F466324
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 583 | 276 | 1166 | 255 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2891554331|2891560021 |
| Length | 282 |
| Sequence | RRASRRSSADGPGGARPRLAVWKFASCDGCQLTLLDCEEELLSVAARVEIAYFLEASSAPGPGPYDLSLVEGSITTPDDLERIRHVRRVSKRLVTIGACATAGGIQALRDFADVREFLSVVYARPDYIATLDRSTPISAHVPVDFELRGCPIDRRQLLEVVSAFLAGRRPVVPPNSVCVECKARGNACVMVAHGTPCLGPVTQAGCGALCPAFNRGCYGCFGPMESPNVRALNRQLRELGMSTPELVRVYRTFNAAEEPFRQAAEEADPELRDHEKTPGEDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 3 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 27 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 28 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 29 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 30 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 32 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 33 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 37 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 56 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 86 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 87 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 88 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 89 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 90 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 91 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 92 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 93 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 94 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 95 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 98 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 99 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 101 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 102 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 103 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 104 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 106 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 107 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 108 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 109 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 110 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 111 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 114 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 115 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 116 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 117 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 118 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 119 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 120 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 121 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 123 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 124 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 126 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 127 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 128 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 129 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 130 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 131 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 132 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 133 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 134 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 135 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 136 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 138 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 141 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 142 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 143 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 144 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 145 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 146 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 147 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 148 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 149 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 150 