F466345

General Info

Members Datasets Scaffolds Average Seq Length
584 359 473 85

Family's Representative Sequence

Representative Sequence 3300005615|Ga0070702_100229863|Ga0070702_1002298631
Length 96
Sequence LSIVWIIIIGFLAGVVARLLSPGPNNPTGFLLTTILGIVGAFVATFLGQTVGWYRADQGAGLIGATVGAILILFIWNRLVANRTIRDPGVTGRRWL

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
6 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
7 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
8 2643221733 Bosea sp. Root381 Isolate Unclassified
9 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
10 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
11 2818991467 Bosea vestrisii 3192 Isolate Unclassified
12 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
13 2841760612 Bosea sp. Tri-49 Isolate Nodule
14 2844104063 Bosea sp. Tri-39 Isolate Nodule
15 2851182111 Bosea sp. Tri-44 Isolate Nodule
16 2851246043 Bosea sp. Tri-54 Isolate Nodule
17 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
18 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
19 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
20 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
21 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
22 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
23 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
24 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
25 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
26 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
27 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
28 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
29 2932401849 Devosia sp. 2618 Isolate Rhizosphere
30 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
31 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
32 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
33 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
34 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
35 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
36 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
37 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
38 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
39 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
40 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
41 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
42 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
43 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
44 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
45 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
46 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
47 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
48 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
49 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
50 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
51 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
52 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
53 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
54 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
55 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
56 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
57 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
58 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
59 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
60 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
61 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
62 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
63 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
64 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
65 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
66 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
67 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
68 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
69 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
70 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
71 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
72 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
73 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
75 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
76 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
77 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
79 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
80 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
81 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
82 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
83 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
84 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
85 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
86 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
87 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
88 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
89 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
90 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
91 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
92 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
93 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
94 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
95 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
96 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
97 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
98 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
99 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
100 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
101 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
102 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
103 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
104 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
105 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
106 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
107 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
108 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
109 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
110 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
111 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
112 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
113 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
114 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
115 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
116 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
117 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
118 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
119 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
120 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
121 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
122 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
123 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
124 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
125 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
126 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
127 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
128 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
129 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
130 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
131 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
132 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
133 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
134 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
135 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
136 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
137 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
138 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
139 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
140 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
141 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
142 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
143 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
144 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
145 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
146 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
147 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
148 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
149 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
150 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
151 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
152 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
153 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
154 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
155 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
156 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
157 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
