F466330

General Info

Members Datasets Scaffolds Average Seq Length
584 257 1168 307

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10222509|Ga0065715_102225091
Length 353
Sequence VGKKILCQVPKHLSLVRTSRHHYLAARPAERLAPIPCAQAEMLINLLPDFFAVLNSTDRVAAYLRYFETHRRLLEAYWHNYVLDPDGPHFRDVVQLAALADRSDLRAMLERTXVVSLARSTSEQCSALLEYDTDVDVVLMVGVGAANAGELVVDGRGVAFVCLEHFTSVANPETQGLGLEPELIPLWLAHEITHAVRYTSPRSRSEIRRLVEEANGYYSYWETGRRASLRELLINEGLAVQTSRVISPGHAAWEYFGYGRRQYARIRELEPVIARAAADDLTRTGLGLRLRYLSGGMSDEARTIERYVMPERSGYYLGARMTDAAFSTRGAEWAVRASAAEISAIAEAAAATA

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
199 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
200 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
201 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.86
Rhizosphere 98.97
Stem 0
Stem Tuber 0
Unclassified 17.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10222509 3300005293 Bacteria 1266
2 JGI25406J46586_10005561 3300003203 Bacteria 5837
3 Ga0058863_11959698 3300004799 Unclassified 2212
4 Ga0065707_10002735 3300005295 Bacteria 7539
5 Ga0070658_10012203 3300005327 Bacteria 6896
6 Ga0070658_10136910 3300005327 Bacteria 2044
7 Ga0070676_10001660 3300005328 Bacteria 11321
8 Ga0070676_10001813 3300005328 Bacteria 10866
9 Ga0070676_10025430 3300005328 Bacteria 3347
10 Ga0070676_10033807 3300005328 Bacteria 2933
11 Ga0070676_10075776 3300005328 Unclassified 2029
12 Ga0070683_100000227 3300005329 Bacteria 38287
13 Ga0070683_100004776 3300005329 Bacteria 11217
14 Ga0070683_100065975 3300005329 Bacteria 3371
15 Ga0070690_100013501 3300005330 Bacteria 4829
16 Ga0070690_100078402 3300005330 Unclassified 2158
17 Ga0070690_100127846 3300005330 Bacteria 1713
18 Ga0070670_100006827 3300005331 Bacteria 9669
19 Ga0070670_100007378 3300005331 Bacteria 9338
20 Ga0068869_100002978 3300005334 Bacteria 10287
21 Ga0068869_100016591 3300005334 Bacteria 4966
22 Ga0070680_100005463 3300005336 Bacteria 9621
23 Ga0070680_100006068 3300005336 Bacteria 9148
24 Ga0070680_100008136 3300005336 Bacteria 8012
25 Ga0070680_100011646 3300005336 Bacteria 6815
26 Ga0070680_100035656 3300005336 Bacteria 4017
27 Ga0070680_100044495 3300005336 Bacteria 3607
28 Ga0070680_100142226 3300005336 Unclassified 2012
29 Ga0070682_100000225 3300005337 Bacteria 40888
30 Ga0068868_100001416 3300005338 Bacteria 16529
31 Ga0068868_100002537 3300005338 Bacteria 12684
32 Ga0068868_100006559 3300005338 Bacteria 8243
33 Ga0068868_100049589 3300005338 Bacteria 3295
34 Ga0070660_100003535 3300005339 Bacteria 10780
35 Ga0070660_100186389 3300005339 Bacteria 1680
36 Ga0070689_100035613 3300005340 Unclassified 3804
37 Ga0070689_100081006 3300005340 Unclassified 2548
38 Ga0070689_100113177 3300005340 Bacteria 2161
39 Ga0070689_100254677 3300005340 Archaea 1449
40 Ga0070689_100294673 3300005340 Bacteria 1349
41 Ga0070691_10008820 3300005341 Unclassified 4615
42 Ga0070691_10138329 3300005341 Bacteria 1239
43 Ga0070687_100025434 3300005343 Bacteria 2840
44 Ga0070687_100139270 3300005343 Unclassified 1411
45 Ga0070661_100001132 3300005344 Bacteria 18735
46 Ga0070661_100002845 3300005344 Bacteria 11890
47 Ga0070692_10044639 3300005345 Unclassified 2284
48 Ga0070668_100003158 3300005347 Bacteria 12137
49 Ga0070668_100010798 3300005347 Bacteria 6794
50 Ga0070668_100011204 3300005347 Bacteria 6676
51 Ga0070669_100001937 3300005353 Bacteria 14938
52 Ga0070669_100043040 3300005353 Bacteria 3287
53 Ga0070669_100162826 3300005353 Bacteria 1735
54 Ga0070675_100001276 3300005354 Bacteria 18403
55 Ga0070675_100004030 3300005354 Bacteria 11149
56 Ga0070675_100026600 3300005354 Bacteria 4644
57 Ga0070675_100410629 3300005354 Unclassified 1209
58 Ga0070671_100114716 3300005355 Bacteria 2264
59 Ga0070671_100154723 3300005355 Bacteria 1937
60 Ga0070674_100003816 3300005356 Bacteria 8522
61 Ga0070674_100048261 3300005356 Unclassified 2921
62 Ga0070673_100074782 3300005364 Bacteria 2731
63 Ga0070673_100100399 3300005364 Archaea 2382
64 Ga0070673_100148508 3300005364 Unclassified 1983
65 Ga0070688_100108719 3300005365 Unclassified 1840
66 Ga0070659_100012211 3300005366 Bacteria 6366
67 Ga0070659_100051898 3300005366 Bacteria 3225
68 Ga0070659_100187109 3300005366 Unclassified 1701
69 Ga0070659_100452313 3300005366 Unclassified 1089
70 Ga0070667_100012691 3300005367 Bacteria 6965
71 Ga0070667_100023979 3300005367 Bacteria 5066
72 Ga0070667_100055270 3300005367 Bacteria 3353
73 Ga0070709_10001385 3300005434 Bacteria 13192
74 Ga0070709_10015007 3300005434 Bacteria 4397
75 Ga0070701_10077549 3300005438 Unclassified 1791
76 Ga0070711_100120862 3300005439 Unclassified 1937
77 Ga0070711_100153220 3300005439 Unclassified 1740
78 Ga0070700_100005071 3300005441 Bacteria 6944
79 Ga0070700_100005981 3300005441 Bacteria 6469
80 Ga0070694_100114138 3300005444 Bacteria 1928
81 Ga0070663_100096123 3300005455 Bacteria 2203
82 Ga0070663_100279369 3300005455 Unclassified 1330
83 Ga0070678_100045025 3300005456 Bacteria 3155
84 Ga0070678_100116801 3300005456 Bacteria 2097
85 Ga0070678_100272441 3300005456 Unclassified 1428
86 Ga0070662_100000245 3300005457 Bacteria 32051
87 Ga0070662_100000509 3300005457 Bacteria 23347
88 Ga0070662_100005036 3300005457 Bacteria 8407
89 Ga0070662_100068671 3300005457 Bacteria 2606
90 Ga0070662_100129834 3300005457 Bacteria 1941
91 Ga0070662_100336754 3300005457 Unclassified 1233
92 Ga0070681_10001039 3300005458 Bacteria 23576
93 Ga0070681_10001894 3300005458 Bacteria 18882
94 Ga0070681_10015856 3300005458 Bacteria 7512
95 Ga0070681_10149221 3300005458 Unclassified 2265
96 Ga0068867_100004982 3300005459 Bacteria 9358
97 Ga0068867_100016262 3300005459 Bacteria 5284
