F466341
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 584 | 281 | 1168 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100793074|Ga0070699_1007930741 |
| Length | 165 |
| Sequence | MEGKVTRAARKPSFIIRHSYFIDPKTIYNLQLVMITAYARWTDHERFLGQATSGHAVVLDAAKEKTAPSPMELVLIGLCGCTATDVVSILRKKREPFTSLEVRAEAERAAEPPTVYTSIKLTYRVGGQVSKKGMEDAVRLSKEKYCSVSAMLQKTAEITATIEYL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 6 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 188 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 189 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 191 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 198 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 199 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 208 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 219 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 221 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 224 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 225 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 226 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 259 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 260 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 261 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 265 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 271 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 272 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 273 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 274 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 275 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 276 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.49 |
| Metatranscriptomes | 0.51 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.45 |
| Rhizosphere | 95.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 40.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070699_100793074 | 3300005518 | Bacteria | 867 |
| 2 | MBSR1b_contig_1520736 | 2162886012 | Unclassified | 2194 |
| 3 | JGI24737J22298_10022550 | 3300001990 | Unclassified | 2001 |
| 4 | JGI24743J22301_10003486 | 3300001991 | Unclassified | 2494 |
| 5 | JGI24749J21850_1060864 | 3300002076 | Unclassified | 574 |
| 6 | JGI24033J26618_1012010 | 3300002155 | Unclassified | 1039 |
| 7 | JGI24034J26672_10000499 | 3300002239 | Bacteria | 5070 |
| 8 | JGI24751J29686_10029447 | 3300002459 | Unclassified | 1140 |
| 9 | Ga0058859_11757536 | 3300004798 | Unclassified | 1386 |
| 10 | Ga0065715_10139428 | 3300005293 | Bacteria | 1877 |
| 11 | Ga0065715_10185347 | 3300005293 | Unclassified | 1447 |
| 12 | Ga0065707_10558169 | 3300005295 | Unclassified | 716 |
| 13 | Ga0070658_10320289 | 3300005327 | Unclassified | 1324 |
| 14 | Ga0070658_10575654 | 3300005327 | Unclassified | 975 |
| 15 | Ga0070676_10025389 | 3300005328 | Bacteria | 3349 |
| 16 | Ga0070683_100005697 | 3300005329 | Bacteria | 10406 |
| 17 | Ga0070683_100334469 | 3300005329 | Unclassified | 1442 |
| 18 | Ga0070690_100095705 | 3300005330 | Unclassified | 1961 |
| 19 | Ga0070690_100368272 | 3300005330 | Unclassified | 1047 |
| 20 | Ga0070690_100629758 | 3300005330 | Unclassified | 817 |
| 21 | Ga0070670_100014577 | 3300005331 | Bacteria | 6750 |
| 22 | Ga0070670_100208770 | 3300005331 | Bacteria | 1698 |
| 23 | Ga0070677_10008576 | 3300005333 | Bacteria | 3446 |
| 24 | Ga0070666_10971088 | 3300005335 | Unclassified | 629 |
| 25 | Ga0070680_100162813 | 3300005336 | Bacteria | 1875 |
| 26 | Ga0070682_100064445 | 3300005337 | Unclassified | 2326 |
| 27 | Ga0070682_100183926 | 3300005337 | Unclassified | 1462 |
| 28 | Ga0068868_100256623 | 3300005338 | Unclassified | 1473 |
| 29 | Ga0068868_100846152 | 3300005338 | Unclassified | 828 |
| 30 | Ga0070660_100006500 | 3300005339 | Bacteria | 8108 |
| 31 | Ga0070660_100024092 | 3300005339 | Unclassified | 4515 |
| 32 | Ga0070689_100091819 | 3300005340 | Bacteria | 2394 |
| 33 | Ga0070687_100012916 | 3300005343 | Unclassified | 3705 |
| 34 | Ga0070687_100928477 | 3300005343 | Unclassified | 626 |
| 35 | Ga0070661_100067292 | 3300005344 | Bacteria | 2632 |
| 36 | Ga0070692_11384734 | 3300005345 | Unclassified | 507 |
| 37 | Ga0070668_100014961 | 3300005347 | Bacteria | 5798 |
| 38 | Ga0070669_100013115 | 3300005353 | Bacteria | 5889 |
| 39 | Ga0070669_100139972 | 3300005353 | Bacteria | 1865 |
| 40 | Ga0070675_100055816 | 3300005354 | Bacteria | 3252 |
| 41 | Ga0070675_100621997 | 3300005354 | Unclassified | 980 |
| 42 | Ga0070671_100116805 | 3300005355 | Bacteria | 2243 |
| 43 | Ga0070671_101085981 | 3300005355 | Unclassified | 702 |
| 44 | Ga0070674_100476135 | 3300005356 | Unclassified | 1035 |
| 45 | Ga0070659_100003497 | 3300005366 | Bacteria | 11186 |
| 46 | Ga0070659_100120492 | 3300005366 | Bacteria | 2124 |
| 47 | Ga0070667_100018641 | 3300005367 | Bacteria | 5756 |
| 48 | Ga0070667_102205286 | 3300005367 | Unclassified | 519 |
| 49 | Ga0070709_10002104 | 3300005434 | Bacteria | 10775 |
| 50 | Ga0070709_10006371 | 3300005434 | Bacteria | 6429 |
| 51 | Ga0070709_10101181 | 3300005434 | Bacteria | 1920 |
| 52 | Ga0070714_100000069 | 3300005435 | Bacteria | 93567 |
| 53 | Ga0070714_100009246 | 3300005435 | Bacteria | 7743 |
| 54 | Ga0070714_100119958 | 3300005435 | Bacteria | 2338 |
| 55 | Ga0070714_100198829 | 3300005435 | Bacteria | 1833 |
| 56 | Ga0070714_100276818 | 3300005435 | Bacteria | 1558 |
| 57 | Ga0070714_100396486 | 3300005435 | Bacteria | 1304 |
| 58 | Ga0070714_100429680 | 3300005435 | Bacteria | 1252 |
| 59 | Ga0070714_101503227 | 3300005435 | Unclassified | 658 |
| 60 | Ga0070714_102087367 | 3300005435 | Unclassified | 552 |
| 61 | Ga0070713_100000432 | 3300005436 | Bacteria | 26764 |
| 62 | Ga0070713_100001604 | 3300005436 | Bacteria | 14476 |
| 63 | Ga0070713_100025744 | 3300005436 | Bacteria | 4606 |
| 64 | Ga0070713_100115756 | 3300005436 | Unclassified | 2343 |
| 65 | Ga0070713_100180065 | 3300005436 | Archaea | 1899 |
| 66 | Ga0070713_100259256 | 3300005436 | Bacteria | 1588 |
| 67 | Ga0070713_100338289 | 3300005436 | Bacteria | 1394 |
| 68 | Ga0070713_100569262 | 3300005436 | Bacteria | 1074 |
| 69 | Ga0070710_10032334 | 3300005437 | Bacteria | 2834 |
| 70 | Ga0070710_10095114 | 3300005437 | Bacteria | 1764 |
| 71 | Ga0070710_10239318 | 3300005437 | Unclassified | 1162 |
| 72 | Ga0070701_10035493 | 3300005438 | Unclassified | 2505 |
| 73 | Ga0070711_100000340 | 3300005439 | Bacteria | 24038 |
| 74 | Ga0070711_100039044 | 3300005439 | Unclassified | 3195 |
| 75 | Ga0070711_100069569 | 3300005439 | Bacteria | 2476 |
| 76 | Ga0070711_100412032 | 3300005439 | Unclassified | 1099 |
| 77 | Ga0070711_101056692 | 3300005439 | Bacteria | 698 |
| 78 | Ga0070711_101474866 | 3300005439 | Unclassified | 593 |
| 79 | Ga0070700_100235392 | 3300005441 | Unclassified | 1306 |
| 80 | Ga0070708_100012763 | 3300005445 | Bacteria | 6864 |
| 81 | Ga0070708_100041792 | 3300005445 | Bacteria | 4021 |
| 82 | Ga0070708_100073284 | 3300005445 | Unclassified | 3086 |
| 83 | Ga0070708_101489142 | 3300005445 | Bacteria | 631 |
| 84 | Ga0070663_100132557 | 3300005455 | Bacteria | 1894 |
| 85 | Ga0070663_100154652 | 3300005455 | Unclassified | 1761 |
| 86 | Ga0070678_100001279 | 3300005456 | Bacteria | 13335 |
| 87 | Ga0070678_100325364 | 3300005456 | Unclassified | 1314 |
| 88 | Ga0070662_100072154 | 3300005457 | Unclassified | 2548 |
