bacteria 1100
539 nmdc:mga03683_170907_c1 3300050489 Bacteria 988
540 nmdc:mga03n38_57196_c1 3300050490 Bacteria 1763
541 nmdc:mga03n38_76615_c1 3300050490 Bacteria 1561
542 nmdc:mga00v17_50428_c1 3300050491 Bacteria 2529
543 nmdc:mga0k408_106850_c1 3300050493 Bacteria 1653
544 nmdc:mga0k408_49025_c1 3300050493 Bacteria 2445
545 nmdc:mga06z11_146215_c1 3300050494 Bacteria 1340
546 nmdc:mga06z11_172822_c1 3300050494 Bacteria 1242
547 nmdc:mga06z11_217191_c1 3300050494 Bacteria 1116
548 nmdc:mga04h51_35643_c1 3300050495 Bacteria 1596
549 nmdc:mga07m45_308588_c1 3300050496 Bacteria 920
550 nmdc:mga05p37_1911954_c1 3300050507 Bacteria 566
551 nmdc:mga05p37_1973740_c1 3300050507 Bacteria 553
552 nmdc:mga05p37_314919_c1 3300050507 Bacteria 1854
553 nmdc:mga05p37_44091_c1 3300050507 Bacteria 5488
554 nmdc:mga09592_1289836_c1 3300050508 Bacteria 601
555 nmdc:mga09592_523540_c1 3300050508 Bacteria 1020
556 nmdc:mga0qj67_43999_c1 3300050509 Bacteria 3517
557 nmdc:mga06r32_112196_c1 3300050510 Bacteria 2683
558 nmdc:mga06r32_1401590_c1 3300050510 Bacteria 641
559 nmdc:mga08y16_83568_c1 3300050511 Bacteria 3328
560 nmdc:mga08x19_862492_c1 3300050514 Unclassified 643
561 nmdc:mga0sz30_96124_c1 3300050516 Bacteria 1292
562 Ga0495601_0000237 3300053077 Bacteria 29469
563 Ga0495601_0000293 3300053077 Bacteria 26739
564 Ga0495612_0000563 3300053078 Bacteria 14886
565 Ga0495612_0154345 3300053078 Bacteria 1000
566 Ga0495595_0001594 3300053084 Bacteria 8856
567 Ga0495595_0365296 3300053084 Bacteria 729
568 Ga0495619_0000052 3300053085 Bacteria 98882
569 Ga0495619_0000343 3300053085 Bacteria 32522
570 Ga0500644_0001647 3300053088 Bacteria 5825
571 Ga0500651_0280613 3300053093 Bacteria 961
572 Ga0500651_0415369 3300053093 Bacteria 754
573 Ga0500650_0099824 3300053098 Bacteria 1358
574 Ga0500597_399369 3300053120 Bacteria 523
575 Ga0500655_053080 3300053133 Bacteria 810
576 Ga0500616_0016966 3300053153 Bacteria 4133
577 Ga0500616_0141379 3300053153 Bacteria 1124
578 Ga0500616_0244543 3300053153 Bacteria 769
579 Ga0501082_0108786 3300060353 Bacteria 2399
580 Ga0501082_0146055 3300060353 Bacteria 2053
581 Ga0530510_0525463 3300061734 Unclassified 898
582 2644746124 2643221736 Bacteria 6608466
583 2841911406 2841911363 Bacteria 6173697
584 2841917869 2841917233 Bacteria 6173500
585 Ga0157373_10112458
586 JGI24032J14994_101180
587 JGI24752J21851_1009722
588 JGI24747J21853_1000169
589 JGI24739J22299_10001524
590 JGI24739J22299_10003887
591 JGI24737J22298_10017120
592 JGI24743J22301_10008537
593 JGI24735J21928_10055399
594 JGI24750J21931_1000745
595 JGI24745J21846_1000061
596 JGI24748J21848_1000185
597 JGI24738J21930_10000067
598 JGI24749J21850_1001798
599 JGI24744J21845_10012664
600 JGI24035J26624_1000005
601 JGI24035J26624_1000190
602 JGI24033J26618_1000613
603 JGI24034J26672_10000951
604 JGI24742J22300_10000153
605 Ga0065712_10130182
606 Ga0065715_10008690
607 Ga0070658_11241192
608 Ga0070676_10000332