158 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
159 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
160 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
161 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
162 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
163 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
164 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
165 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
166 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
167 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
168 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
169 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
170 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
171 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
172 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
173 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
174 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
175 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
176 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
177 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
178 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
179 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
180 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
181 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
182 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
183 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
184 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
185 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
186 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
187 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
188 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
189 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
190 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
191 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
192 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
193 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
257 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
259 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
263 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
264 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
265 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
266 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
267 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
268 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
269 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
270 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
271 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
272 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
273 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
274 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
275 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
276 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
277 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
278 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
279 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
280 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
281 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
284 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
287 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
294 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
304 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
305 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
310 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
311 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
312 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
313 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
314 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
317 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
318 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
319 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
320 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
321 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
322 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
323 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
326 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
327 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
328 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
329 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
330 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
331 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
332 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
333 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
334 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
335 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
336 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
337 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
338 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
339 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
340 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
341 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
342 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 641522639 Methylobacterium sp. 4-46 Isolate Nodule
344 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
345 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
346 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
347 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
348 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
349 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
350 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
351 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
352 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
353 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
354 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
355 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
356 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
357 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
358 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
359 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.1
Metatranscriptomes 1.03
Isolates 18.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.34
Nodule 17.12
Rhizoplane 9.25
Rhizosphere 63.7
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214939095 2209111006 Unclassified 540
2 JGI24739J22299_10140049 3300001989 Bacteria 717
3 JGI24738J21930_10038943 3300002075 Bacteria 966
4 JGI24744J21845_10052700 3300002077 Bacteria 749
5 JGI24742J22300_10106271 3300002244 Bacteria 546
6 JGI25406J46586_10002044 3300003203 Bacteria 9521
7 JGI25153J46596_10009379 3300003215 Bacteria 4559
8 rootL2_10101098 3300003322 Bacteria 1933
9 Ga0058860_11911029 3300004801 Bacteria 652
10 Ga0058862_11914580 3300004803 Bacteria 581
11 Ga0070676_10031818 3300005328 Bacteria 3018
12 Ga0070683_100416047 3300005329 Bacteria 1282
13 Ga0070690_100062337 3300005330 Bacteria 2405
14 Ga0070690_100322895 3300005330 Bacteria 1113
15 Ga0070670_100169366 3300005331 Bacteria 1894
16 Ga0068869_100818349 3300005334 Bacteria 801
17 Ga0068869_100945950 3300005334 Bacteria 748
18 Ga0070666_10647980 3300005335 Bacteria 773
19 Ga0070666_11121601 3300005335 Bacteria 585
20 Ga0070682_100294856 3300005337 Bacteria 1187
21 Ga0068868_100121682 3300005338 Bacteria 2129
22 Ga0068868_101126957 3300005338 Bacteria 723
23 Ga0070660_100084652 3300005339 Bacteria 2492
24 Ga0070660_100221059 3300005339 Bacteria 1539
25 Ga0070689_100047320 3300005340 Bacteria 3316
26 Ga0070689_100767259 3300005340 Bacteria 846
27 Ga0070689_101601640 3300005340 Unclassified 591
28 Ga0070687_100136604 3300005343 Bacteria 1422
29 Ga0070661_100029313 3300005344 Bacteria 3972
30 Ga0070661_100432620 3300005344 Bacteria 1044
31 Ga0070668_100121997 3300005347 Bacteria 2084
32 Ga0070668_100270760 3300005347 Bacteria 1415
33 Ga0070675_100307609 3300005354 Bacteria 1398
34 Ga0070675_100992220 3300005354 Bacteria 771
35 Ga0070671_100286140 3300005355 Bacteria 1402
36 Ga0070674_100125642 3300005356 Bacteria 1904
37 Ga0070673_100310403 3300005364 Bacteria 1391
38 Ga0070688_100105105 3300005365 Bacteria 1868
39 Ga0070659_100062026 3300005366 Bacteria 2954
40 Ga0070659_100553466 3300005366 Bacteria 985
41 Ga0070667_100031236 3300005367 Bacteria 4441
42 Ga0070667_100577716 3300005367 Unclassified 1034
43 Ga0070667_101477595 3300005367 Bacteria 638
44 Ga0070709_10008184 3300005434 Bacteria 5742
45 Ga0070709_10475559 3300005434 Bacteria 945
46 Ga0070709_11223710 3300005434 Unclassified 604
47 Ga0070714_100045484 3300005435 Plasmid 3721
48 Ga0070713_100017924 3300005436 Bacteria 5372
49 Ga0070710_10088345 3300005437 Bacteria 1823
50 Ga0070701_10193829 3300005438 Bacteria 1197
51 Ga0070711_100276204 3300005439 Bacteria 1327
52 Ga0070711_100393489 3300005439 Bacteria 1123
53 Ga0070705_100259459 3300005440 Bacteria 1225