| 89 | Ga0070681_10015039 | 3300005458 | Bacteria | 7698 |
| 90 | Ga0070681_10137981 | 3300005458 | Bacteria | 2368 |
| 91 | Ga0070681_10316890 | 3300005458 | Bacteria | 1469 |
| 92 | Ga0070681_11067802 | 3300005458 | Bacteria | 728 |
| 93 | Ga0070681_11406604 | 3300005458 | Bacteria | 621 |
| 94 | Ga0070685_10006488 | 3300005466 | Bacteria | 5966 |
| 95 | Ga0070706_100010487 | 3300005467 | Bacteria | 8600 |
| 96 | Ga0070706_100069388 | 3300005467 | Unclassified | 3260 |
| 97 | Ga0070706_100071686 | 3300005467 | Bacteria | 3205 |
| 98 | Ga0070706_100135894 | 3300005467 | Bacteria | 2295 |
| 99 | Ga0070707_100006096 | 3300005468 | Bacteria | 11241 |
| 100 | Ga0070707_100009485 | 3300005468 | Bacteria | 9039 |
| 101 | Ga0070707_100092063 | 3300005468 | Bacteria | 2935 |
| 102 | Ga0070707_100124956 | 3300005468 | Bacteria | 2499 |
| 103 | Ga0070707_100193914 | 3300005468 | Bacteria | 1981 |
| 104 | Ga0070707_100249291 | 3300005468 | Unclassified | 1728 |
| 105 | Ga0070707_100379607 | 3300005468 | Bacteria | 1373 |
| 106 | Ga0070707_100849896 | 3300005468 | Bacteria | 877 |
| 107 | Ga0070698_100030770 | 3300005471 | Bacteria | 5565 |
| 108 | Ga0070698_100064327 | 3300005471 | Bacteria | 3696 |
| 109 | Ga0070698_100166792 | 3300005471 | Bacteria | 2145 |
| 110 | Ga0070699_100001027 | 3300005518 | Bacteria | 25921 |
| 111 | Ga0070699_100008978 | 3300005518 | Bacteria | 8658 |
| 112 | Ga0070699_100644604 | 3300005518 | Bacteria | 967 |
| 113 | Ga0070699_101352983 | 3300005518 | Unclassified | 653 |
| 114 | Ga0070699_101354503 | 3300005518 | Unclassified | 653 |
| 115 | Ga0070699_101821952 | 3300005518 | Unclassified | 557 |
| 116 | Ga0070679_100306637 | 3300005530 | Bacteria | 1538 |
| 117 | Ga0070679_100356680 | 3300005530 | Unclassified | 1410 |
| 118 | Ga0070679_101054760 | 3300005530 | Unclassified | 757 |
| 119 | Ga0070684_100008190 | 3300005535 | Bacteria | 8165 |
| 120 | Ga0070684_100058238 | 3300005535 | Unclassified | 3376 |
| 121 | Ga0070697_100005514 | 3300005536 | Bacteria | 9753 |
| 122 | Ga0070697_100038998 | 3300005536 | Bacteria | 3839 |
| 123 | Ga0070697_100415627 | 3300005536 | Bacteria | 1168 |
| 124 | Ga0070697_100703548 | 3300005536 | Bacteria | 892 |
| 125 | Ga0070697_100905908 | 3300005536 | Unclassified | 782 |
| 126 | Ga0068853_100007763 | 3300005539 | Bacteria | 8605 |
| 127 | Ga0068853_100030992 | 3300005539 | Bacteria | 4520 |
| 128 | Ga0068853_101225314 | 3300005539 | Unclassified | 725 |
| 129 | Ga0070672_100106557 | 3300005543 | Unclassified | 2280 |
| 130 | Ga0070686_100278841 | 3300005544 | Bacteria | 1232 |
| 131 | Ga0070686_100379598 | 3300005544 | Unclassified | 1069 |
| 132 | Ga0070695_101241229 | 3300005545 | Bacteria | 614 |
| 133 | Ga0070693_100059055 | 3300005547 | Unclassified | 2222 |
| 134 | Ga0068855_100029998 | 3300005563 | Bacteria | 6504 |
| 135 | Ga0068855_100444416 | 3300005563 | Bacteria | 1416 |
| 136 | Ga0068855_100467719 | 3300005563 | Bacteria | 1374 |
| 137 | Ga0068855_100830688 | 3300005563 | Bacteria | 980 |
| 138 | Ga0070664_100453641 | 3300005564 | Unclassified | 1177 |
| 139 | Ga0068857_100149834 | 3300005577 | Bacteria | 2113 |
| 140 | Ga0068857_100833958 | 3300005577 | Unclassified | 881 |
| 141 | Ga0068857_102299117 | 3300005577 | Bacteria | 529 |
| 142 | Ga0068854_100147293 | 3300005578 | Bacteria | 1812 |
| 143 | Ga0068854_100676058 | 3300005578 | Unclassified | 889 |
| 144 | Ga0068854_101015950 | 3300005578 | Bacteria | 735 |
| 145 | Ga0068856_100002427 | 3300005614 | Bacteria | 19176 |
| 146 | Ga0068856_100040140 | 3300005614 | Unclassified | 4596 |
| 147 | Ga0068856_100293226 | 3300005614 | Unclassified | 1643 |
| 148 | Ga0068856_100343659 | 3300005614 | Bacteria | 1511 |
| 149 | Ga0070702_100599296 | 3300005615 | Unclassified | 826 |
| 150 | Ga0068852_100033406 | 3300005616 | Unclassified | 4270 |
| 151 | Ga0068852_100198010 | 3300005616 | Bacteria | 1900 |
| 152 | Ga0068859_100108769 | 3300005617 | Bacteria | 2833 |
| 153 | Ga0068864_100117827 | 3300005618 | Bacteria | 2371 |
| 154 | Ga0068864_101587147 | 3300005618 | Unclassified | 658 |
| 155 | Ga0068866_10004876 | 3300005718 | Bacteria | 5510 |
| 156 | Ga0068861_102532556 | 3300005719 | Unclassified | 517 |
| 157 | Ga0068851_10038726 | 3300005834 | Bacteria | 2393 |
| 158 | Ga0068851_10576531 | 3300005834 | Unclassified | 682 |
| 159 | Ga0068870_10047043 | 3300005840 | Bacteria | 2265 |
| 160 | Ga0068863_100019063 | 3300005841 | Bacteria | 6567 |
| 161 | Ga0068863_100184095 | 3300005841 | Unclassified | 2006 |
| 162 | Ga0068863_100236045 | 3300005841 | Unclassified | 1765 |
| 163 | Ga0068858_100022316 | 3300005842 | Bacteria | 5910 |
| 164 | Ga0068860_100103788 | 3300005843 | Unclassified | 2714 |
| 165 | Ga0068862_100028772 | 3300005844 | Unclassified | 4680 |
| 166 | Ga0068862_100856742 | 3300005844 | Unclassified | 891 |
| 167 | Ga0070717_10000535 | 3300006028 | Bacteria | 24038 |
| 168 | Ga0070717_10000774 | 3300006028 | Bacteria | 20927 |
| 169 | Ga0070717_10005116 | 3300006028 | Bacteria | 9568 |
| 170 | Ga0070717_10252821 | 3300006028 | Bacteria | 1557 |
| 171 | Ga0070717_10317015 | 3300006028 | Bacteria | 1388 |
| 172 | Ga0070717_10389735 | 3300006028 | Bacteria | 1250 |
| 173 | Ga0070717_10427178 | 3300006028 | Unclassified | 1192 |
| 174 | Ga0070717_10584174 | 3300006028 | Unclassified | 1013 |
| 175 | Ga0070717_10933422 | 3300006028 | Unclassified | 790 |
| 176 | Ga0070715_10019671 | 3300006163 | Bacteria | 2594 |
| 177 | Ga0070715_10057614 | 3300006163 | Unclassified | 1693 |
| 178 | Ga0070716_100000792 | 3300006173 | Bacteria | 13578 |
| 179 | Ga0070716_100003222 | 3300006173 | Bacteria | 7658 |
| 180 | Ga0070716_100100104 | 3300006173 | Bacteria | 1775 |
| 181 | Ga0070716_100123893 | 3300006173 | Bacteria | 1622 |
| 182 | Ga0070716_100155662 | 3300006173 | Bacteria | 1475 |
| 183 | Ga0070716_100328294 | 3300006173 | Bacteria | 1075 |
| 184 | Ga0070716_100367081 | 3300006173 | Unclassified | 1024 |
| 185 | Ga0070716_100490504 | 3300006173 | Unclassified | 904 |
| 186 | Ga0070716_100832908 | 3300006173 | Bacteria | 717 |
| 187 | Ga0070716_101117709 | 3300006173 | Unclassified | 629 |
| 188 | Ga0070712_100033521 | 3300006175 | Bacteria | 3476 |
| 189 | Ga0070712_100084987 | 3300006175 | Bacteria | 2302 |
| 190 | Ga0070712_100098909 | 3300006175 | Bacteria | 2152 |
| 191 | Ga0070712_100125793 | 3300006175 | Bacteria | 1936 |
| 192 | Ga0070712_100844784 | 3300006175 | Bacteria | 787 |
| 193 | Ga0097621_100130082 | 3300006237 | Unclassified | 2142 |
| 194 | Ga0068871_100326392 | 3300006358 | Bacteria | 1353 |
| 195 | Ga0068871_100664804 | 3300006358 | Unclassified | 952 |
| 196 | Ga0068871_100723521 | 3300006358 | Bacteria | 913 |
| 197 | Ga0068865_100328457 | 3300006881 | Unclassified | 1232 |
| 198 | Ga0075436_100003704 | 3300006914 | Bacteria | 10475 |
| 199 | Ga0075436_100064446 | 3300006914 | Bacteria | 2533 |
| 200 | Ga0075436_100132702 | 3300006914 | Unclassified | 1747 |
| 201 | Ga0097620_100108769 | 3300006931 | Bacteria | 2833 |
| 202 | Ga0075435_100506761 | 3300007076 | Unclassified | 1044 |
| 203 | Ga0075435_100784378 | 3300007076 | Bacteria | 829 |
| 204 | Ga0099794_10418028 | 3300007265 | Bacteria | 701 |
| 205 | Ga0105250_10011456 | 3300009092 | Unclassified | 3677 |
| 206 | Ga0105240_10023269 | 3300009093 | Bacteria | 8199 |
| 207 | Ga0105240_10106765 | 3300009093 | Bacteria | 3395 |