609 Ga0070683_100004171
610 Ga0070690_100005079
611 Ga0070670_100023341
612 Ga0070677_10000258
613 Ga0068869_100000510
614 Ga0070666_10004570
615 Ga0070666_10131556
616 Ga0070680_100001476
617 Ga0070680_100083665
618 Ga0070680_100516411
619 Ga0070680_100960408
620 Ga0070682_100003255
621 Ga0070682_101328146
622 Ga0068868_100000148
623 Ga0068868_100026298
624 Ga0070660_100001314
625 Ga0070660_100080340
626 Ga0070689_100014799
627 Ga0070691_10035255
628 Ga0070691_10887342
629 Ga0070687_100000318
630 Ga0070661_100000768
631 Ga0070661_100603172
632 Ga0070692_10011615
633 Ga0070668_100093298
634 Ga0070669_100003445
635 Ga0070675_100001491
636 Ga0070671_100003997
637 Ga0070674_100001355
638 Ga0070673_100000670
639 Ga0070688_100031440
640 Ga0070659_100001400
641 Ga0070667_100002340
642 Ga0070667_100063920
643 Ga0070703_10013030
644 Ga0070709_10594957
645 Ga0070713_100000838
646 Ga0070710_10240498
647 Ga0070701_10019659
648 Ga0070701_10508520
649 Ga0070711_100176345
650 Ga0070711_100483277
651 Ga0070711_100810728
652 Ga0070711_100814735
653 Ga0070705_100001500
654 Ga0070700_100001568
655 Ga0070694_100002175
656 Ga0070708_100105830
657 Ga0070663_100001857
658 Ga0070678_100000391
659 Ga0070662_100001285
660 Ga0070681_10006791
661 Ga0070681_10345834
662 Ga0070681_10628403
663 Ga0070681_10838818
664 Ga0070681_11225338
665 Ga0068867_100006925
666 Ga0070685_10003877
667 Ga0070706_100501772
668 Ga0070706_101104809
669 Ga0070679_100142520
670 Ga0070679_100434409
671 Ga0070684_100000101
672 Ga0070684_100014524
673 Ga0070684_100394473
674 Ga0070697_100534046
675 Ga0068853_100116865
676 Ga0068853_100272734
677 Ga0070672_100000016
678 Ga0070686_100008745
679 Ga0070686_100056715
680 Ga0070695_100000225
681 Ga0070696_100002898
682 Ga0070696_100154125
683 Ga0070693_100000138
684 Ga0070665_100172093
685 Ga0070665_100725920
686 Ga0070704_100082859
687 Ga0070704_101148435
688 Ga0068855_100023959
689 Ga0068855_100129068
690 Ga0068855_100245280
691 Ga0068855_100350390
692 Ga0068855_101321642
693 Ga0070664_100000067
694 Ga0070664_100689178
695 Ga0068857_100000275
696 Ga0068857_100440780
697 Ga0068854_100002271
698 Ga0068854_100679642
699 Ga0068854_100725016
700 Ga0068856_100001016
701 Ga0068856_100069733
702 Ga0068856_100261375
703 Ga0068856_100294679
704 Ga0068856_100504801
705 Ga0070702_100000175
706 Ga0068852_100000611
707 Ga0068852_100368501
708 Ga0068852_100684544
709 Ga0068859_100002948
710 Ga0068864_100000234
711 Ga0068864_100698317
712 Ga0068866_10002227
713 Ga0068861_100044242
714 Ga0068870_10000009
715 Ga0068863_100001729
716 Ga0068863_101606764
717 Ga0068858_100001059
718 Ga0068860_100003167
719 Ga0068862_100019397
720 Ga0070717_11075688
721 Ga0075368_10032891
722 Ga0075368_10190053
723 Ga0075368_10242962
724 Ga0075363_100006871
725 Ga0075363_100138096
726 Ga0075364_10012554
727 Ga0075364_11264338
728 Ga0070715_10417924
729 Ga0070716_100264030
730 Ga0070712_100032812
731 Ga0070712_100039495