54 Ga0070705_100403068 3300005440 Unclassified 1013
55 Ga0070700_100147189 3300005441 Bacteria 1607
56 Ga0070700_100195988 3300005441 Bacteria 1416
57 Ga0070700_101586215 3300005441 Bacteria 559
58 Ga0070700_101641283 3300005441 Bacteria 550
59 Ga0070694_100096099 3300005444 Bacteria 2088
60 Ga0070694_100904733 3300005444 Unclassified 729
61 Ga0070663_100110353 3300005455 Bacteria 2066
62 Ga0070663_100117513 3300005455 Bacteria 2005
63 Ga0070663_100230246 3300005455 Unclassified 1459
64 Ga0070663_101868704 3300005455 Unclassified 539
65 Ga0070678_100057262 3300005456 Bacteria 2855
66 Ga0070678_100589245 3300005456 Bacteria 991
67 Ga0070678_101037223 3300005456 Unclassified 755
68 Ga0070662_100136137 3300005457 Bacteria 1899
69 Ga0070662_100720644 3300005457 Bacteria 845
70 Ga0070681_11441252 3300005458 Bacteria 613
71 Ga0068867_100493284 3300005459 Bacteria 1051
72 Ga0068867_101394535 3300005459 Unclassified 650
73 Ga0070685_10070207 3300005466 Bacteria 2074
74 Ga0070679_100806445 3300005530 Bacteria 882
75 Ga0070679_101572205 3300005530 Bacteria 605
76 Ga0070697_101641841 3300005536 Bacteria 575
77 Ga0070697_102138753 3300005536 Unclassified 501
78 Ga0068853_100298512 3300005539 Bacteria 1488
79 Ga0070672_100125555 3300005543 Bacteria 2104
80 Ga0070686_100070177 3300005544 Bacteria 2290
81 Ga0070695_100090689 3300005545 Bacteria 2040
82 Ga0070696_100461774 3300005546 Bacteria 1004
83 Ga0070696_100554043 3300005546 Bacteria 921
84 Ga0070693_100007252 3300005547 Bacteria 5412
85 Ga0070693_100532085 3300005547 Bacteria 838
86 Ga0070665_100005008 3300005548 Bacteria 13742
87 Ga0070665_100561010 3300005548 Bacteria 1154
88 Ga0070665_101161484 3300005548 Unclassified 783
89 Ga0070665_101709733 3300005548 Unclassified 636
90 Ga0070665_102338605 3300005548 Unclassified 537
91 Ga0070704_100741552 3300005549 Bacteria 874
92 Ga0070704_101220339 3300005549 Bacteria 686
93 Ga0068855_100629426 3300005563 Bacteria 1154
94 Ga0070664_100045548 3300005564 Bacteria 3704
95 Ga0070664_100279286 3300005564 Bacteria 1506
96 Ga0070664_101269265 3300005564 Bacteria 695
97 Ga0070664_101964828 3300005564 Bacteria 555
98 Ga0068857_100070645 3300005577 Bacteria 3110
99 Ga0068854_100048960 3300005578 Bacteria 3017
100 Ga0068856_100007190 3300005614 Bacteria 10858
101 Ga0068856_100080655 3300005614 Bacteria 3227
102 Ga0068856_100134163 3300005614 Bacteria 2481
103 Ga0068856_100543499 3300005614 Bacteria 1183
104 Ga0068856_100793492 3300005614 Bacteria 967
105 Ga0068856_101304819 3300005614 Bacteria 741
106 Ga0070702_100028364 3300005615 Bacteria 3033
107 Ga0070702_100163709 3300005615 Unclassified 1440
108 Ga0070702_100229863 3300005615 Bacteria 1246
109 Ga0068852_102454455 3300005616 Bacteria 542
110 Ga0068859_100979037 3300005617 Bacteria 928
111 Ga0068859_101404444 3300005617 Bacteria 770
112 Ga0068864_101156343 3300005618 Bacteria 771
113 Ga0068866_10011372 3300005718 Bacteria 3849
114 Ga0068866_10220507 3300005718 Bacteria 1144
115 Ga0068866_10258630 3300005718 Bacteria 1069
116 Ga0068866_10600575 3300005718 Bacteria 743
117 Ga0068861_100075228 3300005719 Bacteria 2628
118 Ga0068861_100539740 3300005719 Unclassified 1061
119 Ga0068861_100615315 3300005719 Bacteria 999
120 Ga0068861_102126643 3300005719 Unclassified 561
121 Ga0068851_10035769 3300005834 Bacteria 2485
122 Ga0068851_11014031 3300005834 Bacteria 524
123 Ga0068870_10045909 3300005840 Bacteria 2289
124 Ga0068863_100228197 3300005841 Bacteria 1795
125 Ga0068863_102106535 3300005841 Unclassified 574
126 Ga0068858_100218208 3300005842 Bacteria 1806
127 Ga0068858_100516861 3300005842 Bacteria 1154
128 Ga0068858_102106868 3300005842 Unclassified 558
129 Ga0068860_100080059 3300005843 Bacteria 3106
130 Ga0068860_100320413 3300005843 Bacteria 1521
131 Ga0068860_100463075 3300005843 Bacteria 1262
132 Ga0068860_101931314 3300005843 Bacteria 612
133 Ga0068860_102363346 3300005843 Bacteria 552
134 Ga0068862_100125298 3300005844 Bacteria 2268
135 Ga0068862_100568409 3300005844 Bacteria 1085
136 Ga0068862_101235730 3300005844 Unclassified 746
137 Ga0068862_101266941 3300005844 Bacteria 738
138 Ga0081455_10215964 3300005937 Bacteria 1425
139 Ga0081540_1000131 3300005983 Bacteria 79958
140 Ga0081540_1036814 3300005983 Bacteria 2603
141 Ga0081539_10000640 3300005985 Bacteria 70720
142 Ga0070717_10045438 3300006028 Plasmid 3591
143 Ga0070717_11143702 3300006028 Bacteria 709
144 Ga0075365_10004445 3300006038 Bacteria 7430
145 Ga0075365_10089495 3300006038 Bacteria 2095
146 Ga0075365_10255712 3300006038 Bacteria 1231
147 Ga0075365_10272629 3300006038 Bacteria 1190
148 Ga0075368_10125809 3300006042 Bacteria 1064
149 Ga0075363_100039105 3300006048 Bacteria 2496
150 Ga0075364_10101332 3300006051 Bacteria 1917
151 Ga0075364_10325517 3300006051 Bacteria 1047
152 Ga0070716_100619622 3300006173 Bacteria 816
153 Ga0070712_100015112 3300006175 Bacteria 4964
154 Ga0070712_100435653 3300006175 Bacteria 1089
155 Ga0070712_100590604 3300006175 Unclassified 939
156 Ga0075362_10018950 3300006177 Bacteria 2855
157 Ga0075362_10102284 3300006177 Bacteria 1341
158 Ga0075369_10008711 3300006186 Bacteria 3916
159 Ga0075369_10022694 3300006186 Bacteria 2590
160 Ga0097621_100083466 3300006237 Bacteria 2662
161 Ga0097621_102074240 3300006237 Unclassified 543
162 Ga0068871_100038913 3300006358 Bacteria 3802
163 Ga0075428_100090838 3300006844 Bacteria 3331
164 Ga0075433_10479522 3300006852 Bacteria 1096
165 Ga0075433_10655110 3300006852 Unclassified 920
166 Ga0075434_100023391 3300006871 Bacteria 6020
167 Ga0075434_100048247 3300006871 Unclassified 4225
168 Ga0075434_100346481 3300006871 Unclassified 1507
169 Ga0075429_100516078 3300006880 Unclassified 1047
170 Ga0068865_100030227 3300006881 Bacteria 3602
171 Ga0068865_100393122 3300006881 Bacteria 1134
172 Ga0068865_101702089 3300006881 Bacteria 568
173 Ga0097620_100979004 3300006931 Bacteria 928
174 Ga0097620_101404496 3300006931 Bacteria 770
175 Ga0075435_100174199 3300007076 Unclassified 1816
176 Ga0105251_10090843 3300009011 Bacteria 1403
177 Ga0105244_10535065 3300009036 Unclassified 540
178 Ga0105240_10062467 3300009093 Bacteria 4637
179 Ga0105245_10124028 3300009098 Bacteria 2415
180 Ga0105245_10334236 3300009098 Bacteria 1496
181 Ga0105245_10768690 3300009098 Bacteria 1000
182 Ga0105245_11711810 3300009098 Bacteria 681
183 Ga0105247_10029022 3300009101 Bacteria 3350
184 Ga0105247_10082235 3300009101 Bacteria 2032
185 Ga0105247_10312712 3300009101 Bacteria 1093
186 Ga0114129_10086965 3300009147 Bacteria 4334
187 Ga0114129_12443388 3300009147 Bacteria 625
188 Ga0105243_10065692 3300009148 Bacteria 2915
189 Ga0105243_10163502 3300009148 Bacteria 1921
190 Ga0105241_11323264 3300009174 Bacteria 687
191 Ga0105242_10068485 3300009176 Bacteria 2936
192 Ga0105242_10622920 3300009176 Bacteria 1045
193 Ga0105248_10357017 3300009177 Bacteria 1645
194 Ga0105237_10081725 3300009545 Plasmid 3222
195 Ga0105237_10447918 3300009545 Bacteria 1297
196 Ga0105237_10518598 3300009545 Bacteria 1198
197 Ga0105238_10052061 3300009551 Bacteria 4116
198 Ga0105238_11831052 3300009551 Bacteria 639
199 Ga0105249_10019839 3300009553 Bacteria 6002
200 Ga0105249_10217794 3300009553 Bacteria 1877
201 Ga0105249_12596323 3300009553 Unclassified 579
202 Ga0105239_10212503 3300010375 Bacteria 2168
203 Ga0105239_10478085 3300010375 Bacteria 1415
204 Ga0105239_10855934 3300010375 Bacteria 1043
205 Ga0105239_10984208 3300010375 Bacteria 969
206 Ga0105239_11558803 3300010375 Bacteria 764
207 Ga0105246_10353635 3300011119 Unclassified 1205
208 Ga0105246_10443926 3300011119 Bacteria 1089
209 Ga0105246_12525115 3300011119 Bacteria 506
210 Ga0157373_10062811 3300013100 Bacteria 2630
211 Ga0157371_10350324 3300013102 Bacteria 1075
212 Ga0157371_10719472 3300013102 Bacteria 748
213 Ga0157369_10700587 3300013105 Bacteria 1043
214 Ga0157374_10312713 3300013296 Bacteria 1555
215 Ga0157374_10404009 3300013296 Bacteria 1363
216 Ga0157378_10805268 3300013297 Bacteria 965
217 Ga0163162_10080083 3300013306 Bacteria 3333
218 Ga0163162_10113833 3300013306 Bacteria 2804
219 Ga0163162_10248122 3300013306 Bacteria 1912
220 Ga0163162_10715132 3300013306 Unclassified 1122
221 Ga0163162_12152011 3300013306 Bacteria 640
222 Ga0157372_10177924 3300013307 Bacteria 2462
223 Ga0157372_10318072 3300013307 Bacteria 1812
224 Ga0157372_11334860 3300013307 Bacteria 827
225 Ga0157375_10159940 3300013308 Bacteria 2394
226 Ga0157375_10228505 3300013308 Bacteria 2019
227 Ga0157375_10467095 3300013308 Unclassified 1427
228 Ga0157375_11417977 3300013308 Bacteria 818
229 Ga0157375_12260496 3300013308 Bacteria 648
230 Ga0163163_10213315 3300014325 Bacteria 1980
231 Ga0163163_10579158 3300014325 Bacteria 1185
232 Ga0157380_10023583 3300014326 Bacteria 4644
233 Ga0157380_11285452 3300014326 Unclassified 778
234 Ga0157377_10020532 3300014745 Bacteria 3462
235 Ga0157379_10105489 3300014968 Bacteria 2529
236 Ga0157379_10243600 3300014968 Bacteria 1631
237 Ga0157376_12039532 3300014969 Bacteria 612