| 208 | Ga0105240_10502575 | 3300009093 | Unclassified | 1348 |
| 209 | Ga0105240_10752005 | 3300009093 | Bacteria | 1060 |
| 210 | Ga0111539_10439828 | 3300009094 | Unclassified | 1518 |
| 211 | Ga0105245_10006526 | 3300009098 | Bacteria | 10246 |
| 212 | Ga0105245_10131233 | 3300009098 | Unclassified | 2350 |
| 213 | Ga0105247_10009888 | 3300009101 | Bacteria | 5779 |
| 214 | Ga0105241_10005799 | 3300009174 | Bacteria | 9118 |
| 215 | Ga0105241_10163316 | 3300009174 | Bacteria | 1833 |
| 216 | Ga0105241_10351316 | 3300009174 | Bacteria | 1280 |
| 217 | Ga0105241_11752262 | 3300009174 | Unclassified | 605 |
| 218 | Ga0105242_10039444 | 3300009176 | Bacteria | 3801 |
| 219 | Ga0105248_10158545 | 3300009177 | Unclassified | 2553 |
| 220 | Ga0105248_10891987 | 3300009177 | Unclassified | 1004 |
| 221 | Ga0105237_10101184 | 3300009545 | Bacteria | 2874 |
| 222 | Ga0105238_10132724 | 3300009551 | Bacteria | 2469 |
| 223 | Ga0105238_10515169 | 3300009551 | Unclassified | 1198 |
| 224 | Ga0105238_10690566 | 3300009551 | Bacteria | 1032 |
| 225 | Ga0105249_10045464 | 3300009553 | Unclassified | 3993 |
| 226 | Ga0105249_10058017 | 3300009553 | Unclassified | 3548 |
| 227 | Ga0105239_10007204 | 3300010375 | Bacteria | 12783 |
| 228 | Ga0105239_10193424 | 3300010375 | Bacteria | 2277 |
| 229 | Ga0105239_10400412 | 3300010375 | Unclassified | 1553 |
| 230 | Ga0105239_10549897 | 3300010375 | Bacteria | 1315 |
| 231 | Ga0105239_11902513 | 3300010375 | Unclassified | 690 |
| 232 | Ga0105246_10008559 | 3300011119 | Bacteria | 6293 |
| 233 | Ga0157373_10004453 | 3300013100 | Bacteria | 10538 |
| 234 | Ga0157373_10021421 | 3300013100 | Unclassified | 4696 |
| 235 | Ga0157371_10121856 | 3300013102 | Unclassified | 1854 |
| 236 | Ga0157370_10221475 | 3300013104 | Bacteria | 1752 |
| 237 | Ga0157370_10320992 | 3300013104 | Bacteria | 1428 |
| 238 | Ga0157369_10038570 | 3300013105 | Bacteria | 5224 |
| 239 | Ga0157369_10531212 | 3300013105 | Bacteria | 1216 |
| 240 | Ga0157369_10686189 | 3300013105 | Bacteria | 1055 |
| 241 | Ga0157374_10046865 | 3300013296 | Unclassified | 4005 |
| 242 | Ga0157374_10052978 | 3300013296 | Bacteria | 3781 |
| 243 | Ga0157374_10592784 | 3300013296 | Unclassified | 1118 |
| 244 | Ga0157378_10870689 | 3300013297 | Unclassified | 930 |
| 245 | Ga0163162_10028765 | 3300013306 | Bacteria | 5501 |
| 246 | Ga0163162_10061087 | 3300013306 | Unclassified | 3806 |
| 247 | Ga0157372_10012309 | 3300013307 | Bacteria | 9116 |
| 248 | Ga0157372_10196987 | 3300013307 | Bacteria | 2333 |
| 249 | Ga0157372_10942616 | 3300013307 | Bacteria | 1001 |
| 250 | Ga0157372_11300318 | 3300013307 | Bacteria | 839 |
| 251 | Ga0157375_10018772 | 3300013308 | Bacteria | 6275 |
| 252 | Ga0157375_10731394 | 3300013308 | Unclassified | 1142 |
| 253 | Ga0163163_10006167 | 3300014325 | Bacteria | 10450 |
| 254 | Ga0163163_10008354 | 3300014325 | Bacteria | 9195 |
| 255 | Ga0163163_10030385 | 3300014325 | Bacteria | 5206 |
| 256 | Ga0163163_10089698 | 3300014325 | Bacteria | 3087 |
| 257 | Ga0163163_10438906 | 3300014325 | Unclassified | 1365 |
| 258 | Ga0163163_10670480 | 3300014325 | Unclassified | 1100 |
| 259 | Ga0157380_10102355 | 3300014326 | Bacteria | 2388 |
| 260 | Ga0182008_10015208 | 3300014497 | Unclassified | 4018 |
| 261 | Ga0182008_10213825 | 3300014497 | Unclassified | 985 |
| 262 | Ga0157377_10000586 | 3300014745 | Bacteria | 15141 |
| 263 | Ga0157377_10306086 | 3300014745 | Unclassified | 1051 |
| 264 | Ga0157379_10006714 | 3300014968 | Bacteria | 9940 |
| 265 | Ga0157379_10973366 | 3300014968 | Unclassified | 808 |
| 266 | Ga0157376_10013454 | 3300014969 | Bacteria | 6104 |
| 267 | Ga0157376_10349109 | 3300014969 | Unclassified | 1415 |
| 268 | Ga0157376_10365881 | 3300014969 | Bacteria | 1384 |
| 269 | Ga0182006_1031108 | 3300015261 | Bacteria | 2153 |
| 270 | Ga0182007_10005454 | 3300015262 | Bacteria | 5582 |
| 271 | Ga0182005_1029281 | 3300015265 | Unclassified | 1502 |
| 272 | Ga0182005_1044810 | 3300015265 | Bacteria | 1202 |
| 273 | Ga0163161_10001547 | 3300017792 | Bacteria | 16984 |
| 274 | Ga0224572_1075237 | 3300024225 | Unclassified | 623 |
| 275 | Ga0207656_10124430 | 3300025321 | Bacteria | 1203 |
| 276 | Ga0207656_10135191 | 3300025321 | Unclassified | 1158 |
| 277 | Ga0207682_10016930 | 3300025893 | Bacteria | 2845 |
| 278 | Ga0207692_10064522 | 3300025898 | Bacteria | 1907 |
| 279 | Ga0207692_10065092 | 3300025898 | Bacteria | 1900 |
| 280 | Ga0207692_10147019 | 3300025898 | Unclassified | 1346 |
| 281 | Ga0207642_10049378 | 3300025899 | Unclassified | 1891 |
| 282 | Ga0207710_10018798 | 3300025900 | Unclassified | 2942 |
| 283 | Ga0207688_10012221 | 3300025901 | Unclassified | 4669 |
| 284 | Ga0207680_10504031 | 3300025903 | Unclassified | 862 |
| 285 | Ga0207647_10003396 | 3300025904 | Bacteria | 11930 |
| 286 | Ga0207685_10021556 | 3300025905 | Unclassified | 2161 |
| 287 | Ga0207685_10044952 | 3300025905 | Bacteria | 1672 |
| 288 | Ga0207699_10034920 | 3300025906 | Bacteria | 2856 |
| 289 | Ga0207699_10037774 | 3300025906 | Unclassified | 2763 |
| 290 | Ga0207699_10038036 | 3300025906 | Unclassified | 2754 |
| 291 | Ga0207699_10053062 | 3300025906 | Unclassified | 2403 |
| 292 | Ga0207699_10120381 | 3300025906 | Unclassified | 1697 |
| 293 | Ga0207699_10298717 | 3300025906 | Bacteria | 1124 |
| 294 | Ga0207699_10304448 | 3300025906 | Bacteria | 1114 |
| 295 | Ga0207645_10000551 | 3300025907 | Bacteria | 31119 |
| 296 | Ga0207643_10005881 | 3300025908 | Bacteria | 6552 |
| 297 | Ga0207705_10957682 | 3300025909 | Unclassified | 662 |
| 298 | Ga0207684_10002771 | 3300025910 | Bacteria | 17451 |
| 299 | Ga0207684_10049869 | 3300025910 | Unclassified | 3551 |
| 300 | Ga0207684_10059551 | 3300025910 | Bacteria | 3243 |
| 301 | Ga0207684_10099131 | 3300025910 | Unclassified | 2488 |
| 302 | Ga0207654_10063715 | 3300025911 | Bacteria | 2165 |
| 303 | Ga0207654_11331277 | 3300025911 | Unclassified | 524 |
| 304 | Ga0207707_10265712 | 3300025912 | Bacteria | 1488 |
| 305 | Ga0207707_11104211 | 3300025912 | Bacteria | 646 |
| 306 | Ga0207695_10026809 | 3300025913 | Bacteria | 6426 |
| 307 | Ga0207695_10067791 | 3300025913 | Unclassified | 3659 |
| 308 | Ga0207693_10000010 | 3300025915 | Bacteria | 162031 |
| 309 | Ga0207693_10002941 | 3300025915 | Bacteria | 14743 |
| 310 | Ga0207693_10043654 | 3300025915 | Bacteria | 3525 |
| 311 | Ga0207693_10055653 | 3300025915 | Bacteria | 3103 |
| 312 | Ga0207693_10161959 | 3300025915 | Bacteria | 1760 |
| 313 | Ga0207663_10000541 | 3300025916 | Bacteria | 16618 |
| 314 | Ga0207663_10065744 | 3300025916 | Bacteria | 2319 |
| 315 | Ga0207663_10249981 | 3300025916 | Unclassified | 1304 |
| 316 | Ga0207662_10000359 | 3300025918 | Bacteria | 20504 |
| 317 | Ga0207657_10006439 | 3300025919 | Bacteria | 12168 |
| 318 | Ga0207657_10330060 | 3300025919 | Bacteria | 1205 |
| 319 | Ga0207649_10000546 | 3300025920 | Bacteria | 26008 |
| 320 | Ga0207649_10065665 | 3300025920 | Bacteria | 2298 |
| 321 | Ga0207652_10562188 | 3300025921 | Unclassified | 1024 |
| 322 | Ga0207646_10010353 | 3300025922 | Bacteria | 9120 |
| 323 | Ga0207646_10078909 | 3300025922 | Bacteria | 2943 |
| 324 | Ga0207646_10131111 | 3300025922 | Bacteria | 2256 |
| 325 | Ga0207646_10131355 | 3300025922 | Bacteria | 2254 |
| 326 | Ga0207646_10134841 | 3300025922 | Bacteria | 2223 |