98 Ga0068867_100019345 3300005459 Bacteria 4853
99 Ga0068867_100035851 3300005459 Unclassified 3599
100 Ga0068867_100132420 3300005459 Bacteria 1939
101 Ga0070685_10051843 3300005466 Unclassified 2373
102 Ga0070706_100089277 3300005467 Unclassified 2858
103 Ga0070699_100005005 3300005518 Bacteria 11681
104 Ga0070699_100068724 3300005518 Bacteria 3078
105 Ga0070699_100096010 3300005518 Bacteria 2596
106 Ga0070699_100220630 3300005518 Bacteria 1689
107 Ga0070679_100000080 3300005530 Bacteria 72275
108 Ga0070679_100003526 3300005530 Bacteria 14326
109 Ga0070679_100005218 3300005530 Bacteria 12024
110 Ga0070679_100050969 3300005530 Bacteria 4123
111 Ga0070679_100058867 3300005530 Bacteria 3829
112 Ga0070679_100394075 3300005530 Unclassified 1331
113 Ga0070684_100009580 3300005535 Bacteria 7631
114 Ga0070684_100033167 3300005535 Unclassified 4406
115 Ga0070684_100039431 3300005535 Bacteria 4063
116 Ga0070684_100089070 3300005535 Bacteria 2743
117 Ga0070684_100093945 3300005535 Bacteria 2671
118 Ga0070684_100096143 3300005535 Unclassified 2640
119 Ga0070684_100115023 3300005535 Unclassified 2415
120 Ga0070684_100232762 3300005535 Unclassified 1682
121 Ga0070697_100014001 3300005536 Bacteria 6298
122 Ga0068853_100020380 3300005539 Bacteria 5513
123 Ga0068853_100057710 3300005539 Bacteria 3350
124 Ga0070672_100007284 3300005543 Bacteria 7497
125 Ga0070672_100017649 3300005543 Bacteria 5141
126 Ga0070672_100046206 3300005543 Bacteria 3373
127 Ga0070686_100001202 3300005544 Bacteria 14758
128 Ga0070686_100018268 3300005544 Bacteria 4112
129 Ga0070695_100041896 3300005545 Bacteria 2904
130 Ga0070696_100000415 3300005546 Bacteria 26640
131 Ga0070696_100198854 3300005546 Unclassified 1495
132 Ga0070696_100267938 3300005546 Bacteria 1298
133 Ga0070693_100003287 3300005547 Bacteria 7511
134 Ga0070693_100070288 3300005547 Bacteria 2059
135 Ga0070693_100072674 3300005547 Bacteria 2029
136 Ga0070665_100020418 3300005548 Bacteria 6654
137 Ga0070704_100004244 3300005549 Bacteria 8281
138 Ga0068855_100018975 3300005563 Bacteria 8269
139 Ga0068855_100026644 3300005563 Bacteria 6917
140 Ga0068855_100040853 3300005563 Bacteria 5501
141 Ga0068855_100049761 3300005563 Bacteria 4942
142 Ga0068855_100356315 3300005563 Bacteria 1611
143 Ga0070664_100016181 3300005564 Bacteria 6112
144 Ga0070664_100025341 3300005564 Bacteria 4915
145 Ga0070664_100080607 3300005564 Unclassified 2804
146 Ga0070664_100087861 3300005564 Bacteria 2688
147 Ga0070664_100167149 3300005564 Bacteria 1949
148 Ga0070664_100268032 3300005564 Unclassified 1538
149 Ga0068857_100001422 3300005577 Bacteria 18943
150 Ga0068857_100007013 3300005577 Bacteria 9697
151 Ga0068857_100007979 3300005577 Bacteria 9138
152 Ga0068854_100313633 3300005578 Unclassified 1272
153 Ga0068856_100009083 3300005614 Bacteria 9669
154 Ga0068856_100248616 3300005614 Bacteria 1793
155 Ga0070702_100007624 3300005615 Bacteria 5187
156 Ga0070702_100040335 3300005615 Bacteria 2611
157 Ga0070702_100119988 3300005615 Bacteria 1645
158 Ga0068852_100004643 3300005616 Bacteria 9736
159 Ga0068852_100006476 3300005616 Bacteria 8461
160 Ga0068852_100067062 3300005616 Bacteria 3137
161 Ga0068852_100155480 3300005616 Unclassified 2130
162 Ga0068852_100223956 3300005616 Bacteria 1790
163 Ga0068859_100012941 3300005617 Bacteria 8382
164 Ga0068859_100059085 3300005617 Bacteria 3863
165 Ga0068864_100000412 3300005618 Bacteria 37143
166 Ga0068864_100007950 3300005618 Bacteria 8740
167 Ga0068864_100127143 3300005618 Bacteria 2285
168 Ga0068866_10001410 3300005718 Bacteria 10316
169 Ga0068866_10005264 3300005718 Bacteria 5332
170 Ga0068861_100000341 3300005719 Bacteria 26532
171 Ga0068861_100007717 3300005719 Bacteria 7387
172 Ga0068861_100257031 3300005719 Bacteria 1493
173 Ga0068851_10051953 3300005834 Unclassified 2083
174 Ga0068851_10094329 3300005834 Unclassified 1580
175 Ga0068851_10119109 3300005834 Bacteria 1417
176 Ga0068870_10000924 3300005840 Bacteria 11507
177 Ga0068870_10035995 3300005840 Bacteria 2544
178 Ga0068863_100002712 3300005841 Bacteria 17482
179 Ga0068863_100146522 3300005841 Unclassified 2258
180 Ga0068863_100397324 3300005841 Unclassified 1348
181 Ga0068858_100166476 3300005842 Archaea 2077
182 Ga0068858_100477910 3300005842 Unclassified 1202
183 Ga0068860_100125756 3300005843 Bacteria 2457
184 Ga0068860_100311577 3300005843 Bacteria 1543
185 Ga0068862_100002663 3300005844 Bacteria 15712
186 Ga0068862_100012968 3300005844 Bacteria 6894
187 Ga0081539_10000206 3300005985 Bacteria 137177
188 Ga0097621_100002782 3300006237 Bacteria 11973
189 Ga0097621_100011623 3300006237 Bacteria 6492
190 Ga0097621_100028059 3300006237 Bacteria 4434
191 Ga0097621_100418595 3300006237 Bacteria 1202
192 Ga0068871_100021159 3300006358 Bacteria 4994
193 Ga0075428_100021946 3300006844 Bacteria 7071
194 Ga0075430_100002052 3300006846 Bacteria 16601
195 Ga0075430_100004308 3300006846 Bacteria 12016
196 Ga0075430_100019168 3300006846 Bacteria 5817
197 Ga0075430_100061758 3300006846 Bacteria 3148
198 Ga0075430_100128977 3300006846 Bacteria 2108
199 Ga0075431_100037694 3300006847 Bacteria 4978
200 Ga0075431_100037852 3300006847 Bacteria 4967
201 Ga0075431_100038367 3300006847 Bacteria 4933
202 Ga0075433_10004828 3300006852 Bacteria 10533
203 Ga0075433_10012981 3300006852 Bacteria 6753
204 Ga0075434_100002083 3300006871 Bacteria 17378
205 Ga0075434_100015120 3300006871 Bacteria 7393
206 Ga0075434_100049267 3300006871 Unclassified 4182
207 Ga0075429_100006174 3300006880 Bacteria 10357
208 Ga0068865_100061107 3300006881 Unclassified 2640
209 Ga0075436_100001006 3300006914 Bacteria 18945
210 Ga0075436_100013664 3300006914 Bacteria 5563