238 Ga0163161_10004584 3300017792 Bacteria 9620
239 Ga0163161_10064705 3300017792 Bacteria 2668
240 Ga0163161_10862583 3300017792 Bacteria 765
241 Ga0206355_1342079 3300020076 Bacteria 874
242 Ga0206352_10797130 3300020078 Bacteria 2560
243 Ga0206352_10836674 3300020078 Bacteria 671
244 Ga0209758_1004985 3300025297 Bacteria 10609
245 Ga0209256_1009043 3300025299 Bacteria 4456
246 Ga0209257_1035090 3300025304 Bacteria 1556
247 Ga0207697_10004740 3300025315 Bacteria 6440
248 Ga0207656_10207917 3300025321 Bacteria 947
249 Ga0207682_10159397 3300025893 Bacteria 1022
250 Ga0207692_10032347 3300025898 Bacteria 2514
251 Ga0207642_10006921 3300025899 Bacteria 3798
252 Ga0207642_10215774 3300025899 Bacteria 1069
253 Ga0207710_10549617 3300025900 Bacteria 601
254 Ga0207688_10017079 3300025901 Bacteria 3943
255 Ga0207680_10183553 3300025903 Bacteria 1416
256 Ga0207647_10013402 3300025904 Bacteria 5683
257 Ga0207647_10078164 3300025904 Bacteria 1988
258 Ga0207699_10071778 3300025906 Bacteria 2119
259 Ga0207645_10024723 3300025907 Bacteria 3890
260 Ga0207643_10011383 3300025908 Bacteria 4803
261 Ga0207705_10390267 3300025909 Bacteria 1076
262 Ga0207654_10019692 3300025911 Bacteria 3567
263 Ga0207695_10161209 3300025913 Bacteria 2174
264 Ga0207671_10067698 3300025914 Bacteria 2660
265 Ga0207671_10072931 3300025914 Unclassified 2563
266 Ga0207693_10011948 3300025915 Bacteria 7019
267 Ga0207693_10327817 3300025915 Bacteria 1199
268 Ga0207693_10424639 3300025915 Unclassified 1039
269 Ga0207663_10214777 3300025916 Bacteria 1396
270 Ga0207660_10129066 3300025917 Bacteria 1922
271 Ga0207657_10097347 3300025919 Bacteria 2447
272 Ga0207649_10039780 3300025920 Bacteria 2853
273 Ga0207649_10298693 3300025920 Bacteria 1177
274 Ga0207652_10579939 3300025921 Bacteria 1007
275 Ga0207681_10773405 3300025923 Bacteria 801
276 Ga0207694_10594729 3300025924 Bacteria 930
277 Ga0207694_11658297 3300025924 Bacteria 538
278 Ga0207650_10098677 3300025925 Bacteria 2244
279 Ga0207659_11650844 3300025926 Unclassified 546
280 Ga0207687_10163597 3300025927 Bacteria 1710
281 Ga0207687_11052527 3300025927 Bacteria 698
282 Ga0207700_10040865 3300025928 Plasmid 3388
283 Ga0207700_10598304 3300025928 Bacteria 981
284 Ga0207664_10178967 3300025929 Unclassified 1819
285 Ga0207644_10059292 3300025931 Bacteria 2768
286 Ga0207690_10224007 3300025932 Bacteria 1440
287 Ga0207690_11273853 3300025932 Unclassified 614
288 Ga0207706_10014199 3300025933 Bacteria 7220
289 Ga0207706_10283186 3300025933 Bacteria 1445
290 Ga0207686_10116860 3300025934 Bacteria 1809
291 Ga0207709_10213374 3300025935 Bacteria 1387
292 Ga0207709_11508705 3300025935 Bacteria 558
293 Ga0207669_11614977 3300025937 Bacteria 553
294 Ga0207704_10666176 3300025938 Unclassified 858
295 Ga0207665_10018952 3300025939 Bacteria 4521
296 Ga0207691_10170442 3300025940 Bacteria 1906
297 Ga0207691_10828742 3300025940 Unclassified 776
298 Ga0207711_10062481 3300025941 Bacteria 3212
299 Ga0207689_10032093 3300025942 Bacteria 4369
300 Ga0207689_10217151 3300025942 Bacteria 1580
301 Ga0207689_10910808 3300025942 Bacteria 742
302 Ga0207661_11080424 3300025944 Bacteria 739
303 Ga0207667_10093224 3300025949 Bacteria 3110
304 Ga0207712_10082028 3300025961 Bacteria 2350
305 Ga0207668_11137924 3300025972 Bacteria 700
306 Ga0207668_11215032 3300025972 Bacteria 677
307 Ga0207640_10127629 3300025981 Bacteria 1833
308 Ga0207658_10088247 3300025986 Bacteria 2397
309 Ga0207658_10206109 3300025986 Unclassified 1645
310 Ga0207658_11548300 3300025986 Unclassified 606
311 Ga0207677_10209802 3300026023 Bacteria 1554
312 Ga0207703_10286310 3300026035 Bacteria 1498
313 Ga0207703_10963011 3300026035 Bacteria 818
314 Ga0207639_10045394 3300026041 Bacteria 3309
315 Ga0207678_10008878 3300026067 Bacteria 8851
316 Ga0207678_10573879 3300026067 Unclassified 988
317 Ga0207708_10074020 3300026075 Bacteria 2611
318 Ga0207708_10089360 3300026075 Bacteria 2374
319 Ga0207708_10609340 3300026075 Bacteria 926
320 Ga0207702_10121083 3300026078 Unclassified 2342
321 Ga0207702_10363630 3300026078 Bacteria 1387
322 Ga0207702_10590593 3300026078 Bacteria 1089
323 Ga0207702_10908673 3300026078 Bacteria 872
324 Ga0207702_11134063 3300026078 Bacteria 776
325 Ga0207641_10381114 3300026088 Bacteria 1350
326 Ga0207648_10036427 3300026089 Bacteria 4334
327 Ga0207648_10896504 3300026089 Unclassified 828
328 Ga0207676_10303971 3300026095 Bacteria 1457
329 Ga0207676_12160798 3300026095 Bacteria 555
330 Ga0207674_10013641 3300026116 Bacteria 9000
331 Ga0207675_100039732 3300026118 Bacteria 4391
332 Ga0207675_100490209 3300026118 Bacteria 1222
333 Ga0207683_10037484 3300026121 Bacteria 4221
334 Ga0207683_10307106 3300026121 Bacteria 1452
335 Ga0207683_10404501 3300026121 Unclassified 1256
336 Ga0207698_10142659 3300026142 Bacteria 2066
337 Ga0209969_1024435 3300027360 Bacteria 908
338 Ga0209179_1160620 3300027512 Unclassified 502
339 Ga0209813_10134320 3300027866 Bacteria 873
340 Ga0209974_10089671 3300027876 Bacteria 1065
341 Ga0207428_10130638 3300027907 Unclassified 1922
342 Ga0268266_10029574 3300028379 Bacteria 4657
343 Ga0268266_11173757 3300028379 Bacteria 742
344 Ga0268265_11810695 3300028380 Unclassified 617
345 Ga0268264_10968427 3300028381 Bacteria 856
346 Ga0268264_11323591 3300028381 Bacteria 731
347 Ga0265325_10001457 3300031241 Bacteria 16630
348 Ga0265339_10006257 3300031249 Bacteria 7837
349 Ga0307513_10959720 3300031456 Bacteria 564
350 Ga0307509_10380813 3300031507 Bacteria 1124
351 Ga0265313_10002515 3300031595 Bacteria 15763
352 Ga0307412_11324748 3300031911 Bacteria 649
353 Ga0307510_10013236 3300033180 Bacteria 9783
354 Ga0373930_0139860 3300034816 Bacteria 601
355 Ga0373955_0423468 3300035172 Bacteria 810
356 Ga0451789_0337074 3300041443 Bacteria 511
357 Ga0451793_0215616 3300041452 Bacteria 1101
358 Ga0451800_0904413 3300041459 Bacteria 687
359 Ga0451800_0957451 3300041459 Bacteria 938
360 Ga0451849_0516681 3300041505 Bacteria 909
361 Ga0451843_0953611 3300041509 Unclassified 536
362 Ga0439441_013640 3300042001 Bacteria 1413
363 Ga0439435_0190565 3300042436 Bacteria 672
364 Ga0439444_0003966 3300042437 Bacteria 2120
365 Ga0450916_030767 3300042530 Bacteria 781
366 Ga0466967_1701743 3300045976 Unclassified 628
367 Ga0495585_0431520 3300046492 Bacteria 632
368 Ga0495628_0161276 3300046516 Bacteria 1704
369 Ga0495637_0236634 3300046520 Bacteria 661
370 Ga0495648_0180435 3300046524 Bacteria 1074
371 Ga0495645_0895667 3300046543 Bacteria 527
372 Ga0495656_0789708 3300046615 Bacteria 513
373 Ga0495668_0307839 3300046616 Bacteria 869
374 Ga0495668_0564851 3300046616 Bacteria 628
375 Ga0495625_0321124 3300046660 Bacteria 986
376 Ga0495669_0109957 3300046684 Unclassified 1286
377 Ga0495649_0081591 3300046694 Unclassified 1729
378 Ga0495674_0485204 3300047319 Bacteria 990
379 Ga0495676_0776883 3300047321 Bacteria 617
380 Ga0495602_0745961 3300048088 Unclassified 661
381 Ga0496100_0697731 3300048903 Bacteria 792
382 Ga0496100_0843902 3300048903 Bacteria 718
383 Ga0496101_0084994 3300048904 Bacteria 2344
384 Ga0496101_0310257 3300048904 Bacteria 1237
385 Ga0496101_0699801 3300048904 Bacteria 800
386 Ga0496102_0057963 3300048905 Bacteria 3538
387 Ga0496102_0181942 3300048905 Bacteria 1981
388 Ga0496102_0238227 3300048905 Bacteria 1716
389 Ga0496102_0296855 3300048905 Bacteria 1523
390 Ga0496102_0532714 3300048905 Bacteria 1097
391 Ga0496103_0069774 3300048906 Bacteria 2198
392 Ga0496104_0205653 3300048907 Bacteria 1880
393 Ga0496104_0294510 3300048907 Bacteria 1535
394 Ga0496104_0485160 3300048907 Bacteria 1147
395 Ga0496104_0741771 3300048907 Bacteria 889
396 Ga0496105_0101393 3300048908 Bacteria 2377
397 Ga0496105_0371186 3300048908 Bacteria 1140
398 Ga0496106_0051448 3300048909 Bacteria 3106
399 Ga0496106_0158296 3300048909 Bacteria 1790
400 Ga0496106_1263684 3300048909 Bacteria 574
401 Ga0496106_1328546 3300048909 Bacteria 557
402 Ga0496107_0452559 3300048910 Unclassified 954
403 Ga0496107_0455350 3300048910 Bacteria 950
404 Ga0496108_0068039 3300048911 Bacteria 3004
405 Ga0496108_0119866 3300048911 Bacteria 2256
406 Ga0496108_0150541 3300048911 Bacteria 2008
407 Ga0496108_1487710 3300048911 Bacteria 564
408 Ga0496108_1705872 3300048911 Bacteria 518
409 Ga0496109_0023690 3300048912 Bacteria 5450
410 Ga0496109_0233190 3300048912 Bacteria 1732
411 Ga0496109_0293427 3300048912 Bacteria 1533
412 Ga0496109_0634841 3300048912 Bacteria 1005
413 Ga0496109_0985614 3300048912 Bacteria 780
414 Ga0496110_0307973 3300048913 Bacteria 1443
415 Ga0496110_0309927 3300048913 Bacteria 1438
416 Ga0496110_0322993 3300048913 Bacteria 1406
417 Ga0496110_0446887 3300048913 Bacteria 1178
418 Ga0496110_0685802 3300048913 Bacteria 925
419 Ga0496110_1749948 3300048913 Bacteria 532
420 Ga0496111_0058604 3300048914 Bacteria 2788
421 Ga0496111_0389199 3300048914 Bacteria 1031
422 Ga0496111_1273350 3300048914 Unclassified 519
423 Ga0496112_0055386 3300048915 Bacteria 3899
424 Ga0496112_0060956 3300048915 Bacteria 3718
425 Ga0496112_0267243 3300048915 Bacteria 1659