| 327 | Ga0207646_10173488 | 3300025922 | Bacteria | 1947 |
| 328 | Ga0207681_10123919 | 3300025923 | Bacteria | 1900 |
| 329 | Ga0207681_10466426 | 3300025923 | Unclassified | 1029 |
| 330 | Ga0207694_10694841 | 3300025924 | Unclassified | 858 |
| 331 | Ga0207694_11126135 | 3300025924 | Bacteria | 664 |
| 332 | Ga0207650_10000045 | 3300025925 | Bacteria | 181507 |
| 333 | Ga0207650_10894898 | 3300025925 | Unclassified | 754 |
| 334 | Ga0207659_10866935 | 3300025926 | Unclassified | 776 |
| 335 | Ga0207687_10472409 | 3300025927 | Unclassified | 1043 |
| 336 | Ga0207687_10739471 | 3300025927 | Bacteria | 837 |
| 337 | Ga0207700_10005755 | 3300025928 | Bacteria | 7443 |
| 338 | Ga0207700_10047164 | 3300025928 | Bacteria | 3192 |
| 339 | Ga0207700_10061696 | 3300025928 | Bacteria | 2844 |
| 340 | Ga0207700_10157117 | 3300025928 | Unclassified | 1885 |
| 341 | Ga0207700_10338021 | 3300025928 | Bacteria | 1308 |
| 342 | Ga0207700_10694849 | 3300025928 | Unclassified | 908 |
| 343 | Ga0207700_10772156 | 3300025928 | Unclassified | 859 |
| 344 | Ga0207664_10000084 | 3300025929 | Bacteria | 93564 |
| 345 | Ga0207664_10002513 | 3300025929 | Bacteria | 12133 |
| 346 | Ga0207664_10053970 | 3300025929 | Bacteria | 3183 |
| 347 | Ga0207664_10368861 | 3300025929 | Bacteria | 1273 |
| 348 | Ga0207664_10487527 | 3300025929 | Bacteria | 1103 |
| 349 | Ga0207644_10018085 | 3300025931 | Unclassified | 4765 |
| 350 | Ga0207690_10150412 | 3300025932 | Bacteria | 1725 |
| 351 | Ga0207690_10216747 | 3300025932 | Unclassified | 1462 |
| 352 | Ga0207690_11073472 | 3300025932 | Unclassified | 671 |
| 353 | Ga0207706_10001085 | 3300025933 | Bacteria | 27637 |
| 354 | Ga0207706_10015387 | 3300025933 | Bacteria | 6911 |
| 355 | Ga0207686_11622488 | 3300025934 | Unclassified | 534 |
| 356 | Ga0207670_10290299 | 3300025936 | Unclassified | 1277 |
| 357 | Ga0207669_10605012 | 3300025937 | Unclassified | 891 |
| 358 | Ga0207704_10828483 | 3300025938 | Unclassified | 774 |
| 359 | Ga0207665_10001046 | 3300025939 | Bacteria | 18599 |
| 360 | Ga0207665_10081748 | 3300025939 | Bacteria | 2225 |
| 361 | Ga0207665_10278571 | 3300025939 | Unclassified | 1244 |
| 362 | Ga0207665_10301797 | 3300025939 | Bacteria | 1197 |
| 363 | Ga0207665_11041111 | 3300025939 | Unclassified | 652 |
| 364 | Ga0207691_10001782 | 3300025940 | Bacteria | 21176 |
| 365 | Ga0207689_10001473 | 3300025942 | Bacteria | 22547 |
| 366 | Ga0207661_10000131 | 3300025944 | Bacteria | 47673 |
| 367 | Ga0207661_10193847 | 3300025944 | Unclassified | 1783 |
| 368 | Ga0207679_10000283 | 3300025945 | Bacteria | 38405 |
| 369 | Ga0207667_10356049 | 3300025949 | Unclassified | 1492 |
| 370 | Ga0207667_10415444 | 3300025949 | Bacteria | 1369 |
| 371 | Ga0207667_10683862 | 3300025949 | Bacteria | 1029 |
| 372 | Ga0207651_10009810 | 3300025960 | Bacteria | 5267 |
| 373 | Ga0207712_10030789 | 3300025961 | Unclassified | 3609 |
| 374 | Ga0207668_11562406 | 3300025972 | Unclassified | 595 |
| 375 | Ga0207640_10502092 | 3300025981 | Unclassified | 1010 |
| 376 | Ga0207658_10158695 | 3300025986 | Bacteria | 1851 |
| 377 | Ga0207658_10634869 | 3300025986 | Bacteria | 962 |
| 378 | Ga0207677_10198917 | 3300026023 | Unclassified | 1591 |
| 379 | Ga0207677_10649161 | 3300026023 | Bacteria | 931 |
| 380 | Ga0207703_10045185 | 3300026035 | Bacteria | 3542 |
| 381 | Ga0207639_10265446 | 3300026041 | Bacteria | 1503 |
| 382 | Ga0207639_10595449 | 3300026041 | Unclassified | 1019 |
| 383 | Ga0207678_10001378 | 3300026067 | Bacteria | 22391 |
| 384 | Ga0207678_10232501 | 3300026067 | Unclassified | 1578 |
| 385 | Ga0207702_10050684 | 3300026078 | Bacteria | 3505 |
| 386 | Ga0207702_10108385 | 3300026078 | Bacteria | 2464 |
| 387 | Ga0207702_10279068 | 3300026078 | Unclassified | 1579 |
| 388 | Ga0207702_10586264 | 3300026078 | Bacteria | 1093 |
| 389 | Ga0207641_10000021 | 3300026088 | Bacteria | 279851 |
| 390 | Ga0207641_10196731 | 3300026088 | Unclassified | 1856 |
| 391 | Ga0207641_10676539 | 3300026088 | Bacteria | 1015 |
| 392 | Ga0207641_10906849 | 3300026088 | Unclassified | 875 |
| 393 | Ga0207648_10000611 | 3300026089 | Bacteria | 40065 |
| 394 | Ga0207676_10000096 | 3300026095 | Bacteria | 80353 |
| 395 | Ga0207674_10000246 | 3300026116 | Bacteria | 67486 |
| 396 | Ga0207674_10060331 | 3300026116 | Unclassified | 3836 |
| 397 | Ga0207674_11310567 | 3300026116 | Unclassified | 694 |
| 398 | Ga0207675_100070698 | 3300026118 | Unclassified | 3262 |
| 399 | Ga0207683_10001457 | 3300026121 | Bacteria | 21339 |
| 400 | Ga0207683_10267748 | 3300026121 | Bacteria | 1560 |
| 401 | Ga0207698_10573319 | 3300026142 | Unclassified | 1109 |
| 402 | Ga0207698_10978216 | 3300026142 | Unclassified | 856 |
| 403 | Ga0268266_10005064 | 3300028379 | Bacteria | 12430 |
| 404 | Ga0268265_10003076 | 3300028380 | Bacteria | 12174 |
| 405 | Ga0268264_10047549 | 3300028381 | Unclassified | 3567 |
| 406 | Ga0268264_10084962 | 3300028381 | Unclassified | 2715 |
| 407 | Ga0268264_10325319 | 3300028381 | Bacteria | 1455 |
| 408 | Ga0265338_10014641 | 3300028800 | Bacteria | 8701 |
| 409 | Ga0265338_10170877 | 3300028800 | Bacteria | 1667 |
| 410 | Ga0265338_10175413 | 3300028800 | Bacteria | 1639 |
| 411 | Ga0265338_10227177 | 3300028800 | Bacteria | 1390 |
| 412 | Ga0265338_10604582 | 3300028800 | Bacteria | 763 |
| 413 | Ga0265760_10009710 | 3300031090 | Bacteria | 2749 |
| 414 | Ga0265760_10064166 | 3300031090 | Bacteria | 1120 |
| 415 | Ga0265330_10374219 | 3300031235 | Unclassified | 602 |
| 416 | Ga0265332_10196762 | 3300031238 | Bacteria | 838 |
| 417 | Ga0265328_10011628 | 3300031239 | Bacteria | 3512 |
| 418 | Ga0265328_10040444 | 3300031239 | Bacteria | 1718 |
| 419 | Ga0265325_10007751 | 3300031241 | Bacteria | 6397 |
| 420 | Ga0265325_10009917 | 3300031241 | Bacteria | 5542 |
| 421 | Ga0265325_10031869 | 3300031241 | Unclassified | 2817 |
| 422 | Ga0265325_10052024 | 3300031241 | Bacteria | 2104 |
| 423 | Ga0265325_10078570 | 3300031241 | Bacteria | 1643 |
| 424 | Ga0265329_10092353 | 3300031242 | Bacteria | 961 |
| 425 | Ga0265340_10002683 | 3300031247 | Bacteria | 10120 |
| 426 | Ga0265340_10007178 | 3300031247 | Bacteria | 6070 |
| 427 | Ga0265340_10039294 | 3300031247 | Bacteria | 2336 |
| 428 | Ga0265339_10015912 | 3300031249 | Unclassified | 4496 |
| 429 | Ga0265339_10197445 | 3300031249 | Unclassified | 994 |
| 430 | Ga0265339_10358553 | 3300031249 | Viruses | 686 |
| 431 | Ga0265339_10513629 | 3300031249 | Unclassified | 553 |
| 432 | Ga0265331_10017081 | 3300031250 | Bacteria | 3793 |
| 433 | Ga0265316_10001005 | 3300031344 | Bacteria | 30618 |
| 434 | Ga0265316_10029140 | 3300031344 | Unclassified | 4544 |
| 435 | Ga0265316_10041370 | 3300031344 | Bacteria | 3689 |
| 436 | Ga0265316_10072399 | 3300031344 | Bacteria | 2655 |
| 437 | Ga0265313_10013056 | 3300031595 | Bacteria | 5020 |
| 438 | Ga0265313_10075770 | 3300031595 | Bacteria | 1539 |
| 439 | Ga0265314_10081206 | 3300031711 | Bacteria | 2137 |
| 440 | Ga0265314_10105524 | 3300031711 | Unclassified | 1801 |
| 441 | Ga0265314_10364258 | 3300031711 | Bacteria | 791 |
| 442 | Ga0265342_10043479 | 3300031712 | Unclassified | 2711 |
| 443 | Ga0316214_1005815 | 3300033545 | Unclassified | 1621 |
| 444 | Ga0373926_0019860 | 3300035083 | Bacteria | 2319 |
| 445 | Ga0373926_0326391 | 3300035083 | Unclassified | 601 |
| 446 | Ga0373934_0006504 | 3300035086 | Bacteria | 4336 |