211 Ga0075436_100048005 3300006914 Bacteria 2946
212 Ga0097620_100012939 3300006931 Bacteria 8382
213 Ga0097620_100059091 3300006931 Bacteria 3863
214 Ga0075435_100053455 3300007076 Bacteria 3257
215 Ga0105240_10101931 3300009093 Bacteria 3490
216 Ga0105240_10247292 3300009093 Bacteria 2064
217 Ga0111539_10013164 3300009094 Bacteria 10345
218 Ga0111539_10030118 3300009094 Bacteria 6600
219 Ga0105245_10018441 3300009098 Bacteria 6102
220 Ga0105245_10102092 3300009098 Bacteria 2656
221 Ga0114129_10008671 3300009147 Bacteria 14491
222 Ga0114129_10039632 3300009147 Bacteria 6642
223 Ga0114129_10050820 3300009147 Bacteria 5821
224 Ga0114129_10305540 3300009147 Unclassified 2119
225 Ga0105241_10249978 3300009174 Unclassified 1503
226 Ga0105242_10171771 3300009176 Unclassified 1906
227 Ga0105242_10276574 3300009176 Unclassified 1523
228 Ga0105248_10011020 3300009177 Bacteria 9973
229 Ga0105248_10025714 3300009177 Bacteria 6548
230 Ga0105248_10107320 3300009177 Bacteria 3149
231 Ga0105237_10006784 3300009545 Bacteria 12627
232 Ga0105237_10326345 3300009545 Unclassified 1539
233 Ga0105238_10090177 3300009551 Bacteria 3053
234 Ga0105249_10000009 3300009553 Bacteria 313866
235 Ga0105249_10000577 3300009553 Bacteria 33686
236 Ga0105249_10015230 3300009553 Bacteria 6806
237 Ga0105249_10417658 3300009553 Unclassified 1375
238 Ga0105239_10006221 3300010375 Bacteria 13892
239 Ga0105239_10032393 3300010375 Bacteria 5745
240 Ga0105246_10000230 3300011119 Bacteria 28637
241 Ga0105246_10343430 3300011119 Unclassified 1221
242 Ga0157373_10004700 3300013100 Bacteria 10267
243 Ga0157371_10004324 3300013102 Bacteria 12454
244 Ga0157371_10085379 3300013102 Unclassified 2236
245 Ga0157370_10000273 3300013104 Bacteria 65419
246 Ga0157370_10004034 3300013104 Bacteria 17061
247 Ga0157369_10154039 3300013105 Bacteria 2428
248 Ga0157369_10205318 3300013105 Bacteria 2067
249 Ga0157374_10009826 3300013296 Bacteria 8214
250 Ga0157374_10016626 3300013296 Bacteria 6470
251 Ga0157378_10011591 3300013297 Bacteria 7719
252 Ga0157378_10030059 3300013297 Bacteria 4799
253 Ga0157378_10309403 3300013297 Bacteria 1532
254 Ga0163162_10001162 3300013306 Bacteria 24548
255 Ga0163162_10007232 3300013306 Bacteria 10776
256 Ga0157372_10002353 3300013307 Bacteria 20451
257 Ga0157372_10035056 3300013307 Bacteria 5521
258 Ga0157372_10074883 3300013307 Bacteria 3818
259 Ga0157372_10214796 3300013307 Bacteria 2229
260 Ga0157372_10343859 3300013307 Unclassified 1738
261 Ga0157375_10017934 3300013308 Bacteria 6406
262 Ga0157375_10067167 3300013308 Bacteria 3582
263 Ga0157375_10077232 3300013308 Unclassified 3359
264 Ga0163163_10309632 3300014325 Unclassified 1632
265 Ga0163163_10327374 3300014325 Unclassified 1586
266 Ga0163163_10425268 3300014325 Archaea 1387
267 Ga0157380_10000971 3300014326 Bacteria 18176
268 Ga0157380_10270669 3300014326 Bacteria 1548
269 Ga0182008_10011424 3300014497 Bacteria 4723
270 Ga0157377_10002180 3300014745 Bacteria 8612
271 Ga0157379_10114632 3300014968 Bacteria 2422
272 Ga0157379_10190328 3300014968 Bacteria 1854
273 Ga0157376_10002156 3300014969 Bacteria 13257
274 Ga0157376_10014229 3300014969 Bacteria 5966
275 Ga0207697_10022207 3300025315 Bacteria 2600
276 Ga0207656_10016130 3300025321 Bacteria 2903
277 Ga0207656_10034302 3300025321 Bacteria 2119
278 Ga0207642_10055063 3300025899 Bacteria 1817
279 Ga0207647_10019584 3300025904 Bacteria 4549
280 Ga0207699_10010162 3300025906 Bacteria 4711
281 Ga0207645_10003490 3300025907 Bacteria 11902
282 Ga0207645_10009781 3300025907 Bacteria 6619
283 Ga0207645_10030920 3300025907 Bacteria 3449
284 Ga0207643_10000780 3300025908 Bacteria 19398
285 Ga0207705_10006906 3300025909 Bacteria 8385
286 Ga0207705_10011065 3300025909 Bacteria 6540
287 Ga0207705_10102328 3300025909 Bacteria 2108
288 Ga0207684_10140691 3300025910 Bacteria 2074
289 Ga0207707_10001593 3300025912 Bacteria 20895
290 Ga0207707_10002379 3300025912 Bacteria 16954
291 Ga0207707_10021293 3300025912 Bacteria 5668
292 Ga0207707_10027744 3300025912 Bacteria 4951
293 Ga0207695_10001133 3300025913 Bacteria 46228
294 Ga0207695_10237398 3300025913 Bacteria 1725
295 Ga0207671_10022993 3300025914 Unclassified 4706
296 Ga0207693_10024792 3300025915 Bacteria 4757
297 Ga0207663_10118876 3300025916 Bacteria 1806
298 Ga0207663_10141173 3300025916 Bacteria 1678
299 Ga0207660_10006595 3300025917 Bacteria 7535
300 Ga0207660_10013447 3300025917 Bacteria 5364
301 Ga0207660_10072202 3300025917 Bacteria 2513
302 Ga0207660_10126428 3300025917 Bacteria 1941
303 Ga0207662_10001496 3300025918 Bacteria 11350
304 Ga0207662_10001528 3300025918 Bacteria 11284
305 Ga0207662_10025131 3300025918 Bacteria 3429
306 Ga0207662_10083675 3300025918 Unclassified 1951
307 Ga0207657_10014345 3300025919 Bacteria 7739
308 Ga0207657_10080206 3300025919 Bacteria 2744
309 Ga0207657_10219205 3300025919 Unclassified 1525
310 Ga0207649_10000731 3300025920 Bacteria 21616
311 Ga0207649_10011606 3300025920 Bacteria 4863
312 Ga0207649_10080954 3300025920 Bacteria 2102
313 Ga0207652_10000424 3300025921 Bacteria 43863
314 Ga0207652_10004136 3300025921 Bacteria 11841
315 Ga0207652_10016351 3300025921 Bacteria 6056
316 Ga0207652_10032458 3300025921 Bacteria 4390
317 Ga0207652_10099867 3300025921 Bacteria 2561
318 Ga0207646_10000912 3300025922 Bacteria 38082
319 Ga0207646_10192326 3300025922 Bacteria 1843
320 Ga0207646_10397830 3300025922 Bacteria 1244
321 Ga0207681_10006976 3300025923 Bacteria 6932
322 Ga0207681_10022913 3300025923 Bacteria 3988
323 Ga0207681_10041353 3300025923 Unclassified 3073
324 Ga0207681_10052225 3300025923 Bacteria 2771
325 Ga0207694_10066286 3300025924 Bacteria 2817