426 Ga0496113_0128559 3300048916 Bacteria 1986
427 Ga0496113_0244992 3300048916 Bacteria 1430
428 Ga0496113_0473718 3300048916 Bacteria 1006
429 Ga0496114_0496958 3300048917 Bacteria 1079
430 Ga0496115_0153177 3300048918 Bacteria 1904
431 Ga0496117_0107550 3300048920 Bacteria 1747
432 Ga0496118_0352631 3300048921 Bacteria 783
433 Ga0496121_0438122 3300048924 Bacteria 846
434 Ga0496124_0044614 3300048927 Bacteria 3803
435 Ga0496124_0738823 3300048927 Bacteria 618
436 Ga0496125_0140518 3300048928 Bacteria 1680
437 Ga0496126_0610959 3300048929 Bacteria 858
438 nmdc:mga03683_15177_c1 3300050489 Bacteria 2870
439 nmdc:mga03683_89676_c1 3300050489 Bacteria 1339
440 nmdc:mga03n38_214571_c1 3300050490 Bacteria 1002
441 nmdc:mga00v17_3518_c1 3300050491 Bacteria 8094
442 nmdc:mga00v17_595956_c1 3300050491 Bacteria 713
443 nmdc:mga0yw44_129242_c1 3300050492 Bacteria 1634
444 nmdc:mga0yw44_32637_c1 3300050492 Bacteria 3036
445 nmdc:mga0k408_173708_c1 3300050493 Bacteria 1285
446 nmdc:mga0k408_934558_c1 3300050493 Bacteria 503
447 nmdc:mga06z11_98560_c1 3300050494 Bacteria 1600
448 nmdc:mga04h51_583_c1 3300050495 Bacteria 8699
449 nmdc:mga07m45_11224_c1 3300050496 Bacteria 4703
450 nmdc:mga05p37_170600_c1 3300050507 Bacteria 2653
451 nmdc:mga09592_90090_c1 3300050508 Unclassified 2620
452 nmdc:mga0qj67_1472203_c1 3300050509 Bacteria 524
453 nmdc:mga0qj67_599202_c1 3300050509 Unclassified 881
454 nmdc:mga08y16_117683_c1 3300050511 Unclassified 2766
455 nmdc:mga0n895_1685282_c1 3300050512 Unclassified 597
456 nmdc:mga0n895_70774_c1 3300050512 Bacteria 3457
457 nmdc:mga0rr50_116603_c1 3300050513 Unclassified 2120
458 nmdc:mga0rr50_14742_c1 3300050513 Bacteria 5138
459 nmdc:mga08x19_783038_c1 3300050514 Bacteria 677
460 nmdc:mga0a205_1097038_c1 3300050515 Bacteria 643
461 nmdc:mga0a205_1158073_c1 3300050515 Unclassified 621
462 nmdc:mga0sz30_246713_c1 3300050516 Bacteria 795
463 nmdc:mga0sz30_57384_c1 3300050516 Bacteria 1659
464 Ga0495601_0001204 3300053077 Bacteria 14176
465 Ga0495612_0041679 3300053078 Unclassified 1873
466 Ga0500635_0114801 3300053080 Bacteria 1003
467 Ga0495655_0053984 3300053083 Bacteria 1074
468 Ga0500651_0448310 3300053093 Bacteria 718
469 Ga0500554_008419 3300053102 Bacteria 2422
470 Ga0500603_001556 3300053150 Bacteria 5213
471 Ga0500616_0029925 3300053153 Bacteria 2993
472 Ga0500637_0118857 3300053178 Bacteria 1533
473 Ga0587091_208725 3300059511 Bacteria 528

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046520 Ga0495637_0236634 Ga0495637_0236634_238_552 65
2 3300005614 Ga0068856_100543499 Ga0068856_1005434992 70
3 3300026078 Ga0207702_10590593 Ga0207702_105905932 70
4 3300046492 Ga0495585_0431520 Ga0495585_0431520_32_253 71
5 3300005434 Ga0070709_10008184 Ga0070709_100081843 72
6 3300005436 Ga0070713_100017924 Ga0070713_1000179243 72
7 3300005437 Ga0070710_10088345 Ga0070710_100883453 72
8 3300005439 Ga0070711_100276204 Ga0070711_1002762042 72
9 3300006028 Ga0070717_11143702 Ga0070717_111437022 72
10 3300006175 Ga0070712_100015112 Ga0070712_1000151127 72
11 3300025898 Ga0207692_10032347 Ga0207692_100323473 72
12 3300025906 Ga0207699_10071778 Ga0207699_100717783 72
13 3300025915 Ga0207693_10011948 Ga0207693_100119483 72
14 3300025916 Ga0207663_10214777 Ga0207663_102147772 72
15 3300025928 Ga0207700_10598304 Ga0207700_105983042 72
16 3300005844 Ga0068862_100568409 Ga0068862_1005684092 74
17 3300005340 Ga0070689_101601640 Ga0070689_1016016402 76
18 3300005347 Ga0070668_100270760 Ga0070668_1002707602 76
19 3300005367 Ga0070667_100577716 Ga0070667_1005777162 76
20 3300005438 Ga0070701_10193829 Ga0070701_101938292 76
21 3300005440 Ga0070705_100403068 Ga0070705_1004030682 76
22 3300005441 Ga0070700_100195988 Ga0070700_1001959881 76
23 3300005444 Ga0070694_100904733 Ga0070694_1009047331 76
24 3300005456 Ga0070678_100057262 Ga0070678_1000572624 76
25 3300005718 Ga0068866_10220507 Ga0068866_102205071 76
26 3300005842 Ga0068858_100218208 Ga0068858_1002182084 76
27 3300005843 Ga0068860_100463075 Ga0068860_1004630752 76
28 3300006881 Ga0068865_100030227 Ga0068865_1000302276 76
29 3300009148 Ga0105243_10163502 Ga0105243_101635023 76
30 3300009553 Ga0105249_10019839 Ga0105249_100198398 76
31 3300013306 Ga0163162_10715132 Ga0163162_107151322 76
32 3300013308 Ga0157375_10467095 Ga0157375_104670952 76
33 3300014968 Ga0157379_10105489 Ga0157379_101054893 76
34 3300017792 Ga0163161_10004584 Ga0163161_100045842 76
35 3300025935 Ga0207709_11508705 Ga0207709_115087051 76
36 3300025972 Ga0207668_11137924 Ga0207668_111379241 76
37 3300025986 Ga0207658_10206109 Ga0207658_102061092 76
38 3300026035 Ga0207703_10963011 Ga0207703_109630111 76
39 3300026121 Ga0207683_10307106 Ga0207683_103071062 76
40 3300048904 Ga0496101_0310257 Ga0496101_0310257_51_317 76
41 3300048905 Ga0496102_0532714 Ga0496102_0532714_658_924 76
42 3300048912 Ga0496109_0023690 Ga0496109_0023690_4970_5236 76
43 3300005530 Ga0070679_101572205 Ga0070679_1015722052 77
44 3300005367 Ga0070667_101477595 Ga0070667_1014775951 79
45 3300005843 Ga0068860_101931314 Ga0068860_1019313142 79
46 3300009101 Ga0105247_10082235 Ga0105247_100822352 79
47 3300009545 Ga0105237_10447918 Ga0105237_104479182 79
48 3300010375 Ga0105239_11558803 Ga0105239_115588032 79
49 3300013308 Ga0157375_10159940 Ga0157375_101599402 79
50 3300025939 Ga0207665_10018952 Ga0207665_100189524 79
51 3300025944 Ga0207661_11080424 Ga0207661_110804241 79
52 3300027360 Ga0209969_1024435 Ga0209969_10244352 79
53 3300027876 Ga0209974_10089671 Ga0209974_100896712 79
54 3300042001 Ga0439441_013640 Ga0439441_013640_346_600 79
55 3300042530 Ga0450916_030767 Ga0450916_030767_92_346 79
56 3300046524 Ga0495648_0180435 Ga0495648_0180435_785_1048 79
57 3300046660 Ga0495625_0321124 Ga0495625_0321124_472_735 79
58 3300047321 Ga0495676_0776883 Ga0495676_0776883_293_556 79
59 3300048905 Ga0496102_0238227 Ga0496102_0238227_1065_1328 79
60 3300048907 Ga0496104_0741771 Ga0496104_0741771_111_374 79
61 3300048908 Ga0496105_0101393 Ga0496105_0101393_148_411 79
62 3300048909 Ga0496106_0158296 Ga0496106_0158296_189_452 79
63 3300048913 Ga0496110_0309927 Ga0496110_0309927_705_968 79
64 3300048927 Ga0496124_0738823 Ga0496124_0738823_115_378 79
65 3300048929 Ga0496126_0610959 Ga0496126_0610959_254_517 79
66 3300059511 Ga0587091_208725 Ga0587091_208725_114_377 79
67 3300005335 Ga0070666_11121601 Ga0070666_111216012 80
68 3300005339 Ga0070660_100084652 Ga0070660_1000846522 80
69 3300005344 Ga0070661_100432620 Ga0070661_1004326202 80
70 3300005564 Ga0070664_100279286 Ga0070664_1002792861 80
71 3300005614 Ga0068856_100080655 Ga0068856_1000806555 80
72 3300006038 Ga0075365_10089495 Ga0075365_100894952 80
73 3300009551 Ga0105238_11831052 Ga0105238_118310521 80
74 3300013102 Ga0157371_10719472 Ga0157371_107194722 80
75 3300013105 Ga0157369_10700587 Ga0157369_107005872 80
76 3300017792 Ga0163161_10862583 Ga0163161_108625831 80
77 3300025904 Ga0207647_10078164 Ga0207647_100781644 80
78 3300025920 Ga0207649_10298693 Ga0207649_102986933 80
79 3300025924 Ga0207694_11658297 Ga0207694_116582971 80
80 3300026078 Ga0207702_11134063 Ga0207702_111340631 80
81 3300041443 Ga0451789_0337074 Ga0451789_0337074_186_449 80
82 3300041452 Ga0451793_0215616 Ga0451793_0215616_615_878 80
83 3300041459 Ga0451800_0957451 Ga0451800_0957451_309_572 80
84 3300041505 Ga0451849_0516681 Ga0451849_0516681_500_763 80
85 3300046616 Ga0495668_0564851 Ga0495668_0564851_303_566 80
86 3300048910 Ga0496107_0452559 Ga0496107_0452559_542_802 80
87 3300048911 Ga0496108_1705872 Ga0496108_1705872_224_487 80
88 3300048913 Ga0496110_0307973 Ga0496110_0307973_229_492 80
89 3300048913 Ga0496110_1749948 Ga0496110_1749948_72_335 80
90 3300050516 nmdc:mga0sz30_57384_c1 nmdc:mga0sz30_57384_c1_541_804 80
91 3300053153 Ga0500616_0029925 Ga0500616_0029925_927_1190 80
92 iso_pu_bacteria 2791355199 2793080958 80
93 iso_pu_bacteria 2841760612 2841766768 80
94 iso_pu_bacteria 2844104063 2844105176 80
95 iso_pu_bacteria 2851182111 2851185652 80
96 iso_pu_bacteria 2851246043 2851252185 80
97 iso_pu_bacteria 2932401849 2932403000 80
98 iso_pu_bacteria 8056681323 8056683779 80
99 3300005434 Ga0070709_10475559 Ga0070709_104755593 81
100 3300005435 Ga0070714_100045484 Ga0070714_1000454841 81
101 3300005564 Ga0070664_101269265 Ga0070664_1012692652 81
102 3300005614 Ga0068856_100007190 Ga0068856_10000719010 81
103 3300006028 Ga0070717_10045438 Ga0070717_100454382 81
104 3300006038 Ga0075365_10255712 Ga0075365_102557122 81
105 3300006048 Ga0075363_100039105 Ga0075363_1000391053 81
106 3300006051 Ga0075364_10325517 Ga0075364_103255171 81
107 3300006175 Ga0070712_100435653 Ga0070712_1004356533 81
108 3300006186 Ga0075369_10008711 Ga0075369_100087115 81
109 3300006844 Ga0075428_100090838 Ga0075428_1000908384 81
110 3300007076 Ga0075435_100174199 Ga0075435_1001741992 81
111 3300009147 Ga0114129_12443388 Ga0114129_124433881 81
112 3300020078 Ga0206352_10836674 Ga0206352_108366741 81
113 3300025915 Ga0207693_10327817 Ga0207693_103278172 81