| 447 | Ga0373944_0060904 | 3300035089 | Unclassified | 1211 |
| 448 | Ga0373923_0007452 | 3300035111 | Bacteria | 3848 |
| 449 | Ga0373923_0108618 | 3300035111 | Unclassified | 1230 |
| 450 | Ga0373936_0004722 | 3300035113 | Bacteria | 5147 |
| 451 | Ga0373945_0004249 | 3300035116 | Bacteria | 4540 |
| 452 | Ga0373945_0234865 | 3300035116 | Unclassified | 770 |
| 453 | Ga0373953_0032634 | 3300035117 | Bacteria | 2032 |
| 454 | Ga0373954_0026687 | 3300035118 | Bacteria | 2648 |
| 455 | Ga0373956_0179157 | 3300035119 | Unclassified | 1001 |
| 456 | Ga0373957_0008137 | 3300035120 | Bacteria | 3386 |
| 457 | Ga0373943_0000009 | 3300035170 | Bacteria | 67175 |
| 458 | Ga0373946_0003102 | 3300035171 | Bacteria | 5888 |
| 459 | Ga0373946_0277915 | 3300035171 | Unclassified | 823 |
| 460 | Ga0373955_0007748 | 3300035172 | Bacteria | 4947 |
| 461 | Ga0373924_0062920 | 3300035410 | Unclassified | 1555 |
| 462 | Ga0373935_0001716 | 3300035692 | Bacteria | 12271 |
| 463 | Ga0373935_0290796 | 3300035692 | Bacteria | 1153 |
| 464 | Ga0373927_0000539 | 3300035695 | Bacteria | 28719 |
| 465 | Ga0373927_0183464 | 3300035695 | Bacteria | 1373 |
| 466 | Ga0373933_0117306 | 3300035724 | Bacteria | 1664 |
| 467 | Ga0373933_0401360 | 3300035724 | Bacteria | 894 |
| 468 | Ga0373947_0002046 | 3300035725 | Bacteria | 12302 |
| 469 | Ga0373937_0070951 | 3300036401 | Bacteria | 3213 |
| 470 | Ga0373937_0277585 | 3300036401 | Bacteria | 1582 |
| 471 | Ga0373937_0413943 | 3300036401 | Unclassified | 1279 |
| 472 | Ga0373937_1149568 | 3300036401 | Bacteria | 725 |
| 473 | Ga0373925_0001274 | 3300037068 | Bacteria | 22247 |
| 474 | Ga0373925_0026898 | 3300037068 | Unclassified | 4212 |
| 475 | Ga0373925_0146207 | 3300037068 | Bacteria | 1853 |
| 476 | Ga0373925_1053402 | 3300037068 | Unclassified | 669 |
| 477 | Ga0436360_0105454 | 3300039438 | Unclassified | 746 |
| 478 | Ga0436360_1075001 | 3300039438 | Bacteria | 623 |
| 479 | Ga0436361_0434841 | 3300039447 | Unclassified | 535 |
| 480 | Ga0436362_1177367 | 3300039453 | Bacteria | 6689 |
| 481 | Ga0453683_0425474 | 3300044673 | Bacteria | 857 |
| 482 | Ga0466963_0076802 | 3300044694 | Bacteria | 2256 |
| 483 | Ga0466964_0290260 | 3300044706 | Unclassified | 821 |
| 484 | Ga0453684_1012298 | 3300044712 | Unclassified | 883 |
| 485 | Ga0466959_0002571 | 3300045049 | Bacteria | 11651 |
| 486 | Ga0466959_0907550 | 3300045049 | Unclassified | 588 |
| 487 | Ga0451576_0733048 | 3300045051 | Unclassified | 1038 |
| 488 | Ga0466967_0467208 | 3300045976 | Unclassified | 1235 |
| 489 | Ga0495603_0025471 | 3300046455 | Unclassified | 3578 |
| 490 | Ga0495629_0065411 | 3300046459 | Bacteria | 2538 |
| 491 | Ga0495629_0077451 | 3300046459 | Bacteria | 2321 |
| 492 | Ga0495629_0587236 | 3300046459 | Unclassified | 746 |
| 493 | Ga0495580_0001237 | 3300046472 | Bacteria | 22525 |
| 494 | Ga0495580_0003245 | 3300046472 | Bacteria | 13908 |
| 495 | Ga0495580_0014786 | 3300046472 | Bacteria | 5914 |
| 496 | Ga0495580_0021375 | 3300046472 | Bacteria | 4775 |
| 497 | Ga0495580_0041517 | 3300046472 | Bacteria | 3281 |
| 498 | Ga0495580_0050161 | 3300046472 | Bacteria | 2951 |
| 499 | Ga0495580_0077047 | 3300046472 | Bacteria | 2326 |
| 500 | Ga0495580_0458938 | 3300046472 | Bacteria | 854 |
| 501 | Ga0495582_0026810 | 3300046473 | Bacteria | 3158 |
| 502 | Ga0495582_0349379 | 3300046473 | Unclassified | 852 |
| 503 | Ga0495582_0650051 | 3300046473 | Bacteria | 610 |
| 504 | Ga0495639_0067979 | 3300046475 | Bacteria | 1642 |
| 505 | Ga0495664_0014988 | 3300046477 | Bacteria | 4401 |
| 506 | Ga0495664_0066801 | 3300046477 | Bacteria | 2145 |
| 507 | Ga0495664_0115237 | 3300046477 | Bacteria | 1624 |
| 508 | Ga0495608_0163243 | 3300046511 | Unclassified | 1416 |
| 509 | Ga0495630_0227859 | 3300046517 | Unclassified | 1423 |
| 510 | Ga0495630_0699364 | 3300046517 | Unclassified | 776 |
| 511 | Ga0495652_0437554 | 3300046529 | Unclassified | 918 |
| 512 | Ga0495652_0881575 | 3300046529 | Unclassified | 591 |
| 513 | Ga0495665_0037026 | 3300046531 | Unclassified | 2604 |
| 514 | Ga0495665_0088960 | 3300046531 | Bacteria | 1623 |
| 515 | Ga0495586_0371796 | 3300046535 | Unclassified | 822 |
| 516 | Ga0495586_0461053 | 3300046535 | Unclassified | 733 |
| 517 | Ga0495667_0287029 | 3300046559 | Unclassified | 1044 |
| 518 | Ga0495668_0515746 | 3300046616 | Bacteria | 659 |
| 519 | Ga0495635_0172917 | 3300046663 | Unclassified | 1469 |
| 520 | Ga0495635_0394975 | 3300046663 | Unclassified | 919 |
| 521 | Ga0495657_0269339 | 3300046675 | Unclassified | 1022 |
| 522 | Ga0495657_0309718 | 3300046675 | Bacteria | 940 |
| 523 | Ga0495657_0394050 | 3300046675 | Bacteria | 816 |
| 524 | Ga0495599_0068244 | 3300046678 | Bacteria | 2220 |
| 525 | Ga0495599_0232282 | 3300046678 | Unclassified | 1126 |
| 526 | Ga0495646_0141496 | 3300046680 | Unclassified | 1345 |
| 527 | Ga0495647_0213318 | 3300046681 | Unclassified | 850 |
| 528 | Ga0495658_0031119 | 3300046683 | Bacteria | 2904 |
| 529 | Ga0495669_0028174 | 3300046684 | Bacteria | 2459 |
| 530 | Ga0495669_0095019 | 3300046684 | Unclassified | 1380 |
| 531 | Ga0495624_0617558 | 3300046690 | Unclassified | 646 |
| 532 | Ga0495624_0641295 | 3300046690 | Unclassified | 632 |
| 533 | Ga0495600_0863131 | 3300046809 | Unclassified | 536 |
| 534 | Ga0495581_0104238 | 3300047315 | Bacteria | 1648 |
| 535 | Ga0495674_0002665 | 3300047319 | Bacteria | 17375 |
| 536 | Ga0495674_0051738 | 3300047319 | Unclassified | 3620 |
| 537 | Ga0495674_0082459 | 3300047319 | Bacteria | 2757 |
| 538 | Ga0495674_0979027 | 3300047319 | Unclassified | 649 |
| 539 | Ga0495676_0303748 | 3300047321 | Bacteria | 1076 |
| 540 | Ga0495680_0220513 | 3300047322 | Unclassified | 1354 |
| 541 | Ga0495684_0317018 | 3300047471 | Unclassified | 1116 |
| 542 | Ga0495593_0541224 | 3300047673 | Unclassified | 584 |
| 543 | Ga0495602_0379598 | 3300048088 | Unclassified | 1013 |
| 544 | Ga0496101_0287148 | 3300048904 | Unclassified | 1287 |
| 545 | Ga0496102_0234468 | 3300048905 | Unclassified | 1730 |
| 546 | Ga0496104_0058718 | 3300048907 | Bacteria | 3642 |
| 547 | Ga0496104_0999178 | 3300048907 | Unclassified | 741 |
| 548 | Ga0496105_0144510 | 3300048908 | Bacteria | 1957 |
| 549 | Ga0496105_0490360 | 3300048908 | Unclassified | 966 |
| 550 | Ga0496105_0499014 | 3300048908 | Unclassified | 956 |
| 551 | Ga0496106_0152915 | 3300048909 | Bacteria | 1821 |
| 552 | Ga0496106_0958538 | 3300048909 | Unclassified | 674 |
| 553 | Ga0496108_0000605 | 3300048911 | Bacteria | 28095 |
| 554 | Ga0496108_0259665 | 3300048911 | Unclassified | 1512 |
| 555 | Ga0496108_0389845 | 3300048911 | Unclassified | 1216 |
| 556 | Ga0496109_0000749 | 3300048912 | Bacteria | 27009 |
| 557 | Ga0496109_0026423 | 3300048912 | Bacteria | 5177 |
| 558 | Ga0496109_0282572 | 3300048912 | Unclassified | 1564 |
| 559 | Ga0496110_0001050 | 3300048913 | Bacteria | 19502 |
| 560 | Ga0496111_0009969 | 3300048914 | Bacteria | 6355 |
| 561 | Ga0496111_0363528 | 3300048914 | Unclassified | 1071 |
| 562 | Ga0496112_0001655 | 3300048915 | Bacteria | 17320 |
| 563 | Ga0496112_0575983 | 3300048915 | Unclassified | 1058 |
| 564 | Ga0496112_1506245 | 3300048915 | Unclassified | 586 |
| 565 | Ga0496113_0000468 | 3300048916 | Bacteria | 19787 |
| 566 | Ga0496113_0103173 | 3300048916 | Unclassified | 2212 |
| 567 | Ga0496113_0255495 | 3300048916 | Bacteria | 1399 |