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 151 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 152 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 200 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 201 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 202 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 205 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 206 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 207 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 208 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 209 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 210 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 211 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 212 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 213 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 214 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 215 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 242 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 243 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 250 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 251 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 252 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 253 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 255 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 257 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 258 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 259 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 260 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 261 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 262 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 263 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 264 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 265 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 266 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 267 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 268 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 269 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 270 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 271 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 272 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 273 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 274 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 275 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 276 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.23 |
| Metatranscriptomes | 0.34 |
| Isolates | 3.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.37 |
| Nodule | 0 |
| Rhizoplane | 8.06 |
| Rhizosphere | 85.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100002886 | 3300005329 | Bacteria | 13772 |
| 2 | Ga0070683_100037296 | 3300005329 | Bacteria | 4449 |
| 3 | Ga0070680_100024283 | 3300005336 | Bacteria | 4840 |
| 4 | Ga0070682_100016668 | 3300005337 | Bacteria | 4277 |
| 5 | Ga0070660_100430553 | 3300005339 | Bacteria | 1093 |
| 6 | Ga0070689_100121821 | 3300005340 | Bacteria | 2084 |
| 7 | Ga0070692_10080541 | 3300005345 | Bacteria | 1753 |
| 8 | Ga0070668_100027553 | 3300005347 | Bacteria | 4314 |
| 9 | Ga0070688_100036350 | 3300005365 | Bacteria | 2995 |
| 10 | Ga0070688_100343114 | 3300005365 | Bacteria | 1091 |
| 11 | Ga0070659_100026977 | 3300005366 | Bacteria | 4423 |
| 12 | Ga0070667_100060562 | 3300005367 | Bacteria | 3203 |
| 13 | Ga0070714_100001436 | 3300005435 | Bacteria | 17333 |
| 14 | Ga0070714_100350421 | 3300005435 | Bacteria | 1386 |
| 15 | Ga0070714_100553625 | 3300005435 | Bacteria | 1101 |
| 16 | Ga0070713_100090733 | 3300005436 | Bacteria | 2627 |
| 17 | Ga0070713_100708136 | 3300005436 | Bacteria | 961 |
| 18 | Ga0070710_10012451 | 3300005437 | Bacteria | 4226 |
| 19 | Ga0070681_10003921 | 3300005458 | Bacteria | 14025 |
| 20 | Ga0070706_100219482 | 3300005467 | Bacteria | 1775 |
| 21 | Ga0070698_100292268 | 3300005471 | Bacteria | 1561 |
| 22 | Ga0070679_100048380 | 3300005530 | Bacteria | 4237 |
| 23 | Ga0070679_100542428 | 3300005530 | Bacteria | 1107 |