732 Ga0070712_100089725
733 Ga0075362_10005087
734 Ga0075367_10002731
735 Ga0075367_10013106
736 Ga0075367_10043407
737 Ga0075367_10187867
738 Ga0075369_10137754
739 Ga0075369_10493999
740 Ga0075427_10098987
741 Ga0075366_10320447
742 Ga0097621_100006760
743 Ga0075370_10124204
744 Ga0068871_100000012
745 Ga0068871_100078982
746 Ga0075428_100144398
747 Ga0075433_10013023
748 Ga0075434_100147219
749 Ga0075429_100116999
750 Ga0075429_101204676
751 Ga0068865_100000355
752 Ga0075436_100566274
753 Ga0097620_100002948
754 Ga0075435_100148541
755 Ga0105251_10106438
756 Ga0105240_10087262
757 Ga0105240_10379596
758 Ga0105240_11091209
759 Ga0111539_10256640
760 Ga0111539_10437159
761 Ga0111539_11252087
762 Ga0105245_10000301
763 Ga0105245_10000409
764 Ga0114129_10034402
765 Ga0114129_10889233
766 Ga0114129_11684522
767 Ga0105248_10110365
768 Ga0105238_10027365
769 Ga0105238_10054076
770 Ga0105249_11089113
771 Ga0105249_11835496
772 Ga0105239_10007939
773 Ga0157373_10017947
774 Ga0157373_10040211
775 Ga0157371_10118038
776 Ga0157371_10489795
777 Ga0157370_10058079
778 Ga0157370_10091556
779 Ga0157370_10250379
780 Ga0157370_10754211
781 Ga0157369_10164508
782 Ga0157369_10596760
783 Ga0157369_11194160
784 Ga0157369_11876966
785 Ga0157374_11336754
786 Ga0157378_10000872
787 Ga0157378_10950688
788 Ga0157372_10124519
789 Ga0157372_10207504
790 Ga0157372_10337909
791 Ga0163163_10073611
792 Ga0163163_11542999
793 Ga0157380_10166780
794 Ga0157380_11188566
795 Ga0157379_10368390
796 Ga0163161_10000499
797 Ga0163161_11538491
798 Ga0206356_10685283
799 Ga0206354_11087048
800 Ga0206353_10987334
801 Ga0206353_11998300
802 Ga0213874_10031547
803 Ga0213876_10234752
804 Ga0207666_1000313
805 Ga0207673_1000072
806 Ga0209025_1064390
807 Ga0207697_10000252
808 Ga0207696_1188180
809 Ga0207655_1067414
810 Ga0207653_10005170
811 Ga0207682_10000029
812 Ga0207642_10000639
813 Ga0207710_10002176
814 Ga0207688_10000020
815 Ga0207680_10001555
816 Ga0207680_10139892
817 Ga0207647_10266221
818 Ga0207699_10153857
819 Ga0207645_10000108
820 Ga0207645_10300188
821 Ga0207643_10000044
822 Ga0207684_10334163
823 Ga0207654_10004211
824 Ga0207707_10002475
825 Ga0207707_10098156
826 Ga0207707_10137962
827 Ga0207707_10652259
828 Ga0207695_10086754
829 Ga0207695_10116086
830 Ga0207693_10005608
831 Ga0207693_10071211
832 Ga0207693_10120847
833 Ga0207663_10331988
834 Ga0207663_10332248
835 Ga0207663_10513681
836 Ga0207663_11382206
837 Ga0207660_10000543
838 Ga0207660_10070734
839 Ga0207660_10178723
840 Ga0207662_10005777
841 Ga0207662_10181600
842 Ga0207657_10016668
843 Ga0207657_10103241
844 Ga0207649_10000057
845 Ga0207649_10447528
846 Ga0207652_10013118
847 Ga0207652_10097079
848 Ga0207652_10225704
849 Ga0207681_10001187
850 Ga0207694_10071927
851 Ga0207694_10121062
852 Ga0207694_10320122
853 Ga0207694_10813330
854 Ga0207694_11711713
855 Ga0207650_10001534
856 Ga0207659_10000028
857 Ga0207659_10615059
858 Ga0207659_10732481