| 568 | Ga0496114_0881984 | 3300048917 | Unclassified | 775 |
| 569 | Ga0496115_0057439 | 3300048918 | Unclassified | 3130 |
| 570 | Ga0501290_041103 | 3300049513 | Bacteria | 693 |
| 571 | Ga0501297_026448 | 3300049520 | Bacteria | 752 |
| 572 | Ga0501298_010063 | 3300049521 | Unclassified | 1620 |
| 573 | Ga0501299_068509 | 3300049522 | Bacteria | 765 |
| 574 | Ga0501235_109734 | 3300049669 | Bacteria | 681 |
| 575 | Ga0501259_046300 | 3300049688 | Bacteria | 871 |
| 576 | Ga0501225_0059416 | 3300049705 | Bacteria | 1074 |
| 577 | nmdc:mga08y16_622594_c1 | 3300050511 | Unclassified | 1086 |
| 578 | nmdc:mga0rr50_14918_c1 | 3300050513 | Bacteria | 5113 |
| 579 | nmdc:mga0rr50_1502540_c1 | 3300050513 | Unclassified | 569 |
| 580 | nmdc:mga0rr50_614018_c1 | 3300050513 | Unclassified | 927 |
| 581 | nmdc:mga0rr50_759084_c1 | 3300050513 | Bacteria | 828 |
| 582 | nmdc:mga08x19_215104_c1 | 3300050514 | Bacteria | 1320 |
| 583 | Ga0495612_0093460 | 3300053078 | Unclassified | 1276 |
| 584 | Ga0495619_0055687 | 3300053085 | Bacteria | 2620 |
| 585 | Ga0070699_100793074 | |||
| 586 | MBSR1b_contig_1520736 | |||
| 587 | JGI24737J22298_10022550 | |||
| 588 | JGI24743J22301_10003486 | |||
| 589 | JGI24749J21850_1060864 | |||
| 590 | JGI24033J26618_1012010 | |||
| 591 | JGI24034J26672_10000499 | |||
| 592 | JGI24751J29686_10029447 | |||
| 593 | Ga0058859_11757536 | |||
| 594 | Ga0065715_10139428 | |||
| 595 | Ga0065715_10185347 | |||
| 596 | Ga0065707_10558169 | |||
| 597 | Ga0070658_10320289 | |||
| 598 | Ga0070658_10575654 | |||
| 599 | Ga0070676_10025389 | |||
| 600 | Ga0070683_100005697 | |||
| 601 | Ga0070683_100334469 | |||
| 602 | Ga0070690_100095705 | |||
| 603 | Ga0070690_100368272 | |||
| 604 | Ga0070690_100629758 | |||
| 605 | Ga0070670_100014577 | |||
| 606 | Ga0070670_100208770 | |||
| 607 | Ga0070677_10008576 | |||
| 608 | Ga0070666_10971088 | |||
| 609 | Ga0070680_100162813 | |||
| 610 | Ga0070682_100064445 | |||
| 611 | Ga0070682_100183926 | |||
| 612 | Ga0068868_100256623 | |||
| 613 | Ga0068868_100846152 | |||
| 614 | Ga0070660_100006500 | |||
| 615 | Ga0070660_100024092 | |||
| 616 | Ga0070689_100091819 | |||
| 617 | Ga0070687_100012916 | |||
| 618 | Ga0070687_100928477 | |||
| 619 | Ga0070661_100067292 | |||
| 620 | Ga0070692_11384734 | |||
| 621 | Ga0070668_100014961 | |||
| 622 | Ga0070669_100013115 | |||
| 623 | Ga0070669_100139972 | |||
| 624 | Ga0070675_100055816 | |||
| 625 | Ga0070675_100621997 | |||
| 626 | Ga0070671_100116805 | |||
| 627 | Ga0070671_101085981 | |||
| 628 | Ga0070674_100476135 | |||
| 629 | Ga0070659_100003497 | |||
| 630 | Ga0070659_100120492 | |||
| 631 | Ga0070667_100018641 | |||
| 632 | Ga0070667_102205286 | |||
| 633 | Ga0070709_10002104 | |||
| 634 | Ga0070709_10006371 | |||
| 635 | Ga0070709_10101181 | |||
| 636 | Ga0070714_100000069 | |||
| 637 | Ga0070714_100009246 | |||
| 638 | Ga0070714_100119958 | |||
| 639 | Ga0070714_100198829 | |||
| 640 | Ga0070714_100276818 | |||
| 641 | Ga0070714_100396486 | |||
| 642 | Ga0070714_100429680 | |||
| 643 | Ga0070714_101503227 | |||
| 644 | Ga0070714_102087367 | |||
| 645 | Ga0070713_100000432 | |||
| 646 | Ga0070713_100001604 | |||
| 647 | Ga0070713_100025744 | |||
| 648 | Ga0070713_100115756 | |||
| 649 | Ga0070713_100180065 | |||
| 650 | Ga0070713_100259256 | |||
| 651 | Ga0070713_100338289 | |||
| 652 | Ga0070713_100569262 | |||
| 653 | Ga0070710_10032334 | |||
| 654 | Ga0070710_10095114 | |||
| 655 | Ga0070710_10239318 | |||
| 656 | Ga0070701_10035493 | |||
| 657 | Ga0070711_100000340 | |||
| 658 | Ga0070711_100039044 | |||
| 659 | Ga0070711_100069569 | |||
| 660 | Ga0070711_100412032 | |||
| 661 | Ga0070711_101056692 | |||
| 662 | Ga0070711_101474866 | |||
| 663 | Ga0070700_100235392 | |||
| 664 | Ga0070708_100012763 | |||
| 665 | Ga0070708_100041792 | |||
| 666 | Ga0070708_100073284 | |||
| 667 | Ga0070708_101489142 | |||
| 668 | Ga0070663_100132557 | |||
| 669 | Ga0070663_100154652 | |||
| 670 | Ga0070678_100001279 | |||
| 671 | Ga0070678_100325364 | |||
| 672 | Ga0070662_100072154 | |||
| 673 | Ga0070681_10015039 | |||
| 674 | Ga0070681_10137981 | |||
| 675 | Ga0070681_10316890 | |||
| 676 | Ga0070681_11067802 | |||
| 677 | Ga0070681_11406604 | |||
| 678 | Ga0070685_10006488 | |||
| 679 | Ga0070706_100010487 | |||
| 680 | Ga0070706_100069388 | |||
| 681 | Ga0070706_100071686 | |||
| 682 | Ga0070706_100135894 | |||
| 683 | Ga0070707_100006096 | |||
| 684 | Ga0070707_100009485 | |||
| 685 | Ga0070707_100092063 | |||
| 686 | Ga0070707_100124956 | |||
| 687 | Ga0070707_100193914 | |||
| 688 | Ga0070707_100249291 | |||
| 689 | Ga0070707_100379607 | |||
| 690 | Ga0070707_100849896 | |||
| 691 | Ga0070698_100030770 | |||
| 692 | Ga0070698_100064327 | |||
| 693 | Ga0070698_100166792 | |||
| 694 | Ga0070699_100001027 | |||
| 695 | Ga0070699_100008978 | |||
| 696 | Ga0070699_100644604 | |||
| 697 | Ga0070699_101352983 | |||
| 698 | Ga0070699_101354503 | |||
| 699 | Ga0070699_101821952 | |||
| 700 | Ga0070679_100306637 | |||
| 701 | Ga0070679_100356680 | |||
| 702 | Ga0070679_101054760 | |||
| 703 | Ga0070684_100008190 | |||
| 704 | Ga0070684_100058238 | |||
| 705 | Ga0070697_100005514 | |||
| 706 | Ga0070697_100038998 | |||
| 707 | Ga0070697_100415627 | |||
| 708 | Ga0070697_100703548 | |||
| 709 | Ga0070697_100905908 | |||
| 710 | Ga0068853_100007763 | |||
| 711 | Ga0068853_100030992 | |||
| 712 | Ga0068853_101225314 | |||
| 713 | Ga0070672_100106557 | |||
| 714 | Ga0070686_100278841 | |||
| 715 | Ga0070686_100379598 | |||
| 716 | Ga0070695_101241229 | |||
| 717 | Ga0070693_100059055 | |||
| 718 | Ga0068855_100029998 | |||
| 719 | Ga0068855_100444416 | |||
| 720 | Ga0068855_100467719 | |||
| 721 | Ga0068855_100830688 | |||
| 722 | Ga0070664_100453641 | |||
| 723 | Ga0068857_100149834 | |||
| 724 | Ga0068857_100833958 | |||
| 725 | Ga0068857_102299117 | |||
| 726 | Ga0068854_100147293 | |||
| 727 | Ga0068854_100676058 | |||
| 728 | Ga0068854_101015950 | |||
| 729 | Ga0068856_100002427 | |||
| 730 | Ga0068856_100040140 | |||
| 731 | Ga0068856_100293226 | |||
| 732 | Ga0068856_100343659 | |||
| 733 | Ga0070702_100599296 | |||
| 734 | Ga0068852_100033406 | |||
| 735 | Ga0068852_100198010 | |||
| 736 | Ga0068859_100108769 | |||
| 737 | Ga0068864_100117827 | |||
| 738 | Ga0068864_101587147 | |||
| 739 | Ga0068866_10004876 | |||
| 740 | Ga0068861_102532556 | |||
| 741 | Ga0068851_10038726 | |||
| 742 | Ga0068851_10576531 | |||
| 743 | Ga0068870_10047043 | |||
| 744 | Ga0068863_100019063 | |||
| 745 | Ga0068863_100184095 | |||
| 746 | Ga0068863_100236045 | |||
| 747 | Ga0068858_100022316 | |||
| 748 | Ga0068860_100103788 | |||
| 749 | Ga0068862_100028772 | |||
| 750 | Ga0068862_100856742 | |||
| 751 | Ga0070717_10000535 | |||
| 752 | Ga0070717_10000774 | |||
| 753 | Ga0070717_10005116 | |||
| 754 | Ga0070717_10252821 | |||
| 755 | Ga0070717_10317015 | |||
| 756 | Ga0070717_10389735 | |||
| 757 | Ga0070717_10427178 | |||
| 758 | Ga0070717_10584174 | |||
| 759 | Ga0070717_10933422 | |||
| 760 | Ga0070715_10019671 | |||
| 761 | Ga0070715_10057614 | |||
| 762 | Ga0070716_100000792 | |||
| 763 | Ga0070716_100003222 | |||
| 764 | Ga0070716_100100104 | |||
| 765 | Ga0070716_100123893 | |||
| 766 | Ga0070716_100155662 | |||
| 767 | Ga0070716_100328294 | |||
| 768 | Ga0070716_100367081 | |||
| 769 | Ga0070716_100490504 | |||
| 770 | Ga0070716_100832908 | |||