| 24 | Ga0070684_100001127 | 3300005535 | Bacteria | 19160 |
| 25 | Ga0070684_100003477 | 3300005535 | Bacteria | 11821 |
| 26 | Ga0070684_100014569 | 3300005535 | Bacteria | 6375 |
| 27 | Ga0070684_100041317 | 3300005535 | Bacteria | 3975 |
| 28 | Ga0070686_100131939 | 3300005544 | Bacteria | 1729 |
| 29 | Ga0070696_100150688 | 3300005546 | Bacteria | 1707 |
| 30 | Ga0070693_100045573 | 3300005547 | Bacteria | 2486 |
| 31 | Ga0070665_100516451 | 3300005548 | Bacteria | 1206 |
| 32 | Ga0070664_100164037 | 3300005564 | Bacteria | 1968 |
| 33 | Ga0068857_100001815 | 3300005577 | Bacteria | 17170 |
| 34 | Ga0068857_100108753 | 3300005577 | Bacteria | 2491 |
| 35 | Ga0070702_100011197 | 3300005615 | Bacteria | 4455 |
| 36 | Ga0068864_100140059 | 3300005618 | Bacteria | 2181 |
| 37 | Ga0068861_100046449 | 3300005719 | Bacteria | 3274 |
| 38 | Ga0068858_100494219 | 3300005842 | Bacteria | 1182 |
| 39 | Ga0068860_100013421 | 3300005843 | Bacteria | 8034 |
| 40 | Ga0070717_10124009 | 3300006028 | Bacteria | 2216 |
| 41 | Ga0075365_10474522 | 3300006038 | Bacteria | 884 |
| 42 | Ga0075364_10002312 | 3300006051 | Bacteria | 10685 |
| 43 | Ga0070716_100278513 | 3300006173 | Bacteria | 1153 |
| 44 | Ga0070712_100025348 | 3300006175 | Bacteria | 3941 |
| 45 | Ga0097621_100049012 | 3300006237 | Bacteria | 3430 |
| 46 | Ga0075428_100531892 | 3300006844 | Bacteria | 1257 |
| 47 | Ga0075434_100000835 | 3300006871 | Bacteria | 24504 |
| 48 | Ga0068865_100067493 | 3300006881 | Bacteria | 2526 |
| 49 | Ga0068865_100190941 | 3300006881 | Bacteria | 1584 |
| 50 | Ga0075435_100105427 | 3300007076 | Bacteria | 2340 |
| 51 | Ga0105245_10018491 | 3300009098 | Bacteria | 6094 |
| 52 | Ga0105245_10069618 | 3300009098 | Bacteria | 3191 |
| 53 | Ga0114129_10556788 | 3300009147 | Bacteria | 1490 |
| 54 | Ga0105243_10053483 | 3300009148 | Bacteria | 3203 |
| 55 | Ga0105243_10366879 | 3300009148 | Bacteria | 1327 |
| 56 | Ga0105243_10547489 | 3300009148 | Bacteria | 1105 |
| 57 | Ga0105248_10128630 | 3300009177 | Bacteria | 2858 |
| 58 | Ga0105237_10195012 | 3300009545 | Bacteria | 2025 |
| 59 | Ga0105238_10067999 | 3300009551 | Bacteria | 3563 |
| 60 | Ga0105239_10013652 | 3300010375 | Bacteria | 9018 |
| 61 | Ga0105246_10039370 | 3300011119 | Bacteria | 3184 |
| 62 | Ga0157374_10205949 | 3300013296 | Bacteria | 1928 |
| 63 | Ga0163162_10235487 | 3300013306 | Bacteria | 1961 |
| 64 | Ga0163162_10343416 | 3300013306 | Bacteria | 1625 |
| 65 | Ga0157372_10826107 | 3300013307 | Bacteria | 1076 |
| 66 | Ga0157375_10311434 | 3300013308 | Bacteria | 1739 |
| 67 | Ga0157375_10888739 | 3300013308 | Bacteria | 1035 |
| 68 | Ga0163163_10124065 | 3300014325 | Bacteria | 2619 |
| 69 | Ga0163163_10392652 | 3300014325 | Bacteria | 1445 |
| 70 | Ga0157377_10015147 | 3300014745 | Bacteria | 3936 |
| 71 | Ga0157377_10019568 | 3300014745 | Bacteria | 3538 |
| 72 | Ga0157379_10400886 | 3300014968 | Bacteria | 1261 |
| 73 | Ga0206353_11636425 | 3300020082 | Bacteria | 1949 |
| 74 | Ga0207692_10008802 | 3300025898 | Bacteria | 4192 |
| 75 | Ga0207692_10065857 | 3300025898 | Bacteria | 1892 |
| 76 | Ga0207699_10113315 | 3300025906 | Bacteria | 1742 |
| 77 | Ga0207707_10009964 | 3300025912 | Bacteria | 8240 |
| 78 | Ga0207693_10042461 | 3300025915 | Bacteria | 3579 |
| 79 | Ga0207663_10117491 | 3300025916 | Bacteria | 1815 |
| 80 | Ga0207660_10056485 | 3300025917 | Bacteria | 2809 |
| 81 | Ga0207660_10246364 | 3300025917 | Bacteria | 1409 |
| 82 | Ga0207657_10324515 | 3300025919 | Bacteria | 1217 |
| 83 | Ga0207652_10002692 | 3300025921 | Bacteria | 14903 |
| 84 | Ga0207687_10011068 | 3300025927 | Bacteria | 5898 |
| 85 | Ga0207700_10051778 | 3300025928 | Bacteria | 3066 |
| 86 | Ga0207700_10068219 | 3300025928 | Bacteria | 2725 |
| 87 | Ga0207700_10084897 | 3300025928 | Bacteria | 2483 |
| 88 | Ga0207664_10005856 | 3300025929 | Bacteria | 8405 |
| 89 | Ga0207664_10123916 | 3300025929 | Bacteria | 2167 |
| 90 | Ga0207664_10125322 | 3300025929 | Bacteria | 2156 |
| 91 | Ga0207664_10138942 | 3300025929 | Bacteria | 2053 |
| 92 | Ga0207664_10450080 | 3300025929 | Bacteria | 1149 |