326 Ga0207650_10011070 3300025925 Bacteria 6202
327 Ga0207650_10011091 3300025925 Bacteria 6197
328 Ga0207650_10024993 3300025925 Bacteria 4253
329 Ga0207659_10005751 3300025926 Bacteria 7553
330 Ga0207659_10058401 3300025926 Bacteria 2769
331 Ga0207659_10177886 3300025926 Bacteria 1683
332 Ga0207659_10206009 3300025926 Unclassified 1574
333 Ga0207687_10012557 3300025927 Bacteria 5533
334 Ga0207687_10017820 3300025927 Bacteria 4684
335 Ga0207687_10019021 3300025927 Unclassified 4545
336 Ga0207664_10165910 3300025929 Unclassified 1887
337 Ga0207644_10004298 3300025931 Bacteria 9248
338 Ga0207644_10066110 3300025931 Unclassified 2631
339 Ga0207690_10003212 3300025932 Bacteria 9807
340 Ga0207690_10008972 3300025932 Bacteria 5934
341 Ga0207706_10001113 3300025933 Bacteria 27369
342 Ga0207706_10001686 3300025933 Bacteria 21798
343 Ga0207706_10008040 3300025933 Bacteria 9734
344 Ga0207706_10036605 3300025933 Unclassified 4359
345 Ga0207706_10057568 3300025933 Bacteria 3424
346 Ga0207706_10065464 3300025933 Bacteria 3200
347 Ga0207709_10012333 3300025935 Bacteria 4709
348 Ga0207670_10116571 3300025936 Unclassified 1934
349 Ga0207670_10261746 3300025936 Archaea 1341
350 Ga0207670_10266576 3300025936 Bacteria 1330
351 Ga0207669_10031606 3300025937 Unclassified 2960
352 Ga0207669_10091819 3300025937 Unclassified 1979
353 Ga0207704_10002614 3300025938 Bacteria 8128
354 Ga0207704_10090486 3300025938 Bacteria 2008
355 Ga0207665_10222126 3300025939 Bacteria 1385
356 Ga0207691_10000797 3300025940 Bacteria 31329
357 Ga0207691_10002878 3300025940 Bacteria 16774
358 Ga0207691_10008345 3300025940 Bacteria 9949
359 Ga0207691_10089239 3300025940 Unclassified 2765
360 Ga0207691_10168201 3300025940 Bacteria 1921
361 Ga0207711_10011473 3300025941 Bacteria 7365
362 Ga0207689_10000970 3300025942 Bacteria 27554
363 Ga0207689_10010948 3300025942 Bacteria 7798
364 Ga0207661_10012824 3300025944 Bacteria 6106
365 Ga0207661_10013340 3300025944 Bacteria 6002
366 Ga0207661_10016955 3300025944 Bacteria 5381
367 Ga0207661_10021620 3300025944 Bacteria 4823
368 Ga0207661_10066961 3300025944 Bacteria 2919
369 Ga0207661_10088157 3300025944 Bacteria 2579
370 Ga0207661_10191756 3300025944 Bacteria 1792
371 Ga0207679_10002102 3300025945 Bacteria 12359
372 Ga0207679_10002461 3300025945 Bacteria 11399
373 Ga0207679_10010452 3300025945 Bacteria 5977
374 Ga0207679_10011052 3300025945 Bacteria 5830
375 Ga0207679_10023192 3300025945 Bacteria 4239
376 Ga0207679_10111033 3300025945 Unclassified 2164
377 Ga0207679_10171117 3300025945 Unclassified 1788
378 Ga0207679_10208991 3300025945 Unclassified 1635
379 Ga0207679_10259490 3300025945 Unclassified 1481
380 Ga0207667_10064201 3300025949 Bacteria 3834
381 Ga0207667_10124072 3300025949 Bacteria 2660
382 Ga0207651_10121798 3300025960 Bacteria 1979
383 Ga0207712_10000080 3300025961 Bacteria 114486
384 Ga0207712_10000958 3300025961 Bacteria 20793
385 Ga0207712_10016180 3300025961 Bacteria 4823
386 Ga0207712_10095389 3300025961 Bacteria 2200
387 Ga0207668_10011844 3300025972 Bacteria 5316
388 Ga0207668_10031618 3300025972 Bacteria 3488
389 Ga0207640_10039590 3300025981 Unclassified 2984
390 Ga0207640_10087232 3300025981 Bacteria 2151
391 Ga0207658_10080360 3300025986 Bacteria 2497
392 Ga0207658_10102763 3300025986 Bacteria 2242
393 Ga0207658_10141157 3300025986 Bacteria 1949
394 Ga0207677_10016076 3300026023 Unclassified 4422
395 Ga0207677_10026914 3300026023 Bacteria 3613
396 Ga0207677_10282216 3300026023 Bacteria 1364
397 Ga0207639_10007026 3300026041 Bacteria 7674
398 Ga0207678_10107826 3300026067 Unclassified 2376
399 Ga0207708_10061016 3300026075 Unclassified 2879
400 Ga0207708_10061273 3300026075 Bacteria 2873
401 Ga0207702_10003875 3300026078 Bacteria 13483
402 Ga0207702_10242211 3300026078 Bacteria 1690
403 Ga0207702_10343776 3300026078 Bacteria 1426
404 Ga0207641_10010316 3300026088 Bacteria 7680
405 Ga0207641_10353210 3300026088 Bacteria 1402
406 Ga0207648_10002292 3300026089 Bacteria 20669
407 Ga0207648_10051263 3300026089 Bacteria 3607
408 Ga0207648_10149652 3300026089 Bacteria 2059
409 Ga0207676_10001303 3300026095 Bacteria 18570
410 Ga0207676_10012504 3300026095 Bacteria 6085
411 Ga0207676_10232426 3300026095 Unclassified 1649
412 Ga0207676_10323815 3300026095 Bacteria 1416
413 Ga0207674_10000033 3300026116 Bacteria 142149
414 Ga0207674_10000044 3300026116 Bacteria 123506
415 Ga0207674_10002683 3300026116 Bacteria 22210
416 Ga0207674_10019757 3300026116 Bacteria 7291
417 Ga0207675_100000125 3300026118 Bacteria 63555
418 Ga0207675_100014041 3300026118 Bacteria 7468
419 Ga0207675_100106795 3300026118 Unclassified 2639
420 Ga0207683_10009187 3300026121 Bacteria 8423
421 Ga0207683_10146753 3300026121 Unclassified 2128
422 Ga0207683_10148270 3300026121 Unclassified 2117
423 Ga0207683_10152416 3300026121 Bacteria 2086
424 Ga0207683_10459785 3300026121 Unclassified 1174
425 Ga0207698_10014194 3300026142 Bacteria 5286
426 Ga0207698_10138425 3300026142 Unclassified 2093
427 Ga0207698_10310066 3300026142 Unclassified 1473
428 Ga0209967_1003536 3300027364 Unclassified 2058
429 Ga0209981_1001759 3300027378 Unclassified 2739
430 Ga0209995_1004896 3300027471 Unclassified 2150
431 Ga0209968_1000169 3300027526 Bacteria 11386
432 Ga0209999_1000311 3300027543 Bacteria 7242
433 Ga0209999_1011554 3300027543 Bacteria 1599
434 Ga0209966_1000989 3300027695 Bacteria 5305
435 Ga0268265_10002817 3300028380 Bacteria 12788
436 Ga0268265_10234334 3300028380 Unclassified 1615
437 Ga0268264_10018364 3300028381 Bacteria 5719
438 Ga0268264_10042936 3300028381 Unclassified 3744
439 Ga0268264_10111051 3300028381 Bacteria 2401