| 771 | Ga0070716_101117709 | |||
| 772 | Ga0070712_100033521 | |||
| 773 | Ga0070712_100084987 | |||
| 774 | Ga0070712_100098909 | |||
| 775 | Ga0070712_100125793 | |||
| 776 | Ga0070712_100844784 | |||
| 777 | Ga0097621_100130082 | |||
| 778 | Ga0068871_100326392 | |||
| 779 | Ga0068871_100664804 | |||
| 780 | Ga0068871_100723521 | |||
| 781 | Ga0068865_100328457 | |||
| 782 | Ga0075436_100003704 | |||
| 783 | Ga0075436_100064446 | |||
| 784 | Ga0075436_100132702 | |||
| 785 | Ga0097620_100108769 | |||
| 786 | Ga0075435_100506761 | |||
| 787 | Ga0075435_100784378 | |||
| 788 | Ga0099794_10418028 | |||
| 789 | Ga0105250_10011456 | |||
| 790 | Ga0105240_10023269 | |||
| 791 | Ga0105240_10106765 | |||
| 792 | Ga0105240_10502575 | |||
| 793 | Ga0105240_10752005 | |||
| 794 | Ga0111539_10439828 | |||
| 795 | Ga0105245_10006526 | |||
| 796 | Ga0105245_10131233 | |||
| 797 | Ga0105247_10009888 | |||
| 798 | Ga0105241_10005799 | |||
| 799 | Ga0105241_10163316 | |||
| 800 | Ga0105241_10351316 | |||
| 801 | Ga0105241_11752262 | |||
| 802 | Ga0105242_10039444 | |||
| 803 | Ga0105248_10158545 | |||
| 804 | Ga0105248_10891987 | |||
| 805 | Ga0105237_10101184 | |||
| 806 | Ga0105238_10132724 | |||
| 807 | Ga0105238_10515169 | |||
| 808 | Ga0105238_10690566 | |||
| 809 | Ga0105249_10045464 | |||
| 810 | Ga0105249_10058017 | |||
| 811 | Ga0105239_10007204 | |||
| 812 | Ga0105239_10193424 | |||
| 813 | Ga0105239_10400412 | |||
| 814 | Ga0105239_10549897 | |||
| 815 | Ga0105239_11902513 | |||
| 816 | Ga0105246_10008559 | |||
| 817 | Ga0157373_10004453 | |||
| 818 | Ga0157373_10021421 | |||
| 819 | Ga0157371_10121856 | |||
| 820 | Ga0157370_10221475 | |||
| 821 | Ga0157370_10320992 | |||
| 822 | Ga0157369_10038570 | |||
| 823 | Ga0157369_10531212 | |||
| 824 | Ga0157369_10686189 | |||
| 825 | Ga0157374_10046865 | |||
| 826 | Ga0157374_10052978 | |||
| 827 | Ga0157374_10592784 | |||
| 828 | Ga0157378_10870689 | |||
| 829 | Ga0163162_10028765 | |||
| 830 | Ga0163162_10061087 | |||
| 831 | Ga0157372_10012309 | |||
| 832 | Ga0157372_10196987 | |||
| 833 | Ga0157372_10942616 | |||
| 834 | Ga0157372_11300318 | |||
| 835 | Ga0157375_10018772 | |||
| 836 | Ga0157375_10731394 | |||
| 837 | Ga0163163_10006167 | |||
| 838 | Ga0163163_10008354 | |||
| 839 | Ga0163163_10030385 | |||
| 840 | Ga0163163_10089698 | |||
| 841 | Ga0163163_10438906 | |||
| 842 | Ga0163163_10670480 | |||
| 843 | Ga0157380_10102355 | |||
| 844 | Ga0182008_10015208 | |||
| 845 | Ga0182008_10213825 | |||
| 846 | Ga0157377_10000586 | |||
| 847 | Ga0157377_10306086 | |||
| 848 | Ga0157379_10006714 | |||
| 849 | Ga0157379_10973366 | |||
| 850 | Ga0157376_10013454 | |||
| 851 | Ga0157376_10349109 | |||
| 852 | Ga0157376_10365881 | |||
| 853 | Ga0182006_1031108 | |||
| 854 | Ga0182007_10005454 | |||
| 855 | Ga0182005_1029281 | |||
| 856 | Ga0182005_1044810 | |||
| 857 | Ga0163161_10001547 | |||
| 858 | Ga0224572_1075237 | |||
| 859 | Ga0207656_10124430 | |||
| 860 | Ga0207656_10135191 | |||
| 861 | Ga0207682_10016930 | |||
| 862 | Ga0207692_10064522 | |||
| 863 | Ga0207692_10065092 | |||
| 864 | Ga0207692_10147019 | |||
| 865 | Ga0207642_10049378 | |||
| 866 | Ga0207710_10018798 | |||
| 867 | Ga0207688_10012221 | |||
| 868 | Ga0207680_10504031 | |||
| 869 | Ga0207647_10003396 | |||
| 870 | Ga0207685_10021556 | |||
| 871 | Ga0207685_10044952 | |||
| 872 | Ga0207699_10034920 | |||
| 873 | Ga0207699_10037774 | |||
| 874 | Ga0207699_10038036 | |||
| 875 | Ga0207699_10053062 | |||
| 876 | Ga0207699_10120381 | |||
| 877 | Ga0207699_10298717 | |||
| 878 | Ga0207699_10304448 | |||
| 879 | Ga0207645_10000551 | |||
| 880 | Ga0207643_10005881 | |||
| 881 | Ga0207705_10957682 | |||
| 882 | Ga0207684_10002771 | |||
| 883 | Ga0207684_10049869 | |||
| 884 | Ga0207684_10059551 | |||
| 885 | Ga0207684_10099131 | |||
| 886 | Ga0207654_10063715 | |||
| 887 | Ga0207654_11331277 | |||
| 888 | Ga0207707_10265712 | |||
| 889 | Ga0207707_11104211 | |||
| 890 | Ga0207695_10026809 | |||
| 891 | Ga0207695_10067791 | |||
| 892 | Ga0207693_10000010 | |||
| 893 | Ga0207693_10002941 | |||
| 894 | Ga0207693_10043654 | |||
| 895 | Ga0207693_10055653 | |||
| 896 | Ga0207693_10161959 | |||
| 897 | Ga0207663_10000541 | |||
| 898 | Ga0207663_10065744 | |||
| 899 | Ga0207663_10249981 | |||
| 900 | Ga0207662_10000359 | |||
| 901 | Ga0207657_10006439 | |||
| 902 | Ga0207657_10330060 | |||
| 903 | Ga0207649_10000546 | |||
| 904 | Ga0207649_10065665 | |||
| 905 | Ga0207652_10562188 | |||
| 906 | Ga0207646_10010353 | |||
| 907 | Ga0207646_10078909 | |||
| 908 | Ga0207646_10131111 | |||
| 909 | Ga0207646_10131355 | |||
| 910 | Ga0207646_10134841 | |||
| 911 | Ga0207646_10173488 | |||
| 912 | Ga0207681_10123919 | |||
| 913 | Ga0207681_10466426 | |||
| 914 | Ga0207694_10694841 | |||
| 915 | Ga0207694_11126135 | |||
| 916 | Ga0207650_10000045 | |||
| 917 | Ga0207650_10894898 | |||
| 918 | Ga0207659_10866935 | |||
| 919 | Ga0207687_10472409 | |||
| 920 | Ga0207687_10739471 | |||
| 921 | Ga0207700_10005755 | |||
| 922 | Ga0207700_10047164 | |||
| 923 | Ga0207700_10061696 | |||
| 924 | Ga0207700_10157117 | |||
| 925 | Ga0207700_10338021 | |||
| 926 | Ga0207700_10694849 | |||
| 927 | Ga0207700_10772156 | |||
| 928 | Ga0207664_10000084 | |||
| 929 | Ga0207664_10002513 | |||
| 930 | Ga0207664_10053970 | |||
| 931 | Ga0207664_10368861 | |||
| 932 | Ga0207664_10487527 | |||
| 933 | Ga0207644_10018085 | |||
| 934 | Ga0207690_10150412 | |||
| 935 | Ga0207690_10216747 | |||
| 936 | Ga0207690_11073472 | |||
| 937 | Ga0207706_10001085 | |||
| 938 | Ga0207706_10015387 | |||
| 939 | Ga0207686_11622488 | |||
| 940 | Ga0207670_10290299 | |||
| 941 | Ga0207669_10605012 | |||
| 942 | Ga0207704_10828483 | |||
| 943 | Ga0207665_10001046 | |||
| 944 | Ga0207665_10081748 | |||
| 945 | Ga0207665_10278571 | |||
| 946 | Ga0207665_10301797 | |||
| 947 | Ga0207665_11041111 | |||
| 948 | Ga0207691_10001782 | |||
| 949 | Ga0207689_10001473 | |||
| 950 | Ga0207661_10000131 | |||
| 951 | Ga0207661_10193847 | |||
| 952 | Ga0207679_10000283 | |||
| 953 | Ga0207667_10356049 | |||
| 954 | Ga0207667_10415444 | |||
| 955 | Ga0207667_10683862 | |||
| 956 | Ga0207651_10009810 | |||
| 957 | Ga0207712_10030789 | |||
| 958 | Ga0207668_11562406 | |||
| 959 | Ga0207640_10502092 | |||
| 960 | Ga0207658_10158695 | |||
| 961 | Ga0207658_10634869 | |||
| 962 | Ga0207677_10198917 | |||
| 963 | Ga0207677_10649161 | |||
| 964 | Ga0207703_10045185 | |||
| 965 | Ga0207639_10265446 | |||
| 966 | Ga0207639_10595449 | |||
| 967 | Ga0207678_10001378 | |||
| 968 | Ga0207678_10232501 | |||
| 969 | Ga0207702_10050684 | |||
| 970 | Ga0207702_10108385 | |||
| 971 | Ga0207702_10279068 | |||
| 972 | Ga0207702_10586264 | |||
| 973 | Ga0207641_10000021 | |||
| 974 | Ga0207641_10196731 | |||
| 975 | Ga0207641_10676539 | |||
| 976 | Ga0207641_10906849 | |||
| 977 | Ga0207648_10000611 | |||
| 978 | Ga0207676_10000096 | |||
| 979 | Ga0207674_10000246 | |||
| 980 | Ga0207674_10060331 | |||
| 981 | Ga0207674_11310567 | |||
| 982 | Ga0207675_100070698 | |||
| 983 | Ga0207683_10001457 | |||
| 984 | Ga0207683_10267748 | |||
| 985 | Ga0207698_10573319 | |||
| 986 | Ga0207698_10978216 | |||
| 987 | Ga0268266_10005064 | |||
| 988 | Ga0268265_10003076 | |||
| 989 | Ga0268264_10047549 | |||
| 990 | Ga0268264_10084962 | |||
| 991 | Ga0268264_10325319 | |||
| 992 | Ga0265338_10014641 | |||