859 Ga0207687_10000061
860 Ga0207687_10016589
861 Ga0207700_10698915
862 Ga0207644_10000194
863 Ga0207690_10000225
864 Ga0207706_10118069
865 Ga0207706_10234050
866 Ga0207686_10007051
867 Ga0207686_10057225
868 Ga0207709_10000291
869 Ga0207669_10000019
870 Ga0207704_10000438
871 Ga0207665_10105265
872 Ga0207691_10001047
873 Ga0207691_10344642
874 Ga0207711_10044822
875 Ga0207711_10358972
876 Ga0207689_10001160
877 Ga0207661_10000126
878 Ga0207661_10227435
879 Ga0207661_10451198
880 Ga0207679_10000026
881 Ga0207679_10942314
882 Ga0207667_10018494
883 Ga0207667_10106775
884 Ga0207667_10169337
885 Ga0207667_10185331
886 Ga0207667_10530043
887 Ga0207651_10001232
888 Ga0207651_10015252
889 Ga0207712_10002654
890 Ga0207712_10724938
891 Ga0207668_10000049
892 Ga0207668_10610707
893 Ga0207668_11181989
894 Ga0207640_10001994
895 Ga0207640_10569363
896 Ga0207640_10724364
897 Ga0207658_10001093
898 Ga0207658_10655824
899 Ga0207677_10000229
900 Ga0207677_10008203
901 Ga0207677_10713413
902 Ga0207703_10012519
903 Ga0207639_10002735
904 Ga0207639_10146516
905 Ga0207639_11349954
906 Ga0207678_10000403
907 Ga0207708_10090192
908 Ga0207702_10001378
909 Ga0207702_10034279
910 Ga0207702_10110054
911 Ga0207702_10117776
912 Ga0207702_10285067
913 Ga0207641_10033694
914 Ga0207648_10001244
915 Ga0207676_10000672
916 Ga0207676_10650525
917 Ga0207674_10001968
918 Ga0207674_10111655
919 Ga0207675_100132497
920 Ga0207683_10000034
921 Ga0207698_10042171
922 Ga0207698_10082670
923 Ga0207698_10256100
924 Ga0209995_1061382
925 Ga0209982_1009437
926 Ga0210002_1000151
927 Ga0210002_1012409
928 Ga0209971_1023980
929 Ga0209998_10008252
930 Ga0209998_10040113
931 Ga0209813_10297277
932 Ga0209974_10018966
933 Ga0207428_10000352
934 Ga0207428_10115953
935 Ga0268266_10111381
936 Ga0268266_11275943
937 Ga0268265_10000410
938 Ga0268264_10001567
939 Ga0265338_10012159
940 Ga0265330_10294703
941 Ga0265332_10045404
942 Ga0265325_10000141
943 Ga0265325_10011173
944 Ga0265325_10057627
945 Ga0265329_10031091
946 Ga0265340_10001519
947 Ga0265340_10092350
948 Ga0265340_10100726
949 Ga0265340_10141316
950 Ga0265339_10015808
951 Ga0265339_10052139
952 Ga0265339_10110594
953 Ga0265339_10209330
954 Ga0265331_10035482
955 Ga0265316_10087704
956 Ga0265316_10089960
957 Ga0265316_10344969
958 Ga0307408_101228124
959 Ga0265313_10007607
960 Ga0265313_10013161
961 Ga0316575_10179362
962 Ga0265314_10005096
963 Ga0265314_10053215
964 Ga0265314_10290211
965 Ga0265342_10000034
966 Ga0307412_11449461
967 Ga0307409_101428992
968 Ga0307416_103702084
969 Ga0316583_10000300
970 Ga0373948_0079212
971 Ga0373923_0039425
972 Ga0373936_0426553
973 Ga0373941_0205667
974 Ga0373945_0306821
975 Ga0373954_0171716
976 Ga0373956_0545572
977 Ga0373957_0002239
978 Ga0373943_0122472
979 Ga0373955_0009848
980 Ga0373955_0422161
981 Ga0373924_0023927
982 Ga0373933_0036726
983 Ga0373933_0040475
984 Ga0373933_0103089
985 Ga0373933_0481130