114 3300025928 Ga0207700_10040865 Ga0207700_100408654 81
115 3300025929 Ga0207664_10178967 Ga0207664_101789673 81
116 3300026078 Ga0207702_10121083 Ga0207702_101210833 81
117 3300026095 Ga0207676_12160798 Ga0207676_121607981 81
118 3300048909 Ga0496106_1328546 Ga0496106_1328546_238_501 81
119 3300048911 Ga0496108_1487710 Ga0496108_1487710_100_363 81
120 3300048912 Ga0496109_0634841 Ga0496109_0634841_235_498 81
121 3300048914 Ga0496111_0389199 Ga0496111_0389199_668_931 81
122 3300048915 Ga0496112_0060956 Ga0496112_0060956_558_821 81
123 3300048916 Ga0496113_0244992 Ga0496113_0244992_1126_1389 81
124 3300050490 nmdc:mga03n38_214571_c1 nmdc:mga03n38_214571_c1_631_894 81
125 3300050491 nmdc:mga00v17_595956_c1 nmdc:mga00v17_595956_c1_304_567 81
126 3300050492 nmdc:mga0yw44_32637_c1 nmdc:mga0yw44_32637_c1_2520_2783 81
127 3300050507 nmdc:mga05p37_170600_c1 nmdc:mga05p37_170600_c1_1443_1706 81
128 3300050513 nmdc:mga0rr50_116603_c1 nmdc:mga0rr50_116603_c1_461_724 81
129 3300050516 nmdc:mga0sz30_246713_c1 nmdc:mga0sz30_246713_c1_160_423 81
130 iso_pu_bacteria 2513237096 2513660590 81
131 iso_pu_bacteria 2513237145 2513922361 81
132 iso_pu_bacteria 2545555834 2545674340 81
133 iso_pu_bacteria 2643221733 2644728546 81
134 iso_pu_bacteria 2738541281 2738747331 81
135 iso_pu_bacteria 2738543032 2739356560 81
136 iso_pu_bacteria 2818991467 2819719832 81
137 iso_pu_bacteria 2829745981 2829748158 81
138 iso_pu_bacteria 2861691609 2861694289 81
139 iso_pu_bacteria 2917699015 2917704262 81
140 iso_pu_bacteria 641522639 641645056 81
141 3300005439 Ga0070711_100393489 Ga0070711_1003934891 82
142 3300011119 Ga0105246_12525115 Ga0105246_125251151 82
143 3300025915 Ga0207693_10424639 Ga0207693_104246393 82
144 iso_pu_bacteria 2508501009 2508539794 82
145 iso_pu_bacteria 2508501009 2508543859 82
146 iso_pu_bacteria 2515154112 2515627357 82
147 iso_pu_bacteria 2528768022 2528857836 82
148 iso_pu_bacteria 2857509624 2857510638 82
149 iso_pu_bacteria 2874590934 2874591329 82
150 iso_pu_bacteria 2874590934 2874598494 82
151 iso_pu_bacteria 2874645413 2874646039 82
152 iso_pu_bacteria 2874645413 2874652451 82
153 iso_pu_bacteria 2876771140 2876771435 82
154 iso_pu_bacteria 2876771140 2876778027 82
155 iso_pu_bacteria 2876818435 2876818744 82
156 iso_pu_bacteria 2876818435 2876826103 82
157 iso_pu_bacteria 2879074833 2879075221 82
158 iso_pu_bacteria 2879074833 2879081821 82
159 iso_pu_bacteria 2879099564 2879103676 82
160 iso_pu_bacteria 2879099564 2879103840 82
161 iso_pu_bacteria 2879127579 2879133348 82
162 iso_pu_bacteria 2879127579 2879134942 82
163 iso_pu_bacteria 2879142872 2879149627 82
164 iso_pu_bacteria 2879142872 2879150903 82
165 iso_pu_bacteria 2885366525 2885371789 82
166 iso_pu_bacteria 2932784394 2932793653 82
167 iso_pu_bacteria 2932809354 2932815735 82
168 iso_pu_bacteria 2932818245 2932827763 82
169 iso_pu_bacteria 2932828146 2932837235 82
170 iso_pu_bacteria 2935608549 2935610130 82
171 iso_pu_bacteria 2935608549 2935611300 82
172 iso_pu_bacteria 2935616580 2935619976 82
173 iso_pu_bacteria 2935616580 2935625360 82
174 iso_pu_bacteria 2935616580 2935625384 82
175 iso_pu_bacteria 2935638405 2935642198 82
176 iso_pu_bacteria 2935665750 2935668498 82
177 iso_pu_bacteria 2935684952 2935688983 82
178 iso_pu_bacteria 2935703347 2935706358 82
179 iso_pu_bacteria 2935713505 2935716002 82
180 iso_pu_bacteria 2935722832 2935725433 82
181 iso_pu_bacteria 2935732158 2935738290 82
182 iso_pu_bacteria 2935741537 2935747665 82
183 iso_pu_bacteria 2935750917 2935753761 82
184 iso_pu_bacteria 2935769743 2935776905 82
185 iso_pu_bacteria 2935785616 2935792837 82
186 iso_pu_bacteria 2935793552 2935801318 82
187 iso_pu_bacteria 2935801545 2935810309 82
188 iso_pu_bacteria 2935810662 2935814673 82
189 iso_pu_bacteria 2935819856 2935820777 82
190 iso_pu_bacteria 2935819856 2935823290 82
191 iso_pu_bacteria 2935827899 2935831811 82
192 iso_pu_bacteria 2935847175 2935850963 82
193 iso_pu_bacteria 2935855204 2935857709 82
194 iso_pu_bacteria 2935855204 2935863987 82
195 iso_pu_bacteria 2935855204 2935864011 82
196 iso_pu_bacteria 2935864058 2935868950 82
197 iso_pu_bacteria 2935864058 2935873587 82
198 iso_pu_bacteria 2935864058 2935873642 82
199 iso_pu_bacteria 2935873716 2935874365 82
200 iso_pu_bacteria 2935873716 2935883075 82
201 iso_pu_bacteria 2935873716 2935883117 82
202 iso_pu_bacteria 2935908558 2935913668 82
203 iso_pu_bacteria 2935916978 2935920342 82
204 iso_pu_bacteria 2935926038 2935930681 82
205 iso_pu_bacteria 2935934488 2935939346 82
206 iso_pu_bacteria 2935942939 2935946295 82
207 iso_pu_bacteria 2935951376 2935955866 82
208 iso_pu_bacteria 2935967501 2935972424 82
209 iso_pu_bacteria 2935975950 2935983520 82
210 iso_pu_bacteria 2935984226 2935991304 82
211 iso_pu_bacteria 2935992306 2935998912 82
212 iso_pu_bacteria 2936002035 2936007764 82
213 iso_pu_bacteria 2936037263 2936040230 82
214 iso_pu_bacteria 2940556831 2940560862 82
215 iso_pu_bacteria 8016603502 8016609941 82
216 iso_pu_bacteria 8016613128 8016614999 82
217 iso_pu_bacteria 8016613128 8016615975 82
218 iso_pu_bacteria 8016613128 8016615998 82
219 iso_pu_bacteria 8016622563 8016625239 82
220 iso_pu_bacteria 8016622563 8016626863 82
221 iso_pu_bacteria 8016630954 8016633077 82
222 iso_pu_bacteria 8017057580 8017062080 82
223 iso_pu_bacteria 8019538911 8019545430 82
224 iso_pu_bacteria 8019538911 8019546404 82
225 iso_pu_bacteria 8019538911 8019546425 82
226 iso_pu_bacteria 8019547302 8019552288 82
227 iso_pu_bacteria 8019576017 8019582438 82
228 iso_pu_bacteria 8019586578 8019590222 82
229 iso_pu_bacteria 8019619141 8019619143 82
230 iso_pu_bacteria 8019629233 8019633968 82
231 iso_pu_bacteria 8019638758 8019639878 82
232 iso_pu_bacteria 8019638758 8019645885 82
233 iso_pu_bacteria 8019659431 8019661848 82
234 iso_pu_bacteria 8019668869 8019671374 82
235 iso_pu_bacteria 8019678201 8019680031 82
236 iso_pu_bacteria 8019678201 8019684814 82
237 3300014325 Ga0163163_10579158 Ga0163163_105791582 83
238 3300025299 Ga0209256_1009043 Ga0209256_10090436 83
239 3300053093 Ga0500651_0448310 Ga0500651_0448310_360_614 83
240 3300005455 Ga0070663_101868704 Ga0070663_1018687041 84
241 3300005834 Ga0068851_11014031 Ga0068851_110140311 84
242 3300005937 Ga0081455_10215964 Ga0081455_102159643 84
243 3300013308 Ga0157375_12260496 Ga0157375_122604962 84
244 3300026067 Ga0207678_10573879 Ga0207678_105738792 84
245 3300026078 Ga0207702_10908673 Ga0207702_109086732 84
246 3300031241 Ga0265325_10001457 Ga0265325_100014577 84
247 3300031249 Ga0265339_10006257 Ga0265339_100062573 84
248 3300031595 Ga0265313_10002515 Ga0265313_1000251514 84
249 3300042436 Ga0439435_0190565 Ga0439435_0190565_110_364 84
250 3300042437 Ga0439444_0003966 Ga0439444_0003966_703_957 84
251 3300046615 Ga0495656_0789708 Ga0495656_0789708_139_393 84
252 3300053083 Ga0495655_0053984 Ga0495655_0053984_193_450 84
253 3300001989 JGI24739J22299_10140049 JGI24739J22299_101400492 85
254 3300002075 JGI24738J21930_10038943 JGI24738J21930_100389432 85
255 3300002077 JGI24744J21845_10052700 JGI24744J21845_100527001 85
256 3300002244 JGI24742J22300_10106271 JGI24742J22300_101062711 85
257 3300003203 JGI25406J46586_10002044 JGI25406J46586_100020444 85
258 3300003215 JGI25153J46596_10009379 JGI25153J46596_100093794 85
259 3300003322 rootL2_10101098 rootL2_101010982 85
260 3300004801 Ga0058860_11911029 Ga0058860_119110292 85
261 3300004803 Ga0058862_11914580 Ga0058862_119145802 85
262 3300005328 Ga0070676_10031818 Ga0070676_100318189 85
263 3300005329 Ga0070683_100416047 Ga0070683_1004160472 85
264 3300005330 Ga0070690_100062337 Ga0070690_1000623373 85
265 3300005331 Ga0070670_100169366 Ga0070670_1001693662 85
266 3300005334 Ga0068869_100818349 Ga0068869_1008183492 85
267 3300005335 Ga0070666_10647980 Ga0070666_106479801 85
268 3300005337 Ga0070682_100294856 Ga0070682_1002948562 85
269 3300005338 Ga0068868_100121682 Ga0068868_1001216823 85
270 3300005339 Ga0070660_100221059 Ga0070660_1002210592 85
271 3300005340 Ga0070689_100047320 Ga0070689_1000473208 85
272 3300005343 Ga0070687_100136604 Ga0070687_1001366042 85
273 3300005344 Ga0070661_100029313 Ga0070661_1000293134 85
274 3300005347 Ga0070668_100121997 Ga0070668_1001219976 85
275 3300005354 Ga0070675_100307609 Ga0070675_1003076093 85
276 3300005355 Ga0070671_100286140 Ga0070671_1002861404 85
277 3300005356 Ga0070674_100125642 Ga0070674_1001256421 85
278 3300005364 Ga0070673_100310403 Ga0070673_1003104032 85
279 3300005365 Ga0070688_100105105 Ga0070688_1001051054 85
280 3300005366 Ga0070659_100062026 Ga0070659_1000620265 85
281 3300005367 Ga0070667_100031236 Ga0070667_1000312367 85
282 3300005434 Ga0070709_11223710 Ga0070709_112237102 85
283 3300005440 Ga0070705_100259459 Ga0070705_1002594593 85
284 3300005441 Ga0070700_100147189 Ga0070700_1001471893 85
285 3300005444 Ga0070694_100096099 Ga0070694_1000960992 85
286 3300005455 Ga0070663_100117513 Ga0070663_1001175134 85
287 3300005456 Ga0070678_100589245 Ga0070678_1005892451 85