| 93 | Ga0207709_10073698 | 3300025935 | Bacteria | 2176 |
| 94 | Ga0207709_10342105 | 3300025935 | Bacteria | 1126 |
| 95 | Ga0207670_10209232 | 3300025936 | Bacteria | 1486 |
| 96 | Ga0207689_10606980 | 3300025942 | Bacteria | 920 |
| 97 | Ga0207689_10680693 | 3300025942 | Bacteria | 867 |
| 98 | Ga0207661_10000541 | 3300025944 | Bacteria | 24217 |
| 99 | Ga0207661_10129106 | 3300025944 | Bacteria | 2163 |
| 100 | Ga0207661_10350659 | 3300025944 | Bacteria | 1331 |
| 101 | Ga0207679_10348754 | 3300025945 | Bacteria | 1290 |
| 102 | Ga0207679_10349123 | 3300025945 | Bacteria | 1289 |
| 103 | Ga0207712_10078163 | 3300025961 | Bacteria | 2400 |
| 104 | Ga0207712_10266252 | 3300025961 | Bacteria | 1392 |
| 105 | Ga0207668_10036250 | 3300025972 | Bacteria | 3290 |
| 106 | Ga0207668_10335346 | 3300025972 | Bacteria | 1260 |
| 107 | Ga0207677_10354571 | 3300026023 | Bacteria | 1230 |
| 108 | Ga0207703_10570096 | 3300026035 | Bacteria | 1069 |
| 109 | Ga0207639_10117820 | 3300026041 | Bacteria | 2176 |
| 110 | Ga0207708_10002912 | 3300026075 | Bacteria | 12612 |
| 111 | Ga0207708_10606941 | 3300026075 | Bacteria | 928 |
| 112 | Ga0207702_10017811 | 3300026078 | Bacteria | 5881 |
| 113 | Ga0207641_10020522 | 3300026088 | Bacteria | 5427 |
| 114 | Ga0207641_10216862 | 3300026088 | Bacteria | 1772 |
| 115 | Ga0207641_10676820 | 3300026088 | Bacteria | 1015 |
| 116 | Ga0207676_10015136 | 3300026095 | Bacteria | 5563 |
| 117 | Ga0207676_10108056 | 3300026095 | Bacteria | 2322 |
| 118 | Ga0207676_10996630 | 3300026095 | Bacteria | 825 |
| 119 | Ga0207674_10000360 | 3300026116 | Bacteria | 59004 |
| 120 | Ga0207674_10035695 | 3300026116 | Bacteria | 5188 |
| 121 | Ga0207675_100047539 | 3300026118 | Bacteria | 4006 |
| 122 | Ga0268265_10516342 | 3300028380 | Bacteria | 1128 |
| 123 | Ga0268265_10537380 | 3300028380 | Bacteria | 1108 |
| 124 | Ga0268264_10181632 | 3300028381 | Bacteria | 1911 |
| 125 | Ga0268264_10186337 | 3300028381 | Bacteria | 1888 |
| 126 | Ga0265337_1001058 | 3300028556 | Bacteria | 14205 |
| 127 | Ga0265326_10004173 | 3300028558 | Bacteria | 4656 |
| 128 | Ga0265319_1001115 | 3300028563 | Bacteria | 16708 |
| 129 | Ga0265334_10000767 | 3300028573 | Bacteria | 16096 |
| 130 | Ga0265318_10054789 | 3300028577 | Bacteria | 1494 |
| 131 | Ga0265323_10080053 | 3300028653 | Bacteria | 1104 |
| 132 | Ga0265322_10028516 | 3300028654 | Bacteria | 1594 |
| 133 | Ga0265336_10001315 | 3300028666 | Bacteria | 11603 |
| 134 | Ga0307517_10049780 | 3300028786 | Bacteria | 4278 |
| 135 | Ga0307515_10002223 | 3300028794 | Bacteria | 42576 |
| 136 | Ga0307515_10006214 | 3300028794 | Bacteria | 23991 |
| 137 | Ga0265338_10000858 | 3300028800 | Bacteria | 51389 |
| 138 | Ga0265324_10003471 | 3300029957 | Bacteria | 7480 |
| 139 | Ga0307512_10011401 | 3300030522 | Bacteria | 8426 |
| 140 | Ga0265330_10080806 | 3300031235 | Bacteria | 1400 |
| 141 | Ga0265330_10130352 | 3300031235 | Bacteria | 1070 |
| 142 | Ga0265332_10008842 | 3300031238 | Bacteria | 4507 |
| 143 | Ga0265332_10095968 | 3300031238 | Bacteria | 1252 |
| 144 | Ga0265320_10006085 | 3300031240 | Bacteria | 7654 |
| 145 | Ga0265325_10004476 | 3300031241 | Bacteria | 8822 |
| 146 | Ga0265325_10018549 | 3300031241 | Bacteria | 3858 |
| 147 | Ga0265325_10051804 | 3300031241 | Bacteria | 2109 |
| 148 | Ga0265340_10002058 | 3300031247 | Bacteria | 11525 |
| 149 | Ga0265340_10013035 | 3300031247 | Bacteria | 4379 |
| 150 | Ga0265340_10017346 | 3300031247 | Bacteria | 3723 |
| 151 | Ga0265340_10025977 | 3300031247 | Bacteria | 2963 |
| 152 | Ga0265339_10019659 | 3300031249 | Bacteria | 3960 |
| 153 | Ga0265339_10192419 | 3300031249 | Bacteria | 1011 |
| 154 | Ga0265327_10071494 | 3300031251 | Bacteria | 1735 |
| 155 | Ga0265327_10103054 | 3300031251 | Bacteria | 1374 |
| 156 | Ga0265316_10016543 | 3300031344 | Bacteria | 6393 |
| 157 | Ga0265316_10154981 | 3300031344 | Bacteria | 1714 |
| 158 | Ga0265316_10243227 | 3300031344 | Bacteria | 1323 |
| 159 | Ga0265316_10268873 | 3300031344 | Bacteria | 1248 |
| 160 | Ga0265316_10478633 | 3300031344 | Bacteria | 891 |
| 161 | Ga0307509_10006603 | 3300031507 | Bacteria | 15516 |