986 Ga0373947_1071746
987 Ga0373937_0010799
988 Ga0373937_0054560
989 Ga0373937_0060851
990 Ga0373937_0133441
991 Ga0373937_0404056
992 Ga0373925_0037718
993 Ga0436364_0170184
994 Ga0436364_1337763
995 Ga0395901_1308035
996 Ga0436365_0318789
997 Ga0436365_1171355
998 Ga0436365_1422081
999 Ga0436363_0538156
1000 Ga0439453_0003663
1001 Ga0451837_0279224
1002 Ga0451853_3046910
1003 Ga0439437_059374
1004 Ga0439448_0078123
1005 Ga0439448_0292059
1006 Ga0439455_0024384
1007 Ga0439455_0185635
1008 Ga0439463_114136
1009 Ga0439435_0015264
1010 Ga0439435_0105945
1011 Ga0439444_0194053
1012 Ga0439464_0041388
1013 Ga0439464_0051758
1014 Ga0439440_0013450
1015 Ga0439440_0226896
1016 Ga0495592_0000513
1017 Ga0495592_0114842
1018 Ga0495592_0169782
1019 Ga0495629_0413402
1020 Ga0495651_0027931
1021 Ga0495651_0041623
1022 Ga0495651_0204633
1023 Ga0495664_0346375
1024 Ga0495585_0368949
1025 Ga0495608_0029859
1026 Ga0495608_0089225
1027 Ga0495618_0104308
1028 Ga0495620_0218837
1029 Ga0495628_0011083
1030 Ga0495628_0086999
1031 Ga0495652_0028963
1032 Ga0495587_0108616
1033 Ga0495587_0232640
1034 Ga0495645_0001151
1035 Ga0495667_0009093
1036 Ga0495667_0027764
1037 Ga0495634_0186518
1038 Ga0495635_0055805
1039 Ga0495635_0251920
1040 Ga0495657_0009329
1041 Ga0495657_0174451
1042 Ga0495599_0018304
1043 Ga0495623_0017571
1044 Ga0495646_0329126
1045 Ga0495658_0864352
1046 Ga0495600_0091426
1047 Ga0495581_0726645
1048 Ga0495604_0010832
1049 Ga0495604_0125615
1050 Ga0495674_0071150
1051 Ga0495674_0157003
1052 Ga0495680_0010622
1053 Ga0495680_0039787
1054 Ga0495680_0415992
1055 Ga0495675_0189120
1056 Ga0495681_0320859
1057 Ga0495684_0070264
1058 Ga0495593_0396634
1059 Ga0495602_0064510
1060 Ga0495602_0308210
1061 Ga0496101_0477483
1062 Ga0496104_0000067
1063 Ga0496105_0000130
1064 Ga0496112_0350705
1065 Ga0496113_0868929
1066 Ga0496115_1347548
1067 Ga0496117_0087304
1068 Ga0496121_0771199
1069 Ga0496122_0025304
1070 Ga0496123_0063954
1071 Ga0501031_0601136
1072 Ga0501032_0111987
1073 Ga0501033_1138896
1074 Ga0501033_1152813
1075 Ga0501034_0044836
1076 Ga0501034_0064592
1077 Ga0501034_0082021
1078 Ga0501034_1016574
1079 Ga0501036_0811732
1080 Ga0501037_0163867
1081 Ga0501037_0785923
1082 Ga0501038_0059454
1083 Ga0501038_1242190
1084 Ga0501040_0535428
1085 Ga0501042_0531523
1086 Ga0501047_0005174
1087 Ga0501047_0159179
1088 Ga0501047_0882441
1089 Ga0501048_0702677
1090 Ga0501069_0513563
1091 Ga0501069_0749121
1092 Ga0501070_0011451
1093 Ga0501070_0054294
1094 Ga0501070_0186365
1095 Ga0501070_0207521
1096 Ga0501071_0038623
1097 Ga0501072_1263028
1098 Ga0501073_0011637
1099 Ga0501073_0041041
1100 Ga0501073_0324520
1101 Ga0501074_0339129
1102 Ga0501074_0463108
1103 Ga0501074_1305680
1104 Ga0501076_0482049
1105 Ga0501076_0550456
1106 Ga0501077_0180698
1107 Ga0501079_0121128
1108 Ga0501080_0299549
1109 Ga0501080_0300825
1110 Ga0501080_0827116
1111 Ga0501083_0074974
1112 Ga0501083_0224230
1113 Ga0501083_0241113