288 3300005457 Ga0070662_100136137 Ga0070662_1001361374 85
289 3300005458 Ga0070681_11441252 Ga0070681_114412522 85
290 3300005459 Ga0068867_100493284 Ga0068867_1004932841 85
291 3300005466 Ga0070685_10070207 Ga0070685_100702073 85
292 3300005530 Ga0070679_100806445 Ga0070679_1008064452 85
293 3300005536 Ga0070697_102138753 Ga0070697_1021387532 85
294 3300005539 Ga0068853_100298512 Ga0068853_1002985123 85
295 3300005543 Ga0070672_100125555 Ga0070672_1001255554 85
296 3300005544 Ga0070686_100070177 Ga0070686_1000701773 85
297 3300005545 Ga0070695_100090689 Ga0070695_1000906896 85
298 3300005546 Ga0070696_100461774 Ga0070696_1004617743 85
299 3300005547 Ga0070693_100007252 Ga0070693_10000725212 85
300 3300005548 Ga0070665_100005008 Ga0070665_1000050081 85
301 3300005548 Ga0070665_100561010 Ga0070665_1005610102 85
302 3300005548 Ga0070665_101709733 Ga0070665_1017097331 85
303 3300005549 Ga0070704_101220339 Ga0070704_1012203392 85
304 3300005563 Ga0068855_100629426 Ga0068855_1006294262 85
305 3300005564 Ga0070664_100045548 Ga0070664_1000455485 85
306 3300005577 Ga0068857_100070645 Ga0068857_1000706453 85
307 3300005578 Ga0068854_100048960 Ga0068854_1000489602 85
308 3300005614 Ga0068856_100134163 Ga0068856_1001341632 85
309 3300005614 Ga0068856_101304819 Ga0068856_1013048191 85
310 3300005615 Ga0070702_100028364 Ga0070702_1000283643 85
311 3300005615 Ga0070702_100163709 Ga0070702_1001637092 85
312 3300005617 Ga0068859_100979037 Ga0068859_1009790372 85
313 3300005618 Ga0068864_101156343 Ga0068864_1011563432 85
314 3300005718 Ga0068866_10011372 Ga0068866_100113728 85
315 3300005718 Ga0068866_10258630 Ga0068866_102586302 85
316 3300005719 Ga0068861_100075228 Ga0068861_1000752284 85
317 3300005719 Ga0068861_100539740 Ga0068861_1005397403 85
318 3300005834 Ga0068851_10035769 Ga0068851_100357693 85
319 3300005840 Ga0068870_10045909 Ga0068870_100459094 85
320 3300005841 Ga0068863_100228197 Ga0068863_1002281971 85
321 3300005842 Ga0068858_100516861 Ga0068858_1005168612 85
322 3300005843 Ga0068860_100080059 Ga0068860_1000800594 85
323 3300005844 Ga0068862_101266941 Ga0068862_1012669411 85
324 3300005983 Ga0081540_1036814 Ga0081540_10368143 85
325 3300005985 Ga0081539_10000640 Ga0081539_1000064028 85
326 3300006038 Ga0075365_10004445 Ga0075365_1000444511 85
327 3300006038 Ga0075365_10272629 Ga0075365_102726292 85
328 3300006042 Ga0075368_10125809 Ga0075368_101258093 85
329 3300006051 Ga0075364_10101332 Ga0075364_101013324 85
330 3300006177 Ga0075362_10018950 Ga0075362_100189501 85
331 3300006177 Ga0075362_10102284 Ga0075362_101022842 85
332 3300006186 Ga0075369_10022694 Ga0075369_100226943 85
333 3300006237 Ga0097621_100083466 Ga0097621_1000834662 85
334 3300006237 Ga0097621_102074240 Ga0097621_1020742401 85
335 3300006358 Ga0068871_100038913 Ga0068871_1000389137 85
336 3300006852 Ga0075433_10479522 Ga0075433_104795222 85
337 3300006871 Ga0075434_100023391 Ga0075434_10002339110 85
338 3300006931 Ga0097620_100979004 Ga0097620_1009790042 85
339 3300009011 Ga0105251_10090843 Ga0105251_100908432 85
340 3300009093 Ga0105240_10062467 Ga0105240_100624672 85
341 3300009098 Ga0105245_10124028 Ga0105245_101240283 85
342 3300009098 Ga0105245_10768690 Ga0105245_107686902 85
343 3300009101 Ga0105247_10029022 Ga0105247_100290222 85
344 3300009101 Ga0105247_10312712 Ga0105247_103127122 85
345 3300009148 Ga0105243_10065692 Ga0105243_100656922 85
346 3300009176 Ga0105242_10068485 Ga0105242_100684854 85
347 3300009177 Ga0105248_10357017 Ga0105248_103570172 85
348 3300009545 Ga0105237_10518598 Ga0105237_105185982 85
349 3300009551 Ga0105238_10052061 Ga0105238_100520618 85
350 3300009553 Ga0105249_10217794 Ga0105249_102177942 85
351 3300010375 Ga0105239_10855934 Ga0105239_108559342 85
352 3300010375 Ga0105239_10984208 Ga0105239_109842082 85
353 3300011119 Ga0105246_10443926 Ga0105246_104439261 85
354 3300013100 Ga0157373_10062811 Ga0157373_100628113 85
355 3300013102 Ga0157371_10350324 Ga0157371_103503241 85
356 3300013296 Ga0157374_10312713 Ga0157374_103127132 85
357 3300013306 Ga0163162_10080083 Ga0163162_100800837 85
358 3300013307 Ga0157372_10177924 Ga0157372_101779243 85
359 3300013308 Ga0157375_10228505 Ga0157375_102285052 85
360 3300013308 Ga0157375_11417977 Ga0157375_114179771 85
361 3300014325 Ga0163163_10213315 Ga0163163_102133151 85
362 3300014326 Ga0157380_10023583 Ga0157380_100235834 85
363 3300014745 Ga0157377_10020532 Ga0157377_100205325 85
364 3300014968 Ga0157379_10243600 Ga0157379_102436002 85
365 3300014969 Ga0157376_12039532 Ga0157376_120395321 85
366 3300017792 Ga0163161_10064705 Ga0163161_100647053 85
367 3300020078 Ga0206352_10797130 Ga0206352_107971305 85
368 3300025297 Ga0209758_1004985 Ga0209758_10049856 85
369 3300025304 Ga0209257_1035090 Ga0209257_10350902 85
370 3300025315 Ga0207697_10004740 Ga0207697_100047405 85
371 3300025321 Ga0207656_10207917 Ga0207656_102079172 85
372 3300025893 Ga0207682_10159397 Ga0207682_101593972 85
373 3300025899 Ga0207642_10006921 Ga0207642_100069214 85
374 3300025899 Ga0207642_10215774 Ga0207642_102157741 85
375 3300025900 Ga0207710_10549617 Ga0207710_105496171 85
376 3300025901 Ga0207688_10017079 Ga0207688_100170793 85
377 3300025903 Ga0207680_10183553 Ga0207680_101835532 85
378 3300025904 Ga0207647_10013402 Ga0207647_100134024 85
379 3300025907 Ga0207645_10024723 Ga0207645_100247234 85
380 3300025908 Ga0207643_10011383 Ga0207643_100113838 85
381 3300025909 Ga0207705_10390267 Ga0207705_103902672 85
382 3300025911 Ga0207654_10019692 Ga0207654_100196924 85
383 3300025913 Ga0207695_10161209 Ga0207695_101612093 85
384 3300025914 Ga0207671_10067698 Ga0207671_100676984 85
385 3300025917 Ga0207660_10129066 Ga0207660_101290662 85
386 3300025919 Ga0207657_10097347 Ga0207657_100973472 85
387 3300025920 Ga0207649_10039780 Ga0207649_100397803 85
388 3300025921 Ga0207652_10579939 Ga0207652_105799391 85
389 3300025923 Ga0207681_10773405 Ga0207681_107734052 85
390 3300025924 Ga0207694_10594729 Ga0207694_105947291 85
391 3300025925 Ga0207650_10098677 Ga0207650_100986773 85
392 3300025926 Ga0207659_11650844 Ga0207659_116508441 85
393 3300025927 Ga0207687_10163597 Ga0207687_101635973 85
394 3300025931 Ga0207644_10059292 Ga0207644_100592926 85
395 3300025932 Ga0207690_10224007 Ga0207690_102240071 85
396 3300025933 Ga0207706_10014199 Ga0207706_100141999 85
397 3300025934 Ga0207686_10116860 Ga0207686_101168602 85
398 3300025935 Ga0207709_10213374 Ga0207709_102133742 85
399 3300025937 Ga0207669_11614977 Ga0207669_116149771 85
400 3300025940 Ga0207691_10170442 Ga0207691_101704422 85
401 3300025940 Ga0207691_10828742 Ga0207691_108287422 85
402 3300025941 Ga0207711_10062481 Ga0207711_100624813 85
403 3300025942 Ga0207689_10032093 Ga0207689_100320935 85
404 3300025942 Ga0207689_10910808 Ga0207689_109108082 85
405 3300025949 Ga0207667_10093224 Ga0207667_100932244 85
406 3300025972 Ga0207668_11215032 Ga0207668_112150321 85
407 3300025981 Ga0207640_10127629 Ga0207640_101276292 85
408 3300025986 Ga0207658_10088247 Ga0207658_100882472 85
409 3300026023 Ga0207677_10209802 Ga0207677_102098022 85
410 3300026035 Ga0207703_10286310 Ga0207703_102863103 85
411 3300026041 Ga0207639_10045394 Ga0207639_100453946 85
412 3300026067 Ga0207678_10008878 Ga0207678_100088787 85
413 3300026075 Ga0207708_10074020 Ga0207708_100740204 85
414 3300026075 Ga0207708_10089360 Ga0207708_100893604 85
415 3300026088 Ga0207641_10381114 Ga0207641_103811141 85
416 3300026089 Ga0207648_10036427 Ga0207648_100364278 85
417 3300026095 Ga0207676_10303971 Ga0207676_103039712 85
418 3300026116 Ga0207674_10013641 Ga0207674_1001364112 85
419 3300026118 Ga0207675_100039732 Ga0207675_1000397327 85
420 3300026121 Ga0207683_10037484 Ga0207683_100374846 85
421 3300026142 Ga0207698_10142659 Ga0207698_101426593 85
422 3300027866 Ga0209813_10134320 Ga0209813_101343202 85
423 3300028379 Ga0268266_10029574 Ga0268266_100295742 85
424 3300028379 Ga0268266_11173757 Ga0268266_111737572 85
425 3300028381 Ga0268264_10968427 Ga0268264_109684271 85
426 3300031456 Ga0307513_10959720 Ga0307513_109597202 85
427 3300031507 Ga0307509_10380813 Ga0307509_103808132 85
428 3300031911 Ga0307412_11324748 Ga0307412_113247481 85
429 3300033180 Ga0307510_10013236 Ga0307510_100132362 85
430 3300034816 Ga0373930_0139860 Ga0373930_0139860_43_303 85
431 3300041459 Ga0451800_0904413 Ga0451800_0904413_65_325 85
432 3300041509 Ga0451843_0953611 Ga0451843_0953611_121_381 85
433 3300048088 Ga0495602_0745961 Ga0495602_0745961_264_521 85
434 3300048903 Ga0496100_0697731 Ga0496100_0697731_22_282 85
435 3300048904 Ga0496101_0084994 Ga0496101_0084994_786_1046 85
436 3300048904 Ga0496101_0699801 Ga0496101_0699801_473_733 85
437 3300048905 Ga0496102_0057963 Ga0496102_0057963_769_1029 85
438 3300048905 Ga0496102_0296855 Ga0496102_0296855_700_960 85
439 3300048906 Ga0496103_0069774 Ga0496103_0069774_1640_1900 85
440 3300048907 Ga0496104_0205653 Ga0496104_0205653_1320_1580 85
441 3300048907 Ga0496104_0294510 Ga0496104_0294510_97_357 85
442 3300048908 Ga0496105_0371186 Ga0496105_0371186_408_668 85