440 Ga0307408_100086365 3300031548 Bacteria 2358
441 Ga0307408_100097090 3300031548 Bacteria 2237
442 Ga0307408_100112166 3300031548 Bacteria 2096
443 Ga0307405_10006044 3300031731 Bacteria 5919
444 Ga0307405_10017312 3300031731 Bacteria 3951
445 Ga0307405_10023609 3300031731 Bacteria 3498
446 Ga0307405_10049644 3300031731 Bacteria 2594
447 Ga0307405_10098253 3300031731 Bacteria 1957
448 Ga0307405_10252502 3300031731 Bacteria 1313
449 Ga0307413_10002303 3300031824 Bacteria 7734
450 Ga0307413_10016202 3300031824 Bacteria 3841
451 Ga0307413_10039253 3300031824 Bacteria 2752
452 Ga0307413_10168180 3300031824 Bacteria 1548
453 Ga0307410_10015051 3300031852 Bacteria 4575
454 Ga0307410_10069615 3300031852 Bacteria 2434
455 Ga0307410_10083845 3300031852 Bacteria 2245
456 Ga0307410_10110884 3300031852 Bacteria 1985
457 Ga0307406_10090984 3300031901 Bacteria 2054
458 Ga0307406_10098270 3300031901 Bacteria 1987
459 Ga0307407_10005027 3300031903 Bacteria 5693
460 Ga0307407_10075516 3300031903 Bacteria 2021
461 Ga0307407_10117110 3300031903 Bacteria 1682
462 Ga0307412_10002263 3300031911 Bacteria 10662
463 Ga0307412_10039064 3300031911 Bacteria 3061
464 Ga0307412_10136096 3300031911 Bacteria 1792
465 Ga0307409_100003073 3300031995 Bacteria 8932
466 Ga0307409_100109236 3300031995 Bacteria 2315
467 Ga0307409_100111647 3300031995 Bacteria 2293
468 Ga0307409_100180513 3300031995 Bacteria 1868
469 Ga0307409_100258834 3300031995 Bacteria 1595
470 Ga0307409_100306805 3300031995 Bacteria 1479
471 Ga0307409_100325011 3300031995 Bacteria 1441
472 Ga0307416_100012552 3300032002 Bacteria 5714
473 Ga0307416_100026127 3300032002 Bacteria 4296
474 Ga0307416_100156728 3300032002 Bacteria 2097
475 Ga0307416_100326080 3300032002 Bacteria 1540
476 Ga0307414_10021276 3300032004 Bacteria 4065
477 Ga0307414_10112252 3300032004 Bacteria 2077
478 Ga0307414_10359349 3300032004 Bacteria 1252
479 Ga0307411_10000219 3300032005 Bacteria 18513
480 Ga0307411_10007213 3300032005 Bacteria 5637
481 Ga0307411_10016862 3300032005 Bacteria 4143
482 Ga0307415_100000195 3300032126 Bacteria 26856
483 Ga0307415_100031538 3300032126 Bacteria 3415
484 Ga0307415_100185251 3300032126 Bacteria 1637
485 Ga0373934_0019190 3300035086 Bacteria 2622
486 Ga0373953_0006075 3300035117 Bacteria 3960
487 Ga0373954_0005863 3300035118 Bacteria 5337
488 Ga0373943_0036956 3300035170 Bacteria 2342
489 Ga0373955_0063121 3300035172 Bacteria 2050
490 Ga0373924_0050261 3300035410 Bacteria 1727
491 Ga0373933_0138215 3300035724 Bacteria 1536
492 Ga0395900_0041740 3300037418 Bacteria 4728
493 Ga0395905_0007240 3300037471 Bacteria 11055
494 Ga0395905_0146073 3300037471 Bacteria 2225
495 Ga0395905_0156513 3300037471 Bacteria 2143
496 Ga0395901_0055060 3300038443 Bacteria 4135
497 Ga0436365_0664906 3300039437 Bacteria 3876
498 Ga0439461_0001136 3300041410 Bacteria 4040
499 Ga0439433_0036638 3300041999 Unclassified 1134
500 Ga0439446_0028147 3300042156 Unclassified 1617
501 Ga0439434_0009005 3300042435 Bacteria 2934
502 Ga0451577_0000001 3300042876 Bacteria 2461803
503 Ga0451577_0023370 3300042876 Bacteria 5639
504 Ga0451577_0082427 3300042876 Bacteria 2869
505 Ga0466963_0203401 3300044694 Unclassified 1385
506 Ga0466957_0087402 3300044842 Bacteria 1949
507 Ga0451576_0057740 3300045051 Bacteria 4057
508 Ga0495592_0051891 3300046454 Bacteria 3046
509 Ga0495603_0018085 3300046455 Unclassified 4264
510 Ga0495603_0063743 3300046455 Bacteria 2174
511 Ga0495590_0056966 3300046457 Unclassified 1366
512 Ga0495629_0029491 3300046459 Bacteria 3889
513 Ga0495651_0004682 3300046462 Bacteria 10469
514 Ga0495653_0051107 3300046463 Bacteria 3175
515 Ga0495580_0004965 3300046472 Bacteria 11112
516 Ga0495580_0043998 3300046472 Bacteria 3176
517 Ga0495582_0135080 3300046473 Bacteria 1395
518 Ga0495594_0053853 3300046499 Bacteria 2217
519 Ga0495594_0060692 3300046499 Bacteria 2092
520 Ga0495608_0022831 3300046511 Bacteria 4292
521 Ga0495628_0030692 3300046516 Bacteria 4351
522 Ga0495630_0033863 3300046517 Bacteria 3810
523 Ga0495652_0003078 3300046529 Bacteria 16705
524 Ga0495665_0012268 3300046531 Bacteria 4637
525 Ga0495665_0029755 3300046531 Bacteria 2925
526 Ga0495665_0193556 3300046531 Bacteria 1055
527 Ga0495640_0131468 3300046533 Bacteria 1620
528 Ga0495586_0009771 3300046535 Bacteria 5108
529 Ga0495586_0025589 3300046535 Bacteria 3158
530 Ga0495586_0080826 3300046535 Bacteria 1786
531 Ga0495587_0010335 3300046536 Bacteria 5945
532 Ga0495587_0019143 3300046536 Bacteria 4240
533 Ga0495645_0014235 3300046543 Bacteria 5641
534 Ga0495667_0035179 3300046559 Bacteria 3348
535 Ga0495588_0002943 3300046674 Bacteria 7358
536 Ga0495588_0159424 3300046674 Unclassified 1193
537 Ga0495657_0094010 3300046675 Bacteria 1918
538 Ga0495599_0009972 3300046678 Bacteria 5815
539 Ga0495623_0056624 3300046679 Bacteria 2467
540 Ga0495646_0060335 3300046680 Bacteria 2262
541 Ga0495658_0013209 3300046683 Unclassified 4202
542 Ga0495658_0021600 3300046683 Bacteria 3394
543 Ga0495613_0017850 3300046689 Bacteria 5289
544 Ga0495600_0069777 3300046809 Bacteria 2297
545 Ga0495581_0007292 3300047315 Bacteria 6398
546 Ga0495636_0089539 3300047318 Bacteria 1335
547 Ga0495674_0049777 3300047319 Bacteria 3700
548 Ga0495674_0050106 3300047319 Bacteria 3686
549 Ga0495680_0130735 3300047322 Bacteria 1845
550 Ga0495684_0364234 3300047471 Unclassified 1023
551 Ga0496104_0144753 3300048907 Bacteria 2282
552 Ga0496108_0042004 3300048911 Bacteria 3816
553 Ga0496109_0146613 3300048912 Archaea 2208
554 Ga0496112_0000919 3300048915 Bacteria 21274
555 Ga0496112_0461048 3300048915 Unclassified 1208
556 Ga0501033_0014927 3300049570 Bacteria 5897