| 162 | Ga0265313_10000365 | 3300031595 | Bacteria | 49111 |
| 163 | Ga0265313_10008443 | 3300031595 | Bacteria | 6839 |
| 164 | Ga0307508_10033747 | 3300031616 | Bacteria | 4618 |
| 165 | Ga0307508_10096080 | 3300031616 | Bacteria | 2554 |
| 166 | Ga0307508_10147759 | 3300031616 | Bacteria | 1955 |
| 167 | Ga0316575_10007630 | 3300031665 | Bacteria | 3920 |
| 168 | Ga0316579_10118274 | 3300031691 | Bacteria | 1273 |
| 169 | Ga0265314_10001864 | 3300031711 | Bacteria | 22601 |
| 170 | Ga0265314_10105895 | 3300031711 | Bacteria | 1797 |
| 171 | Ga0265314_10150870 | 3300031711 | Bacteria | 1425 |
| 172 | Ga0265314_10183601 | 3300031711 | Bacteria | 1251 |
| 173 | Ga0265342_10003438 | 3300031712 | Bacteria | 13000 |
| 174 | Ga0265342_10011994 | 3300031712 | Bacteria | 5887 |
| 175 | Ga0265342_10013841 | 3300031712 | Bacteria | 5384 |
| 176 | Ga0316578_10021288 | 3300031728 | Bacteria | 3598 |
| 177 | Ga0316578_10213657 | 3300031728 | Bacteria | 1160 |
| 178 | Ga0307516_10066470 | 3300031730 | Bacteria | 3477 |
| 179 | Ga0307405_10190893 | 3300031731 | Bacteria | 1480 |
| 180 | Ga0307410_10314702 | 3300031852 | Bacteria | 1240 |
| 181 | Ga0307406_10293717 | 3300031901 | Bacteria | 1245 |
| 182 | Ga0307407_10362856 | 3300031903 | Bacteria | 1029 |
| 183 | Ga0307409_100240342 | 3300031995 | Bacteria | 1648 |
| 184 | Ga0307415_100007578 | 3300032126 | Bacteria | 5947 |
| 185 | Ga0307415_100047333 | 3300032126 | Bacteria | 2895 |
| 186 | Ga0307415_100201714 | 3300032126 | Bacteria | 1579 |
| 187 | Ga0307415_100478919 | 3300032126 | Bacteria | 1083 |
| 188 | Ga0316593_10062895 | 3300032168 | Bacteria | 1272 |
| 189 | Ga0373934_0006208 | 3300035086 | Bacteria | 4429 |
| 190 | Ga0373944_0076148 | 3300035089 | Bacteria | 1101 |
| 191 | Ga0373923_0061725 | 3300035111 | Bacteria | 1593 |
| 192 | Ga0373923_0082406 | 3300035111 | Bacteria | 1397 |
| 193 | Ga0373954_0006278 | 3300035118 | Bacteria | 5181 |
| 194 | Ga0373954_0035348 | 3300035118 | Bacteria | 2317 |
| 195 | Ga0373956_0005567 | 3300035119 | Bacteria | 5037 |
| 196 | Ga0373956_0110713 | 3300035119 | Bacteria | 1278 |
| 197 | Ga0373957_0005067 | 3300035120 | Bacteria | 4065 |
| 198 | Ga0373946_0278615 | 3300035171 | Bacteria | 822 |
| 199 | Ga0373955_0005956 | 3300035172 | Bacteria | 5523 |
| 200 | Ga0373955_0013658 | 3300035172 | Bacteria | 3934 |
| 201 | Ga0316574_0043130 | 3300035398 | Bacteria | 2786 |
| 202 | Ga0373924_0028441 | 3300035410 | Bacteria | 2228 |
| 203 | Ga0373924_0037174 | 3300035410 | Bacteria | 1981 |
| 204 | Ga0373935_0010988 | 3300035692 | Bacteria | 5437 |
| 205 | Ga0373935_0048774 | 3300035692 | Bacteria | 2682 |
| 206 | Ga0373927_0033540 | 3300035695 | Bacteria | 3343 |
| 207 | Ga0373933_0003694 | 3300035724 | Bacteria | 8463 |
| 208 | Ga0373933_0004859 | 3300035724 | Bacteria | 7335 |
| 209 | Ga0373947_0148187 | 3300035725 | Bacteria | 1510 |
| 210 | Ga0373937_0005836 | 3300036401 | Bacteria | 10585 |
| 211 | Ga0373937_0059398 | 3300036401 | Bacteria | 3514 |
| 212 | Ga0373937_0151000 | 3300036401 | Bacteria | 2176 |
| 213 | Ga0373937_0227702 | 3300036401 | Bacteria | 1755 |
| 214 | Ga0316582_0272897 | 3300036647 | Bacteria | 1160 |
| 215 | Ga0373925_0311157 | 3300037068 | Bacteria | 1273 |
| 216 | Ga0373925_0426695 | 3300037068 | Bacteria | 1084 |
| 217 | Ga0395900_0397718 | 3300037418 | Bacteria | 1343 |
| 218 | Ga0395898_0153805 | 3300037466 | Bacteria | 2201 |
| 219 | Ga0395905_0095818 | 3300037471 | Bacteria | 2786 |
| 220 | Ga0395901_0011378 | 3300038443 | Bacteria | 9017 |
| 221 | Ga0395901_0145970 | 3300038443 | Bacteria | 2487 |
| 222 | Ga0395901_0263819 | 3300038443 | Bacteria | 1792 |
| 223 | Ga0395901_0465738 | 3300038443 | Bacteria | 1291 |
| 224 | Ga0400483_120008 | 3300039062 | Bacteria | 3120 |
| 225 | Ga0400483_156580 | 3300039062 | Bacteria | 2841 |
| 226 | Ga0436363_0555582 | 3300039450 | Bacteria | 1996 |
| 227 | Ga0436363_0759113 | 3300039450 | Bacteria | 7088 |
| 228 | Ga0439451_000586 | 3300042009 | Bacteria | 6916 |
| 229 | Ga0439455_0028555 | 3300042012 | Bacteria | 1374 |
| 230 | Ga0439458_0002877 | 3300042157 | Bacteria | 4139 |