443 3300048909 Ga0496106_0051448 Ga0496106_0051448_1903_2163 85
444 3300048910 Ga0496107_0455350 Ga0496107_0455350_281_541 85
445 3300048911 Ga0496108_0068039 Ga0496108_0068039_2163_2423 85
446 3300048912 Ga0496109_0293427 Ga0496109_0293427_568_828 85
447 3300048912 Ga0496109_0985614 Ga0496109_0985614_20_280 85
448 3300048913 Ga0496110_0322993 Ga0496110_0322993_752_1012 85
449 3300048913 Ga0496110_0446887 Ga0496110_0446887_18_278 85
450 3300048914 Ga0496111_0058604 Ga0496111_0058604_2075_2335 85
451 3300048914 Ga0496111_1273350 Ga0496111_1273350_144_404 85
452 3300048915 Ga0496112_0055386 Ga0496112_0055386_2515_2775 85
453 3300048916 Ga0496113_0128559 Ga0496113_0128559_905_1165 85
454 3300048917 Ga0496114_0496958 Ga0496114_0496958_169_429 85
455 3300048918 Ga0496115_0153177 Ga0496115_0153177_413_673 85
456 3300048920 Ga0496117_0107550 Ga0496117_0107550_976_1236 85
457 3300048921 Ga0496118_0352631 Ga0496118_0352631_349_609 85
458 3300048924 Ga0496121_0438122 Ga0496121_0438122_283_552 85
459 3300048927 Ga0496124_0044614 Ga0496124_0044614_1127_1387 85
460 3300048928 Ga0496125_0140518 Ga0496125_0140518_856_1116 85
461 3300050489 nmdc:mga03683_15177_c1 nmdc:mga03683_15177_c1_154_414 85
462 3300050489 nmdc:mga03683_89676_c1 nmdc:mga03683_89676_c1_618_878 85
463 3300050491 nmdc:mga00v17_3518_c1 nmdc:mga00v17_3518_c1_231_491 85
464 3300050492 nmdc:mga0yw44_129242_c1 nmdc:mga0yw44_129242_c1_381_641 85
465 3300050493 nmdc:mga0k408_173708_c1 nmdc:mga0k408_173708_c1_883_1143 85
466 3300050493 nmdc:mga0k408_934558_c1 nmdc:mga0k408_934558_c1_20_280 85
467 3300050494 nmdc:mga06z11_98560_c1 nmdc:mga06z11_98560_c1_1311_1571 85
468 3300050495 nmdc:mga04h51_583_c1 nmdc:mga04h51_583_c1_322_582 85
469 3300050496 nmdc:mga07m45_11224_c1 nmdc:mga07m45_11224_c1_429_689 85
470 3300050509 nmdc:mga0qj67_599202_c1 nmdc:mga0qj67_599202_c1_166_426 85
471 3300050512 nmdc:mga0n895_70774_c1 nmdc:mga0n895_70774_c1_2963_3223 85
472 3300050513 nmdc:mga0rr50_14742_c1 nmdc:mga0rr50_14742_c1_1746_2006 85
473 3300050514 nmdc:mga08x19_783038_c1 nmdc:mga08x19_783038_c1_398_658 85
474 3300050515 nmdc:mga0a205_1097038_c1 nmdc:mga0a205_1097038_c1_154_414 85
475 3300053077 Ga0495601_0001204 Ga0495601_0001204_7988_8245 85
476 3300053078 Ga0495612_0041679 Ga0495612_0041679_1199_1456 85
477 3300053080 Ga0500635_0114801 Ga0500635_0114801_706_984 85
478 3300053102 Ga0500554_008419 Ga0500554_008419_1389_1667 85
479 3300053150 Ga0500603_001556 Ga0500603_001556_4467_4745 85
480 3300053178 Ga0500637_0118857 Ga0500637_0118857_1183_1461 85
481 2209111006 2214939095 2214002276 86
482 3300005330 Ga0070690_100322895 Ga0070690_1003228953 86
483 3300005334 Ga0068869_100945950 Ga0068869_1009459502 86
484 3300005338 Ga0068868_101126957 Ga0068868_1011269571 86
485 3300005340 Ga0070689_100767259 Ga0070689_1007672592 86
486 3300005354 Ga0070675_100992220 Ga0070675_1009922202 86
487 3300005366 Ga0070659_100553466 Ga0070659_1005534662 86
488 3300005441 Ga0070700_101586215 Ga0070700_1015862152 86
489 3300005441 Ga0070700_101641283 Ga0070700_1016412831 86
490 3300005455 Ga0070663_100110353 Ga0070663_1001103534 86
491 3300005455 Ga0070663_100230246 Ga0070663_1002302464 86
492 3300005456 Ga0070678_101037223 Ga0070678_1010372232 86
493 3300005457 Ga0070662_100720644 Ga0070662_1007206441 86
494 3300005459 Ga0068867_101394535 Ga0068867_1013945351 86
495 3300005536 Ga0070697_101641841 Ga0070697_1016418411 86
496 3300005546 Ga0070696_100554043 Ga0070696_1005540431 86
497 3300005547 Ga0070693_100532085 Ga0070693_1005320852 86
498 3300005548 Ga0070665_101161484 Ga0070665_1011614842 86
499 3300005548 Ga0070665_102338605 Ga0070665_1023386051 86
500 3300005549 Ga0070704_100741552 Ga0070704_1007415522 86
501 3300005564 Ga0070664_101964828 Ga0070664_1019648281 86
502 3300005614 Ga0068856_100793492 Ga0068856_1007934923 86
503 3300005615 Ga0070702_100229863 Ga0070702_1002298631 86
504 3300005616 Ga0068852_102454455 Ga0068852_1024544552 86
505 3300005617 Ga0068859_101404444 Ga0068859_1014044442 86
506 3300005718 Ga0068866_10600575 Ga0068866_106005752 86
507 3300005719 Ga0068861_100615315 Ga0068861_1006153152 86
508 3300005719 Ga0068861_102126643 Ga0068861_1021266431 86
509 3300005841 Ga0068863_102106535 Ga0068863_1021065352 86
510 3300005842 Ga0068858_102106868 Ga0068858_1021068681 86
511 3300005843 Ga0068860_100320413 Ga0068860_1003204132 86
512 3300005843 Ga0068860_102363346 Ga0068860_1023633462 86
513 3300005844 Ga0068862_100125298 Ga0068862_1001252982 86
514 3300005844 Ga0068862_101235730 Ga0068862_1012357301 86
515 3300005983 Ga0081540_1000131 Ga0081540_100013131 86
516 3300006173 Ga0070716_100619622 Ga0070716_1006196222 86
517 3300006175 Ga0070712_100590604 Ga0070712_1005906041 86
518 3300006852 Ga0075433_10655110 Ga0075433_106551102 86
519 3300006871 Ga0075434_100048247 Ga0075434_1000482472 86
520 3300006871 Ga0075434_100346481 Ga0075434_1003464811 86
521 3300006880 Ga0075429_100516078 Ga0075429_1005160781 86
522 3300006881 Ga0068865_100393122 Ga0068865_1003931222 86
523 3300006881 Ga0068865_101702089 Ga0068865_1017020892 86
524 3300006931 Ga0097620_101404496 Ga0097620_1014044962 86
525 3300009036 Ga0105244_10535065 Ga0105244_105350651 86
526 3300009098 Ga0105245_10334236 Ga0105245_103342362 86
527 3300009098 Ga0105245_11711810 Ga0105245_117118101 86
528 3300009147 Ga0114129_10086965 Ga0114129_100869658 86
529 3300009174 Ga0105241_11323264 Ga0105241_113232641 86
530 3300009176 Ga0105242_10622920 Ga0105242_106229203 86
531 3300009545 Ga0105237_10081725 Ga0105237_100817252 86
532 3300009553 Ga0105249_12596323 Ga0105249_125963232 86
533 3300010375 Ga0105239_10212503 Ga0105239_102125033 86
534 3300010375 Ga0105239_10478085 Ga0105239_104780853 86
535 3300011119 Ga0105246_10353635 Ga0105246_103536352 86
536 3300013296 Ga0157374_10404009 Ga0157374_104040092 86
537 3300013297 Ga0157378_10805268 Ga0157378_108052681 86
538 3300013306 Ga0163162_10113833 Ga0163162_101138336 86
539 3300013306 Ga0163162_10248122 Ga0163162_102481222 86
540 3300013306 Ga0163162_12152011 Ga0163162_121520111 86
541 3300013307 Ga0157372_10318072 Ga0157372_103180723 86
542 3300013307 Ga0157372_11334860 Ga0157372_113348602 86
543 3300014326 Ga0157380_11285452 Ga0157380_112854522 86
544 3300020076 Ga0206355_1342079 Ga0206355_13420792 86
545 3300025914 Ga0207671_10072931 Ga0207671_100729312 86
546 3300025927 Ga0207687_11052527 Ga0207687_110525271 86
547 3300025932 Ga0207690_11273853 Ga0207690_112738531 86
548 3300025933 Ga0207706_10283186 Ga0207706_102831862 86
549 3300025938 Ga0207704_10666176 Ga0207704_106661761 86
550 3300025942 Ga0207689_10217151 Ga0207689_102171512 86
551 3300025961 Ga0207712_10082028 Ga0207712_100820285 86
552 3300025986 Ga0207658_11548300 Ga0207658_115483002 86
553 3300026075 Ga0207708_10609340 Ga0207708_106093403 86
554 3300026078 Ga0207702_10363630 Ga0207702_103636302 86
555 3300026089 Ga0207648_10896504 Ga0207648_108965041 86
556 3300026118 Ga0207675_100490209 Ga0207675_1004902093 86
557 3300026121 Ga0207683_10404501 Ga0207683_104045011 86
558 3300027512 Ga0209179_1160620 Ga0209179_11606201 86
559 3300027907 Ga0207428_10130638 Ga0207428_101306383 86
560 3300028380 Ga0268265_11810695 Ga0268265_118106952 86
561 3300028381 Ga0268264_11323591 Ga0268264_113235911 86
562 3300035172 Ga0373955_0423468 Ga0373955_0423468_381_671 86
563 3300045976 Ga0466967_1701743 Ga0466967_1701743_249_512 86
564 3300046516 Ga0495628_0161276 Ga0495628_0161276_34_324 86
565 3300046543 Ga0495645_0895667 Ga0495645_0895667_42_332 86
566 3300046616 Ga0495668_0307839 Ga0495668_0307839_101_391 86
567 3300046684 Ga0495669_0109957 Ga0495669_0109957_486_776 86
568 3300046694 Ga0495649_0081591 Ga0495649_0081591_699_989 86
569 3300047319 Ga0495674_0485204 Ga0495674_0485204_222_512 86
570 3300048903 Ga0496100_0843902 Ga0496100_0843902_155_445 86
571 3300048905 Ga0496102_0181942 Ga0496102_0181942_1570_1830 86
572 3300048907 Ga0496104_0485160 Ga0496104_0485160_827_1093 86
573 3300048909 Ga0496106_1263684 Ga0496106_1263684_150_410 86
574 3300048911 Ga0496108_0119866 Ga0496108_0119866_1333_1599 86
575 3300048911 Ga0496108_0150541 Ga0496108_0150541_825_1085 86
576 3300048912 Ga0496109_0233190 Ga0496109_0233190_283_543 86
577 3300048913 Ga0496110_0685802 Ga0496110_0685802_605_895 86
578 3300048915 Ga0496112_0267243 Ga0496112_0267243_1006_1272 86
579 3300048916 Ga0496113_0473718 Ga0496113_0473718_154_420 86
580 3300050508 nmdc:mga09592_90090_c1 nmdc:mga09592_90090_c1_309_572 86
581 3300050509 nmdc:mga0qj67_1472203_c1 nmdc:mga0qj67_1472203_c1_134_397 86
582 3300050511 nmdc:mga08y16_117683_c1 nmdc:mga08y16_117683_c1_2129_2392 86
583 3300050512 nmdc:mga0n895_1685282_c1 nmdc:mga0n895_1685282_c1_199_462 86
584 3300050515 nmdc:mga0a205_1158073_c1 nmdc:mga0a205_1158073_c1_46_306 86

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04226

Transgly_assoc

Transglycosylase associated protein

34

81

0.96

Feature Viewer

pLDDT pTM Quality
73.71 0.33 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map