557 Ga0501034_0119252 3300049571 Bacteria 2625
558 Ga0501034_0343592 3300049571 Bacteria 1422
559 Ga0501043_0105339 3300049579 Unclassified 2216
560 Ga0501070_0122560 3300049586 Unclassified 2149
561 Ga0501073_0122040 3300049589 Unclassified 1806
562 Ga0501035_0253898 3300049822 Bacteria 1492
563 Ga0501044_0010211 3300049823 Bacteria 10201
564 Ga0501044_0201090 3300049823 Bacteria 1951
565 Ga0501044_0347383 3300049823 Bacteria 1404
566 nmdc:mga05p37_246655_c1 3300050507 Bacteria 2144
567 nmdc:mga09592_18404_c1 3300050508 Bacteria 5730
568 nmdc:mga09592_43341_c1 3300050508 Bacteria 3788
569 nmdc:mga0qj67_15533_c1 3300050509 Bacteria 5765
570 nmdc:mga0qj67_35133_c1 3300050509 Bacteria 3917
571 nmdc:mga0qj67_67532_c1 3300050509 Bacteria 2849
572 nmdc:mga0qj67_9999_c1 3300050509 Bacteria 7074
573 nmdc:mga06r32_332941_c1 3300050510 Unclassified 1503
574 nmdc:mga06r32_345995_c1 3300050510 Unclassified 1471
575 nmdc:mga06r32_35021_c1 3300050510 Bacteria 4737
576 nmdc:mga06r32_44986_c1 3300050510 Bacteria 4206
577 nmdc:mga06r32_49752_c1 3300050510 Bacteria 4009
578 nmdc:mga08y16_108003_c1 3300050511 Bacteria 2897
579 nmdc:mga0n895_5381_c1 3300050512 Bacteria 10682
580 nmdc:mga0n895_9306_c1 3300050512 Bacteria 8584
581 nmdc:mga0rr50_18910_c1 3300050513 Unclassified 4639
582 nmdc:mga08x19_106016_c1 3300050514 Bacteria 1870
583 nmdc:mga08x19_1592_c1 3300050514 Bacteria 14077
584 Ga0495595_0105396 3300053084 Bacteria 1363
585 Ga0065715_10222509
586 JGI25406J46586_10005561
587 Ga0058863_11959698
588 Ga0065707_10002735
589 Ga0070658_10012203
590 Ga0070658_10136910
591 Ga0070676_10001660
592 Ga0070676_10001813
593 Ga0070676_10025430
594 Ga0070676_10033807
595 Ga0070676_10075776
596 Ga0070683_100000227
597 Ga0070683_100004776
598 Ga0070683_100065975
599 Ga0070690_100013501
600 Ga0070690_100078402
601 Ga0070690_100127846
602 Ga0070670_100006827
603 Ga0070670_100007378
604 Ga0068869_100002978
605 Ga0068869_100016591
606 Ga0070680_100005463
607 Ga0070680_100006068
608 Ga0070680_100008136
609 Ga0070680_100011646
610 Ga0070680_100035656
611 Ga0070680_100044495
612 Ga0070680_100142226
613 Ga0070682_100000225
614 Ga0068868_100001416
615 Ga0068868_100002537
616 Ga0068868_100006559
617 Ga0068868_100049589
618 Ga0070660_100003535
619 Ga0070660_100186389
620 Ga0070689_100035613
621 Ga0070689_100081006
622 Ga0070689_100113177
623 Ga0070689_100254677
624 Ga0070689_100294673
625 Ga0070691_10008820
626 Ga0070691_10138329
627 Ga0070687_100025434
628 Ga0070687_100139270
629 Ga0070661_100001132
630 Ga0070661_100002845
631 Ga0070692_10044639
632 Ga0070668_100003158
633 Ga0070668_100010798
634 Ga0070668_100011204
635 Ga0070669_100001937
636 Ga0070669_100043040
637 Ga0070669_100162826
638 Ga0070675_100001276
639 Ga0070675_100004030
640 Ga0070675_100026600
641 Ga0070675_100410629
642 Ga0070671_100114716
643 Ga0070671_100154723
644 Ga0070674_100003816
645 Ga0070674_100048261
646 Ga0070673_100074782
647 Ga0070673_100100399
648 Ga0070673_100148508
649 Ga0070688_100108719
650 Ga0070659_100012211
651 Ga0070659_100051898
652 Ga0070659_100187109
653 Ga0070659_100452313
654 Ga0070667_100012691
655 Ga0070667_100023979
656 Ga0070667_100055270
657 Ga0070709_10001385
658 Ga0070709_10015007
659 Ga0070701_10077549
660 Ga0070711_100120862
661 Ga0070711_100153220
662 Ga0070700_100005071
663 Ga0070700_100005981
664 Ga0070694_100114138
665 Ga0070663_100096123
666 Ga0070663_100279369
667 Ga0070678_100045025
668 Ga0070678_100116801
669 Ga0070678_100272441
670 Ga0070662_100000245
671 Ga0070662_100000509
672 Ga0070662_100005036
673 Ga0070662_100068671
674 Ga0070662_100129834
675 Ga0070662_100336754
676 Ga0070681_10001039
677 Ga0070681_10001894
678 Ga0070681_10015856
679 Ga0070681_10149221
680 Ga0068867_100004982
681 Ga0068867_100016262
682 Ga0068867_100019345
683 Ga0068867_100035851
684 Ga0068867_100132420
685 Ga0070685_10051843
686 Ga0070706_100089277
687 Ga0070699_100005005
688 Ga0070699_100068724
689 Ga0070699_100096010
690 Ga0070699_100220630
691 Ga0070679_100000080
692 Ga0070679_100003526
693 Ga0070679_100005218
694 Ga0070679_100050969
695 Ga0070679_100058867
696 Ga0070679_100394075
697 Ga0070684_100009580
698 Ga0070684_100033167
699 Ga0070684_100039431
700 Ga0070684_100089070
701 Ga0070684_100093945
702 Ga0070684_100096143
703 Ga0070684_100115023
704 Ga0070684_100232762
705 Ga0070697_100014001
706 Ga0068853_100020380
707 Ga0068853_100057710
708 Ga0070672_100007284
709 Ga0070672_100017649
710 Ga0070672_100046206
711 Ga0070686_100001202
712 Ga0070686_100018268
713 Ga0070695_100041896
714 Ga0070696_100000415
715 Ga0070696_100198854
716 Ga0070696_100267938
717 Ga0070693_100003287
718 Ga0070693_100070288
719 Ga0070693_100072674
720 Ga0070665_100020418
721 Ga0070704_100004244
722 Ga0068855_100018975
723 Ga0068855_100026644
724 Ga0068855_100040853
725 Ga0068855_100049761
726 Ga0068855_100356315
727 Ga0070664_100016181
728 Ga0070664_100025341
729 Ga0070664_100080607
730 Ga0070664_100087861
731 Ga0070664_100167149
732 Ga0070664_100268032
733 Ga0068857_100001422
734 Ga0068857_100007013
735 Ga0068857_100007979
736 Ga0068854_100313633
737 Ga0068856_100009083
738 Ga0068856_100248616
739 Ga0070702_100007624
740 Ga0070702_100040335
741 Ga0070702_100119988
742 Ga0068852_100004643
743 Ga0068852_100006476
744 Ga0068852_100067062
745 Ga0068852_100155480
746 Ga0068852_100223956
747 Ga0068859_100012941
748 Ga0068859_100059085
749 Ga0068864_100000412
750 Ga0068864_100007950
751 Ga0068864_100127143
752 Ga0068866_10001410
753 Ga0068866_10005264
754 Ga0068861_100000341
755 Ga0068861_100007717
756 Ga0068861_100257031
757 Ga0068851_10051953
758 Ga0068851_10094329
759 Ga0068851_10119109
760 Ga0068870_10000924