| 231 | Ga0466972_0079454 | 3300044658 | Bacteria | 1562 |
| 232 | Ga0466966_0376273 | 3300044684 | Unclassified | 853 |
| 233 | Ga0466961_0257889 | 3300044693 | Bacteria | 1069 |
| 234 | Ga0451576_0018904 | 3300045051 | Bacteria | 7532 |
| 235 | Ga0495592_0004491 | 3300046454 | Bacteria | 10211 |
| 236 | Ga0495592_0057192 | 3300046454 | Bacteria | 2879 |
| 237 | Ga0495592_0217338 | 3300046454 | Bacteria | 1280 |
| 238 | Ga0495603_0006628 | 3300046455 | Bacteria | 6947 |
| 239 | Ga0495603_0054054 | 3300046455 | Bacteria | 2381 |
| 240 | Ga0495603_0060416 | 3300046455 | Bacteria | 2239 |
| 241 | Ga0495603_0084818 | 3300046455 | Bacteria | 1855 |
| 242 | Ga0495629_0122766 | 3300046459 | Bacteria | 1809 |
| 243 | Ga0495629_0156174 | 3300046459 | Bacteria | 1585 |
| 244 | Ga0495629_0173814 | 3300046459 | Bacteria | 1494 |
| 245 | Ga0495641_0028366 | 3300046461 | Bacteria | 2710 |
| 246 | Ga0495641_0102400 | 3300046461 | Bacteria | 1277 |
| 247 | Ga0495651_0004793 | 3300046462 | Bacteria | 10355 |
| 248 | Ga0495651_0006250 | 3300046462 | Bacteria | 9106 |
| 249 | Ga0495651_0008423 | 3300046462 | Bacteria | 7902 |
| 250 | Ga0495651_0030003 | 3300046462 | Bacteria | 4240 |
| 251 | Ga0495651_0050271 | 3300046462 | Bacteria | 3216 |
| 252 | Ga0495651_0111717 | 3300046462 | Bacteria | 2020 |
| 253 | Ga0495653_0010061 | 3300046463 | Bacteria | 7737 |
| 254 | Ga0495653_0017859 | 3300046463 | Bacteria | 5767 |
| 255 | Ga0495653_0031650 | 3300046463 | Bacteria | 4203 |
| 256 | Ga0495653_0056624 | 3300046463 | Bacteria | 2988 |
| 257 | Ga0495653_0097034 | 3300046463 | Bacteria | 2142 |
| 258 | Ga0495653_0311629 | 3300046463 | Bacteria | 1023 |
| 259 | Ga0495580_0032729 | 3300046472 | Bacteria | 3749 |
| 260 | Ga0495580_0160645 | 3300046472 | Bacteria | 1555 |
| 261 | Ga0495582_0012497 | 3300046473 | Bacteria | 4680 |
| 262 | Ga0495582_0017116 | 3300046473 | Bacteria | 3968 |
| 263 | Ga0495582_0026885 | 3300046473 | Bacteria | 3153 |
| 264 | Ga0495582_0031078 | 3300046473 | Bacteria | 2934 |
| 265 | Ga0495639_0072538 | 3300046475 | Bacteria | 1592 |
| 266 | Ga0495639_0146578 | 3300046475 | Bacteria | 1137 |
| 267 | Ga0495662_0016526 | 3300046476 | Bacteria | 3574 |
| 268 | Ga0495664_0021019 | 3300046477 | Bacteria | 3768 |
| 269 | Ga0495664_0036811 | 3300046477 | Bacteria | 2886 |
| 270 | Ga0495594_0164170 | 3300046499 | Bacteria | 1263 |
| 271 | Ga0495608_0001055 | 3300046511 | Bacteria | 19397 |
| 272 | Ga0495608_0002908 | 3300046511 | Bacteria | 12260 |
| 273 | Ga0495608_0048173 | 3300046511 | Bacteria | 2832 |
| 274 | Ga0495618_0009086 | 3300046514 | Bacteria | 5999 |
| 275 | Ga0495618_0102781 | 3300046514 | Bacteria | 1829 |
| 276 | Ga0495628_0004315 | 3300046516 | Bacteria | 12634 |
| 277 | Ga0495628_0063770 | 3300046516 | Bacteria | 2886 |
| 278 | Ga0495628_0094193 | 3300046516 | Bacteria | 2315 |
| 279 | Ga0495630_0009173 | 3300046517 | Bacteria | 7115 |
| 280 | Ga0495630_0011778 | 3300046517 | Bacteria | 6338 |
| 281 | Ga0495630_0019942 | 3300046517 | Bacteria | 4936 |
| 282 | Ga0495630_0028014 | 3300046517 | Bacteria | 4186 |
| 283 | Ga0495630_0034497 | 3300046517 | Bacteria | 3778 |
| 284 | Ga0495630_0092675 | 3300046517 | Bacteria | 2283 |
| 285 | Ga0495630_0180460 | 3300046517 | Bacteria | 1610 |
| 286 | Ga0495630_0544515 | 3300046517 | Bacteria | 890 |
| 287 | Ga0495666_0003828 | 3300046526 | Bacteria | 7612 |
| 288 | Ga0495666_0143264 | 3300046526 | Bacteria | 1113 |
| 289 | Ga0495652_0007315 | 3300046529 | Bacteria | 10183 |
| 290 | Ga0495652_0018787 | 3300046529 | Bacteria | 6160 |
| 291 | Ga0495652_0040913 | 3300046529 | Bacteria | 4003 |
| 292 | Ga0495652_0045794 | 3300046529 | Bacteria | 3758 |
| 293 | Ga0495652_0064870 | 3300046529 | Bacteria | 3070 |
| 294 | Ga0495665_0002165 | 3300046531 | Bacteria | 10624 |
| 295 | Ga0495665_0023909 | 3300046531 | Bacteria | 3283 |
| 296 | Ga0495665_0054438 | 3300046531 | Bacteria | 2114 |
| 297 | Ga0495665_0059027 | 3300046531 | Bacteria | 2025 |
| 298 | Ga0495665_0067785 | 3300046531 | Bacteria | 1882 |
| 299 | Ga0495665_0137208 | 3300046531 | Bacteria | 1279 |