| 993 | Ga0265338_10170877 | |||
| 994 | Ga0265338_10175413 | |||
| 995 | Ga0265338_10227177 | |||
| 996 | Ga0265338_10604582 | |||
| 997 | Ga0265760_10009710 | |||
| 998 | Ga0265760_10064166 | |||
| 999 | Ga0265330_10374219 | |||
| 1000 | Ga0265332_10196762 | |||
| 1001 | Ga0265328_10011628 | |||
| 1002 | Ga0265328_10040444 | |||
| 1003 | Ga0265325_10007751 | |||
| 1004 | Ga0265325_10009917 | |||
| 1005 | Ga0265325_10031869 | |||
| 1006 | Ga0265325_10052024 | |||
| 1007 | Ga0265325_10078570 | |||
| 1008 | Ga0265329_10092353 | |||
| 1009 | Ga0265340_10002683 | |||
| 1010 | Ga0265340_10007178 | |||
| 1011 | Ga0265340_10039294 | |||
| 1012 | Ga0265339_10015912 | |||
| 1013 | Ga0265339_10197445 | |||
| 1014 | Ga0265339_10358553 | |||
| 1015 | Ga0265339_10513629 | |||
| 1016 | Ga0265331_10017081 | |||
| 1017 | Ga0265316_10001005 | |||
| 1018 | Ga0265316_10029140 | |||
| 1019 | Ga0265316_10041370 | |||
| 1020 | Ga0265316_10072399 | |||
| 1021 | Ga0265313_10013056 | |||
| 1022 | Ga0265313_10075770 | |||
| 1023 | Ga0265314_10081206 | |||
| 1024 | Ga0265314_10105524 | |||
| 1025 | Ga0265314_10364258 | |||
| 1026 | Ga0265342_10043479 | |||
| 1027 | Ga0316214_1005815 | |||
| 1028 | Ga0373926_0019860 | |||
| 1029 | Ga0373926_0326391 | |||
| 1030 | Ga0373934_0006504 | |||
| 1031 | Ga0373944_0060904 | |||
| 1032 | Ga0373923_0007452 | |||
| 1033 | Ga0373923_0108618 | |||
| 1034 | Ga0373936_0004722 | |||
| 1035 | Ga0373945_0004249 | |||
| 1036 | Ga0373945_0234865 | |||
| 1037 | Ga0373953_0032634 | |||
| 1038 | Ga0373954_0026687 | |||
| 1039 | Ga0373956_0179157 | |||
| 1040 | Ga0373957_0008137 | |||
| 1041 | Ga0373943_0000009 | |||
| 1042 | Ga0373946_0003102 | |||
| 1043 | Ga0373946_0277915 | |||
| 1044 | Ga0373955_0007748 | |||
| 1045 | Ga0373924_0062920 | |||
| 1046 | Ga0373935_0001716 | |||
| 1047 | Ga0373935_0290796 | |||
| 1048 | Ga0373927_0000539 | |||
| 1049 | Ga0373927_0183464 | |||
| 1050 | Ga0373933_0117306 | |||
| 1051 | Ga0373933_0401360 | |||
| 1052 | Ga0373947_0002046 | |||
| 1053 | Ga0373937_0070951 | |||
| 1054 | Ga0373937_0277585 | |||
| 1055 | Ga0373937_0413943 | |||
| 1056 | Ga0373937_1149568 | |||
| 1057 | Ga0373925_0001274 | |||
| 1058 | Ga0373925_0026898 | |||
| 1059 | Ga0373925_0146207 | |||
| 1060 | Ga0373925_1053402 | |||
| 1061 | Ga0436360_0105454 | |||
| 1062 | Ga0436360_1075001 | |||
| 1063 | Ga0436361_0434841 | |||
| 1064 | Ga0436362_1177367 | |||
| 1065 | Ga0453683_0425474 | |||
| 1066 | Ga0466963_0076802 | |||
| 1067 | Ga0466964_0290260 | |||
| 1068 | Ga0453684_1012298 | |||
| 1069 | Ga0466959_0002571 | |||
| 1070 | Ga0466959_0907550 | |||
| 1071 | Ga0451576_0733048 | |||
| 1072 | Ga0466967_0467208 | |||
| 1073 | Ga0495603_0025471 | |||
| 1074 | Ga0495629_0065411 | |||
| 1075 | Ga0495629_0077451 | |||
| 1076 | Ga0495629_0587236 | |||
| 1077 | Ga0495580_0001237 | |||
| 1078 | Ga0495580_0003245 | |||
| 1079 | Ga0495580_0014786 | |||
| 1080 | Ga0495580_0021375 | |||
| 1081 | Ga0495580_0041517 | |||
| 1082 | Ga0495580_0050161 | |||
| 1083 | Ga0495580_0077047 | |||
| 1084 | Ga0495580_0458938 | |||
| 1085 | Ga0495582_0026810 | |||
| 1086 | Ga0495582_0349379 | |||
| 1087 | Ga0495582_0650051 | |||
| 1088 | Ga0495639_0067979 | |||
| 1089 | Ga0495664_0014988 | |||
| 1090 | Ga0495664_0066801 | |||
| 1091 | Ga0495664_0115237 | |||
| 1092 | Ga0495608_0163243 | |||
| 1093 | Ga0495630_0227859 | |||
| 1094 | Ga0495630_0699364 | |||
| 1095 | Ga0495652_0437554 | |||
| 1096 | Ga0495652_0881575 | |||
| 1097 | Ga0495665_0037026 | |||
| 1098 | Ga0495665_0088960 | |||
| 1099 | Ga0495586_0371796 | |||
| 1100 | Ga0495586_0461053 | |||
| 1101 | Ga0495667_0287029 | |||
| 1102 | Ga0495668_0515746 | |||
| 1103 | Ga0495635_0172917 | |||
| 1104 | Ga0495635_0394975 | |||
| 1105 | Ga0495657_0269339 | |||
| 1106 | Ga0495657_0309718 | |||
| 1107 | Ga0495657_0394050 | |||
| 1108 | Ga0495599_0068244 | |||
| 1109 | Ga0495599_0232282 | |||
| 1110 | Ga0495646_0141496 | |||
| 1111 | Ga0495647_0213318 | |||
| 1112 | Ga0495658_0031119 | |||
| 1113 | Ga0495669_0028174 | |||
| 1114 | Ga0495669_0095019 | |||
| 1115 | Ga0495624_0617558 | |||
| 1116 | Ga0495624_0641295 | |||
| 1117 | Ga0495600_0863131 | |||
| 1118 | Ga0495581_0104238 | |||
| 1119 | Ga0495674_0002665 | |||
| 1120 | Ga0495674_0051738 | |||
| 1121 | Ga0495674_0082459 | |||
| 1122 | Ga0495674_0979027 | |||
| 1123 | Ga0495676_0303748 | |||
| 1124 | Ga0495680_0220513 | |||
| 1125 | Ga0495684_0317018 | |||
| 1126 | Ga0495593_0541224 | |||
| 1127 | Ga0495602_0379598 | |||
| 1128 | Ga0496101_0287148 | |||
| 1129 | Ga0496102_0234468 | |||
| 1130 | Ga0496104_0058718 | |||
| 1131 | Ga0496104_0999178 | |||
| 1132 | Ga0496105_0144510 | |||
| 1133 | Ga0496105_0490360 | |||
| 1134 | Ga0496105_0499014 | |||
| 1135 | Ga0496106_0152915 | |||
| 1136 | Ga0496106_0958538 | |||
| 1137 | Ga0496108_0000605 | |||
| 1138 | Ga0496108_0259665 | |||
| 1139 | Ga0496108_0389845 | |||
| 1140 | Ga0496109_0000749 | |||
| 1141 | Ga0496109_0026423 | |||
| 1142 | Ga0496109_0282572 | |||
| 1143 | Ga0496110_0001050 | |||
| 1144 | Ga0496111_0009969 | |||
| 1145 | Ga0496111_0363528 | |||
| 1146 | Ga0496112_0001655 | |||
| 1147 | Ga0496112_0575983 | |||
| 1148 | Ga0496112_1506245 | |||
| 1149 | Ga0496113_0000468 | |||
| 1150 | Ga0496113_0103173 | |||
| 1151 | Ga0496113_0255495 | |||
| 1152 | Ga0496114_0881984 | |||
| 1153 | Ga0496115_0057439 | |||
| 1154 | Ga0501290_041103 | |||
| 1155 | Ga0501297_026448 | |||
| 1156 | Ga0501298_010063 | |||
| 1157 | Ga0501299_068509 | |||
| 1158 | Ga0501235_109734 | |||
| 1159 | Ga0501259_046300 | |||
| 1160 | Ga0501225_0059416 | |||
| 1161 | nmdc:mga08y16_622594_c1 | |||
| 1162 | nmdc:mga0rr50_14918_c1 | |||
| 1163 | nmdc:mga0rr50_1502540_c1 | |||
| 1164 | nmdc:mga0rr50_614018_c1 | |||
| 1165 | nmdc:mga0rr50_759084_c1 | |||
| 1166 | nmdc:mga08x19_215104_c1 | |||
| 1167 | Ga0495612_0093460 | |||
| 1168 | Ga0495619_0055687 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ml8-assembly1.cif.gz_A-2 | structural genomics | 0.9028 | 3 | 132 |
| 1ml8-assembly1.cif.gz_A-2 | structural genomics | 0.8897 | 3 | 132 |
| 2e8c-assembly1.cif.gz_A | crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 | 0.8883 | 1 | 133 |
| 1lql-assembly4.cif.gz_G | crystal structure of osmc like protein from mycoplasma pneumoniae | 0.888 | 1 | 131 |
| 2pn2-assembly1.cif.gz_A-2 | crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution | 0.878 | 4 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2egtA02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9217 | 36 | 133 | 3.30.300.20 |
| 2e8fA00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8981 | 1 | 133 | 3.30.300.20 |
| 2egtA02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8951 | 36 | 133 | 3.30.300.20 |
| 1ml8A01 | Mainly Beta;Single Sheet;N-terminal domain of TfIIb; | 0.8877 | 3 | 34 | 2.20.25.10 |
| 1ml8A02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8866 | 36 | 132 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9KAK9-F1-model_v4 | Osmotically inducible protein OsmC | 0.9921 | 42 | 131 |
|
| AF-A0A321LZJ6-F1-model_v4 | Osmotically inducible protein OsmC | 0.9916 | 24 | 132 |
|
| AF-A0A2V9W1K5-F1-model_v4 | Osmotically inducible protein OsmC | 0.99 | 1 | 133 |
|
| AF-A0A4R1LA32-F1-model_v4 | Putative redox protein | 0.9896 | 3 | 132 |
|
| AF-A0A7C5CIB6-F1-model_v4 | OsmC family peroxiredoxin | 0.9889 | 39 | 131 |
|