761 Ga0068870_10035995
762 Ga0068863_100002712
763 Ga0068863_100146522
764 Ga0068863_100397324
765 Ga0068858_100166476
766 Ga0068858_100477910
767 Ga0068860_100125756
768 Ga0068860_100311577
769 Ga0068862_100002663
770 Ga0068862_100012968
771 Ga0081539_10000206
772 Ga0097621_100002782
773 Ga0097621_100011623
774 Ga0097621_100028059
775 Ga0097621_100418595
776 Ga0068871_100021159
777 Ga0075428_100021946
778 Ga0075430_100002052
779 Ga0075430_100004308
780 Ga0075430_100019168
781 Ga0075430_100061758
782 Ga0075430_100128977
783 Ga0075431_100037694
784 Ga0075431_100037852
785 Ga0075431_100038367
786 Ga0075433_10004828
787 Ga0075433_10012981
788 Ga0075434_100002083
789 Ga0075434_100015120
790 Ga0075434_100049267
791 Ga0075429_100006174
792 Ga0068865_100061107
793 Ga0075436_100001006
794 Ga0075436_100013664
795 Ga0075436_100048005
796 Ga0097620_100012939
797 Ga0097620_100059091
798 Ga0075435_100053455
799 Ga0105240_10101931
800 Ga0105240_10247292
801 Ga0111539_10013164
802 Ga0111539_10030118
803 Ga0105245_10018441
804 Ga0105245_10102092
805 Ga0114129_10008671
806 Ga0114129_10039632
807 Ga0114129_10050820
808 Ga0114129_10305540
809 Ga0105241_10249978
810 Ga0105242_10171771
811 Ga0105242_10276574
812 Ga0105248_10011020
813 Ga0105248_10025714
814 Ga0105248_10107320
815 Ga0105237_10006784
816 Ga0105237_10326345
817 Ga0105238_10090177
818 Ga0105249_10000009
819 Ga0105249_10000577
820 Ga0105249_10015230
821 Ga0105249_10417658
822 Ga0105239_10006221
823 Ga0105239_10032393
824 Ga0105246_10000230
825 Ga0105246_10343430
826 Ga0157373_10004700
827 Ga0157371_10004324
828 Ga0157371_10085379
829 Ga0157370_10000273
830 Ga0157370_10004034
831 Ga0157369_10154039
832 Ga0157369_10205318
833 Ga0157374_10009826
834 Ga0157374_10016626
835 Ga0157378_10011591
836 Ga0157378_10030059
837 Ga0157378_10309403
838 Ga0163162_10001162
839 Ga0163162_10007232
840 Ga0157372_10002353
841 Ga0157372_10035056
842 Ga0157372_10074883
843 Ga0157372_10214796
844 Ga0157372_10343859
845 Ga0157375_10017934
846 Ga0157375_10067167
847 Ga0157375_10077232
848 Ga0163163_10309632
849 Ga0163163_10327374
850 Ga0163163_10425268
851 Ga0157380_10000971
852 Ga0157380_10270669
853 Ga0182008_10011424
854 Ga0157377_10002180
855 Ga0157379_10114632
856 Ga0157379_10190328
857 Ga0157376_10002156
858 Ga0157376_10014229
859 Ga0207697_10022207
860 Ga0207656_10016130
861 Ga0207656_10034302
862 Ga0207642_10055063
863 Ga0207647_10019584
864 Ga0207699_10010162
865 Ga0207645_10003490
866 Ga0207645_10009781
867 Ga0207645_10030920
868 Ga0207643_10000780
869 Ga0207705_10006906
870 Ga0207705_10011065
871 Ga0207705_10102328
872 Ga0207684_10140691
873 Ga0207707_10001593
874 Ga0207707_10002379
875 Ga0207707_10021293
876 Ga0207707_10027744
877 Ga0207695_10001133
878 Ga0207695_10237398
879 Ga0207671_10022993
880 Ga0207693_10024792
881 Ga0207663_10118876
882 Ga0207663_10141173
883 Ga0207660_10006595
884 Ga0207660_10013447
885 Ga0207660_10072202
886 Ga0207660_10126428
887 Ga0207662_10001496
888 Ga0207662_10001528
889 Ga0207662_10025131
890 Ga0207662_10083675
891 Ga0207657_10014345
892 Ga0207657_10080206
893 Ga0207657_10219205
894 Ga0207649_10000731
895 Ga0207649_10011606
896 Ga0207649_10080954
897 Ga0207652_10000424
898 Ga0207652_10004136
899 Ga0207652_10016351
900 Ga0207652_10032458
901 Ga0207652_10099867
902 Ga0207646_10000912
903 Ga0207646_10192326
904 Ga0207646_10397830
905 Ga0207681_10006976
906 Ga0207681_10022913
907 Ga0207681_10041353
908 Ga0207681_10052225
909 Ga0207694_10066286
910 Ga0207650_10011070
911 Ga0207650_10011091
912 Ga0207650_10024993
913 Ga0207659_10005751
914 Ga0207659_10058401
915 Ga0207659_10177886
916 Ga0207659_10206009
917 Ga0207687_10012557
918 Ga0207687_10017820
919 Ga0207687_10019021
920 Ga0207664_10165910
921 Ga0207644_10004298
922 Ga0207644_10066110
923 Ga0207690_10003212
924 Ga0207690_10008972
925 Ga0207706_10001113
926 Ga0207706_10001686
927 Ga0207706_10008040
928 Ga0207706_10036605
929 Ga0207706_10057568
930 Ga0207706_10065464
931 Ga0207709_10012333
932 Ga0207670_10116571
933 Ga0207670_10261746
934 Ga0207670_10266576
935 Ga0207669_10031606
936 Ga0207669_10091819
937 Ga0207704_10002614
938 Ga0207704_10090486
939 Ga0207665_10222126
940 Ga0207691_10000797
941 Ga0207691_10002878
942 Ga0207691_10008345
943 Ga0207691_10089239
944 Ga0207691_10168201
945 Ga0207711_10011473
946 Ga0207689_10000970
947 Ga0207689_10010948
948 Ga0207661_10012824
949 Ga0207661_10013340
950 Ga0207661_10016955
951 Ga0207661_10021620
952 Ga0207661_10066961
953 Ga0207661_10088157
954 Ga0207661_10191756
955 Ga0207679_10002102
956 Ga0207679_10002461
957 Ga0207679_10010452
958 Ga0207679_10011052
959 Ga0207679_10023192
960 Ga0207679_10111033
961 Ga0207679_10171117
962 Ga0207679_10208991
963 Ga0207679_10259490
964 Ga0207667_10064201
965 Ga0207667_10124072
966 Ga0207651_10121798
967 Ga0207712_10000080
968 Ga0207712_10000958
969 Ga0207712_10016180
970 Ga0207712_10095389
971 Ga0207668_10011844
972 Ga0207668_10031618
973 Ga0207640_10039590
974 Ga0207640_10087232
975 Ga0207658_10080360
976 Ga0207658_10102763
977 Ga0207658_10141157
978 Ga0207677_10016076
979 Ga0207677_10026914
980 Ga0207677_10282216
981 Ga0207639_10007026
982 Ga0207678_10107826
983 Ga0207708_10061016
984 Ga0207708_10061273
985 Ga0207702_10003875
986 Ga0207702_10242211
987 Ga0207702_10343776
988 Ga0207641_10010316
989 Ga0207641_10353210
990 Ga0207648_10002292
991 Ga0207648_10051263
992 Ga0207648_10149652
993 Ga0207676_10001303
994 Ga0207676_10012504
995 Ga0207676_10232426
996 Ga0207676_10323815
997 Ga0207674_10000033
998 Ga0207674_10000044
999 Ga0207674_10002683
1000 Ga0207674_10019757
1001 Ga0207675_100000125
1002 Ga0207675_100014041