1114 Ga0501083_0242459
1115 Ga0501083_0516193
1116 Ga0501035_0227444
1117 Ga0501035_0437205
1118 Ga0501044_0052223
1119 Ga0501044_0128910
1120 Ga0501044_1062076
1121 nmdc:mga03683_134205_c1
1122 nmdc:mga03683_136481_c1
1123 nmdc:mga03683_170907_c1
1124 nmdc:mga03n38_57196_c1
1125 nmdc:mga03n38_76615_c1
1126 nmdc:mga00v17_50428_c1
1127 nmdc:mga0k408_106850_c1
1128 nmdc:mga0k408_49025_c1
1129 nmdc:mga06z11_146215_c1
1130 nmdc:mga06z11_172822_c1
1131 nmdc:mga06z11_217191_c1
1132 nmdc:mga04h51_35643_c1
1133 nmdc:mga07m45_308588_c1
1134 nmdc:mga05p37_1911954_c1
1135 nmdc:mga05p37_1973740_c1
1136 nmdc:mga05p37_314919_c1
1137 nmdc:mga05p37_44091_c1
1138 nmdc:mga09592_1289836_c1
1139 nmdc:mga09592_523540_c1
1140 nmdc:mga0qj67_43999_c1
1141 nmdc:mga06r32_112196_c1
1142 nmdc:mga06r32_1401590_c1
1143 nmdc:mga08y16_83568_c1
1144 nmdc:mga08x19_862492_c1
1145 nmdc:mga0sz30_96124_c1
1146 Ga0495601_0000237
1147 Ga0495601_0000293
1148 Ga0495612_0000563
1149 Ga0495612_0154345
1150 Ga0495595_0001594
1151 Ga0495595_0365296
1152 Ga0495619_0000052
1153 Ga0495619_0000343
1154 Ga0500644_0001647
1155 Ga0500651_0280613
1156 Ga0500651_0415369
1157 Ga0500650_0099824
1158 Ga0500597_399369
1159 Ga0500655_053080
1160 Ga0500616_0016966
1161 Ga0500616_0141379
1162 Ga0500616_0244543
1163 Ga0501082_0108786
1164 Ga0501082_0146055
1165 Ga0530510_0525463
1166 2644746124
1167 2841911406
1168 2841917869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02594

DUF167

Uncharacterised ACR, YggU family COG1872

12

89

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yh5-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.7055 5 106
1n91-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.6983 1 106
1n91-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.6869 1 106
1yh5-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.66 5 106
6fg9-assembly1.cif.gz_B mouse sorcs2 ectodomain (sortilin related vps10 domain containing receptor 2) 0.62 39 101
ID Description Score Start End Superfamily
af_B7EHD8_35_125_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.8758 10 101 3.30.1200.10
af_Q58035_1_98_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.8645 1 102 3.30.1200.10
af_Q58035_1_98_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.8484 1 102 3.30.1200.10
af_P52060_1_96_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.8477 4 99 3.30.1200.10
af_B7EHD8_35_125_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.8399 10 101 3.30.1200.10
ID Description Score Start End GO Terms
AF-A0A7Z2SPD6-F1-model_v4 Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] 0.9976 4 103 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A0Q8Q6J1-F1-model_v4 UPF0235 protein ASE00_19790 0.9943 5 103 GO:0005737
AF-A0A0D7QFZ3-F1-model_v4 UPF0235 protein UP10_07760 0.9942 4 104
AF-A0A1C3XNB6-F1-model_v4 UPF0235 protein GA0061098_1019150 0.9938 3 104
AF-A0A537XHM5-F1-model_v4 UPF0235 protein E6G70_24870 0.9917 4 106

Map