| 300 | Ga0495640_0004351 | 3300046533 | Bacteria | 11308 |
| 301 | Ga0495640_0010782 | 3300046533 | Bacteria | 7051 |
| 302 | Ga0495640_0012455 | 3300046533 | Bacteria | 6496 |
| 303 | Ga0495640_0111643 | 3300046533 | Bacteria | 1786 |
| 304 | Ga0495586_0001735 | 3300046535 | Bacteria | 11886 |
| 305 | Ga0495586_0047009 | 3300046535 | Bacteria | 2328 |
| 306 | Ga0495586_0109316 | 3300046535 | Bacteria | 1538 |
| 307 | Ga0495586_0122794 | 3300046535 | Bacteria | 1451 |
| 308 | Ga0495587_0009534 | 3300046536 | Bacteria | 6218 |
| 309 | Ga0495587_0009899 | 3300046536 | Bacteria | 6083 |
| 310 | Ga0495587_0010516 | 3300046536 | Bacteria | 5885 |
| 311 | Ga0495587_0100433 | 3300046536 | Bacteria | 1668 |
| 312 | Ga0495645_0036512 | 3300046543 | Bacteria | 3581 |
| 313 | Ga0495645_0146333 | 3300046543 | Bacteria | 1645 |
| 314 | Ga0495645_0397379 | 3300046543 | Bacteria | 879 |
| 315 | Ga0495667_0011451 | 3300046559 | Bacteria | 6002 |
| 316 | Ga0495667_0011586 | 3300046559 | Bacteria | 5970 |
| 317 | Ga0495667_0012302 | 3300046559 | Bacteria | 5800 |
| 318 | Ga0495667_0022542 | 3300046559 | Bacteria | 4242 |
| 319 | Ga0495667_0259750 | 3300046559 | Bacteria | 1105 |
| 320 | Ga0495667_0297147 | 3300046559 | Bacteria | 1023 |
| 321 | Ga0495667_0403606 | 3300046559 | Bacteria | 861 |
| 322 | Ga0495634_0011536 | 3300046642 | Bacteria | 6429 |
| 323 | Ga0495634_0026972 | 3300046642 | Bacteria | 4003 |
| 324 | Ga0495634_0137796 | 3300046642 | Bacteria | 1551 |
| 325 | Ga0495635_0001919 | 3300046663 | Bacteria | 14140 |
| 326 | Ga0495635_0008742 | 3300046663 | Bacteria | 7071 |
| 327 | Ga0495635_0019605 | 3300046663 | Bacteria | 4712 |
| 328 | Ga0495635_0252271 | 3300046663 | Bacteria | 1189 |
| 329 | Ga0495588_0032842 | 3300046674 | Bacteria | 2618 |
| 330 | Ga0495588_0164274 | 3300046674 | Bacteria | 1174 |
| 331 | Ga0495657_0004334 | 3300046675 | Bacteria | 11336 |
| 332 | Ga0495657_0006683 | 3300046675 | Bacteria | 9003 |
| 333 | Ga0495657_0014217 | 3300046675 | Bacteria | 5848 |
| 334 | Ga0495657_0026751 | 3300046675 | Bacteria | 4082 |
| 335 | Ga0495599_0002309 | 3300046678 | Bacteria | 11089 |
| 336 | Ga0495599_0066803 | 3300046678 | Bacteria | 2246 |
| 337 | Ga0495599_0131138 | 3300046678 | Bacteria | 1557 |
| 338 | Ga0495599_0257013 | 3300046678 | Bacteria | 1062 |
| 339 | Ga0495623_0111039 | 3300046679 | Bacteria | 1661 |
| 340 | Ga0495646_0013377 | 3300046680 | Bacteria | 5215 |
| 341 | Ga0495646_0027462 | 3300046680 | Bacteria | 3571 |
| 342 | Ga0495646_0038742 | 3300046680 | Bacteria | 2941 |
| 343 | Ga0495646_0060757 | 3300046680 | Bacteria | 2252 |
| 344 | Ga0495647_0003397 | 3300046681 | Bacteria | 5099 |
| 345 | Ga0495647_0026568 | 3300046681 | Bacteria | 2122 |
| 346 | Ga0495647_0103452 | 3300046681 | Bacteria | 1182 |
| 347 | Ga0495658_0066435 | 3300046683 | Bacteria | 2083 |
| 348 | Ga0495658_0075065 | 3300046683 | Bacteria | 1972 |
| 349 | Ga0495658_0075073 | 3300046683 | Bacteria | 1972 |
| 350 | Ga0495658_0201465 | 3300046683 | Bacteria | 1241 |
| 351 | Ga0495658_0204953 | 3300046683 | Bacteria | 1230 |
| 352 | Ga0495613_0006126 | 3300046689 | Bacteria | 9001 |
| 353 | Ga0495613_0016340 | 3300046689 | Bacteria | 5530 |
| 354 | Ga0495613_0104001 | 3300046689 | Bacteria | 2050 |
| 355 | Ga0495624_0225517 | 3300046690 | Bacteria | 1136 |
| 356 | Ga0495600_0028142 | 3300046809 | Bacteria | 3635 |
| 357 | Ga0495600_0036965 | 3300046809 | Bacteria | 3173 |
| 358 | Ga0495600_0044369 | 3300046809 | Bacteria | 2900 |
| 359 | Ga0495600_0063109 | 3300046809 | Bacteria | 2420 |
| 360 | Ga0495600_0110851 | 3300046809 | Bacteria | 1787 |
| 361 | Ga0495581_0002255 | 3300047315 | Bacteria | 10848 |
| 362 | Ga0495581_0030785 | 3300047315 | Bacteria | 3109 |
| 363 | Ga0495581_0139371 | 3300047315 | Bacteria | 1414 |
| 364 | Ga0495604_0000981 | 3300047317 | Bacteria | 23800 |
| 365 | Ga0495604_0043120 | 3300047317 | Bacteria | 3533 |
| 366 | Ga0495604_0058603 | 3300047317 | Bacteria | 2956 |
| 367 | Ga0495674_0014798 | 3300047319 | Bacteria | 7299 |
| 368 | Ga0495674_0030939 | 3300047319 | Bacteria | 4863 |
| 369 | Ga0495674_0031990 | 3300047319 | Bacteria | 4774 |