1003 Ga0207675_100106795
1004 Ga0207683_10009187
1005 Ga0207683_10146753
1006 Ga0207683_10148270
1007 Ga0207683_10152416
1008 Ga0207683_10459785
1009 Ga0207698_10014194
1010 Ga0207698_10138425
1011 Ga0207698_10310066
1012 Ga0209967_1003536
1013 Ga0209981_1001759
1014 Ga0209995_1004896
1015 Ga0209968_1000169
1016 Ga0209999_1000311
1017 Ga0209999_1011554
1018 Ga0209966_1000989
1019 Ga0268265_10002817
1020 Ga0268265_10234334
1021 Ga0268264_10018364
1022 Ga0268264_10042936
1023 Ga0268264_10111051
1024 Ga0307408_100086365
1025 Ga0307408_100097090
1026 Ga0307408_100112166
1027 Ga0307405_10006044
1028 Ga0307405_10017312
1029 Ga0307405_10023609
1030 Ga0307405_10049644
1031 Ga0307405_10098253
1032 Ga0307405_10252502
1033 Ga0307413_10002303
1034 Ga0307413_10016202
1035 Ga0307413_10039253
1036 Ga0307413_10168180
1037 Ga0307410_10015051
1038 Ga0307410_10069615
1039 Ga0307410_10083845
1040 Ga0307410_10110884
1041 Ga0307406_10090984
1042 Ga0307406_10098270
1043 Ga0307407_10005027
1044 Ga0307407_10075516
1045 Ga0307407_10117110
1046 Ga0307412_10002263
1047 Ga0307412_10039064
1048 Ga0307412_10136096
1049 Ga0307409_100003073
1050 Ga0307409_100109236
1051 Ga0307409_100111647
1052 Ga0307409_100180513
1053 Ga0307409_100258834
1054 Ga0307409_100306805
1055 Ga0307409_100325011
1056 Ga0307416_100012552
1057 Ga0307416_100026127
1058 Ga0307416_100156728
1059 Ga0307416_100326080
1060 Ga0307414_10021276
1061 Ga0307414_10112252
1062 Ga0307414_10359349
1063 Ga0307411_10000219
1064 Ga0307411_10007213
1065 Ga0307411_10016862
1066 Ga0307415_100000195
1067 Ga0307415_100031538
1068 Ga0307415_100185251
1069 Ga0373934_0019190
1070 Ga0373953_0006075
1071 Ga0373954_0005863
1072 Ga0373943_0036956
1073 Ga0373955_0063121
1074 Ga0373924_0050261
1075 Ga0373933_0138215
1076 Ga0395900_0041740
1077 Ga0395905_0007240
1078 Ga0395905_0146073
1079 Ga0395905_0156513
1080 Ga0395901_0055060
1081 Ga0436365_0664906
1082 Ga0439461_0001136
1083 Ga0439433_0036638
1084 Ga0439446_0028147
1085 Ga0439434_0009005
1086 Ga0451577_0000001
1087 Ga0451577_0023370
1088 Ga0451577_0082427
1089 Ga0466963_0203401
1090 Ga0466957_0087402
1091 Ga0451576_0057740
1092 Ga0495592_0051891
1093 Ga0495603_0018085
1094 Ga0495603_0063743
1095 Ga0495590_0056966
1096 Ga0495629_0029491
1097 Ga0495651_0004682
1098 Ga0495653_0051107
1099 Ga0495580_0004965
1100 Ga0495580_0043998
1101 Ga0495582_0135080
1102 Ga0495594_0053853
1103 Ga0495594_0060692
1104 Ga0495608_0022831
1105 Ga0495628_0030692
1106 Ga0495630_0033863
1107 Ga0495652_0003078
1108 Ga0495665_0012268
1109 Ga0495665_0029755
1110 Ga0495665_0193556
1111 Ga0495640_0131468
1112 Ga0495586_0009771
1113 Ga0495586_0025589
1114 Ga0495586_0080826
1115 Ga0495587_0010335
1116 Ga0495587_0019143
1117 Ga0495645_0014235
1118 Ga0495667_0035179
1119 Ga0495588_0002943
1120 Ga0495588_0159424
1121 Ga0495657_0094010
1122 Ga0495599_0009972
1123 Ga0495623_0056624
1124 Ga0495646_0060335
1125 Ga0495658_0013209
1126 Ga0495658_0021600
1127 Ga0495613_0017850
1128 Ga0495600_0069777
1129 Ga0495581_0007292
1130 Ga0495636_0089539
1131 Ga0495674_0049777
1132 Ga0495674_0050106
1133 Ga0495680_0130735
1134 Ga0495684_0364234
1135 Ga0496104_0144753
1136 Ga0496108_0042004
1137 Ga0496109_0146613
1138 Ga0496112_0000919
1139 Ga0496112_0461048
1140 Ga0501033_0014927
1141 Ga0501034_0119252
1142 Ga0501034_0343592
1143 Ga0501043_0105339
1144 Ga0501070_0122560
1145 Ga0501073_0122040
1146 Ga0501035_0253898
1147 Ga0501044_0010211
1148 Ga0501044_0201090
1149 Ga0501044_0347383
1150 nmdc:mga05p37_246655_c1
1151 nmdc:mga09592_18404_c1
1152 nmdc:mga09592_43341_c1
1153 nmdc:mga0qj67_15533_c1
1154 nmdc:mga0qj67_35133_c1
1155 nmdc:mga0qj67_67532_c1
1156 nmdc:mga0qj67_9999_c1
1157 nmdc:mga06r32_332941_c1
1158 nmdc:mga06r32_345995_c1
1159 nmdc:mga06r32_35021_c1
1160 nmdc:mga06r32_44986_c1
1161 nmdc:mga06r32_49752_c1
1162 nmdc:mga08y16_108003_c1
1163 nmdc:mga0n895_5381_c1
1164 nmdc:mga0n895_9306_c1
1165 nmdc:mga0rr50_18910_c1
1166 nmdc:mga08x19_106016_c1
1167 nmdc:mga08x19_1592_c1
1168 Ga0495595_0105396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fgm-assembly1.cif.gz_A crystal structure of the aminopeptidase n family protein q5qty1 from idiomarina loihiensis. northeast structural genomics consortium target ilr60. 0.4442 71 309
4z7i-assembly2.cif.gz_B crystal structure of insulin regulated aminopeptidase in complex with ligand 0.433 69 288
6mdw-assembly1.cif.gz_A mechanism of protease dependent dpc repair 0.432 77 217
5y2z-assembly3.cif.gz_E crystal structure of human lgi1 eptp-adam22 complex 0.3964 84 175
4fgm-assembly1.cif.gz_A crystal structure of the aminopeptidase n family protein q5qty1 from idiomarina loihiensis. northeast structural genomics consortium target ilr60. 0.3344 71 309
ID Description Score Start End Superfamily
af_Q4DNK3_272_397_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.4316 78 157 3.30.2010.10
af_P46557_387_605_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.4249 73 296 1.10.390.10
af_O17396_5_205_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3963 60 156 1.20.1070.10
af_Q55CA5_72_237_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.3931 61 241 3.40.390.10
af_P0C7Q8_321_527_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.3918 136 305 1.10.390.10
ID Description Score Start End GO Terms
AF-A0A7Y5K0H3-F1-model_v4 DUF2268 domain-containing protein 0.9879 1 314
AF-A0A838Q5C5-F1-model_v4 DUF2268 domain-containing protein 0.9834 60 314
AF-A0A7W1KP16-F1-model_v4 DUF2268 domain-containing protein 0.9827 1 287
AF-A0A838Q5C5-F1-model_v4 DUF2268 domain-containing protein 0.9796 60 314
AF-A0A7W1KP16-F1-model_v4 DUF2268 domain-containing protein 0.9793 1 287

Map