| 370 | Ga0495674_0150553 | 3300047319 | Bacteria | 1951 |
| 371 | Ga0495674_0563089 | 3300047319 | Bacteria | 906 |
| 372 | Ga0495676_0042817 | 3300047321 | Bacteria | 3713 |
| 373 | Ga0495676_0096114 | 3300047321 | Bacteria | 2203 |
| 374 | Ga0495680_0003252 | 3300047322 | Bacteria | 16128 |
| 375 | Ga0495680_0007627 | 3300047322 | Bacteria | 9884 |
| 376 | Ga0495680_0019081 | 3300047322 | Bacteria | 5803 |
| 377 | Ga0495680_0058994 | 3300047322 | Bacteria | 2964 |
| 378 | Ga0495680_0173854 | 3300047322 | Bacteria | 1558 |
| 379 | Ga0495684_0007018 | 3300047471 | Bacteria | 8749 |
| 380 | Ga0495684_0008259 | 3300047471 | Bacteria | 8058 |
| 381 | Ga0495684_0019498 | 3300047471 | Bacteria | 5224 |
| 382 | Ga0495684_0295072 | 3300047471 | Bacteria | 1166 |
| 383 | Ga0495593_0039528 | 3300047673 | Bacteria | 2543 |
| 384 | Ga0495593_0199987 | 3300047673 | Bacteria | 1004 |
| 385 | Ga0495602_0010197 | 3300048088 | Bacteria | 9752 |
| 386 | Ga0495602_0031499 | 3300048088 | Bacteria | 5013 |
| 387 | Ga0495602_0046275 | 3300048088 | Bacteria | 3931 |
| 388 | Ga0495602_0053038 | 3300048088 | Bacteria | 3594 |
| 389 | Ga0495602_0082238 | 3300048088 | Bacteria | 2703 |
| 390 | Ga0495602_0224406 | 3300048088 | Bacteria | 1416 |
| 391 | Ga0495614_0028733 | 3300048089 | Bacteria | 2394 |
| 392 | Ga0496100_0039350 | 3300048903 | Bacteria | 3003 |
| 393 | Ga0496100_0237199 | 3300048903 | Bacteria | 1344 |
| 394 | Ga0496100_0302040 | 3300048903 | Bacteria | 1198 |
| 395 | Ga0496101_0057693 | 3300048904 | Bacteria | 2809 |
| 396 | Ga0496101_0108020 | 3300048904 | Bacteria | 2091 |
| 397 | Ga0496102_0025005 | 3300048905 | Bacteria | 5312 |
| 398 | Ga0496104_0047803 | 3300048907 | Bacteria | 4033 |
| 399 | Ga0496104_0052456 | 3300048907 | Bacteria | 3852 |
| 400 | Ga0496104_0073395 | 3300048907 | Bacteria | 3255 |
| 401 | Ga0496104_0417955 | 3300048907 | Bacteria | 1253 |
| 402 | Ga0496104_0664785 | 3300048907 | Bacteria | 950 |
| 403 | Ga0496105_0004567 | 3300048908 | Bacteria | 10428 |
| 404 | Ga0496105_0026916 | 3300048908 | Bacteria | 4693 |
| 405 | Ga0496105_0047114 | 3300048908 | Bacteria | 3557 |
| 406 | Ga0496108_0011849 | 3300048911 | Bacteria | 7095 |
| 407 | Ga0496108_0013036 | 3300048911 | Bacteria | 6774 |
| 408 | Ga0496108_0027222 | 3300048911 | Bacteria | 4719 |
| 409 | Ga0496109_0002012 | 3300048912 | Bacteria | 16870 |
| 410 | Ga0496109_0005694 | 3300048912 | Bacteria | 10431 |
| 411 | Ga0496109_0007237 | 3300048912 | Bacteria | 9386 |
| 412 | Ga0496109_0026608 | 3300048912 | Bacteria | 5160 |
| 413 | Ga0496109_0079968 | 3300048912 | Bacteria | 3012 |
| 414 | Ga0496109_0594836 | 3300048912 | Bacteria | 1042 |
| 415 | Ga0496110_0000406 | 3300048913 | Bacteria | 29240 |
| 416 | Ga0496110_0019694 | 3300048913 | Bacteria | 5685 |
| 417 | Ga0496110_0029275 | 3300048913 | Bacteria | 4738 |
| 418 | Ga0496110_0344619 | 3300048913 | Bacteria | 1357 |
| 419 | Ga0496111_0009722 | 3300048914 | Bacteria | 6429 |
| 420 | Ga0496111_0014070 | 3300048914 | Bacteria | 5457 |
| 421 | Ga0496111_0018769 | 3300048914 | Bacteria | 4793 |
| 422 | Ga0496111_0032072 | 3300048914 | Bacteria | 3746 |
| 423 | Ga0496112_0026479 | 3300048915 | Bacteria | 5581 |
| 424 | Ga0496112_0048320 | 3300048915 | Bacteria | 4172 |
| 425 | Ga0496112_0064761 | 3300048915 | Bacteria | 3607 |
| 426 | Ga0496112_0296834 | 3300048915 | Bacteria | 1562 |
| 427 | Ga0496112_0345434 | 3300048915 | Bacteria | 1431 |
| 428 | Ga0496113_0012247 | 3300048916 | Bacteria | 5758 |
| 429 | Ga0496113_0015723 | 3300048916 | Bacteria | 5211 |
| 430 | Ga0496113_0029630 | 3300048916 | Bacteria | 3956 |
| 431 | Ga0496113_0162739 | 3300048916 | Bacteria | 1765 |
| 432 | Ga0496114_0001070 | 3300048917 | Bacteria | 20594 |
| 433 | Ga0496114_0036636 | 3300048917 | Bacteria | 4055 |
| 434 | Ga0496114_0098388 | 3300048917 | Bacteria | 2494 |
| 435 | Ga0496115_0124897 | 3300048918 | Bacteria | 2119 |
| 436 | Ga0496115_0159558 | 3300048918 | Bacteria | 1864 |
| 437 | Ga0496115_0205522 | 3300048918 | Bacteria | 1627 |
| 438 | Ga0496115_0342492 | 3300048918 | Bacteria | 1220 |
| 439 | Ga0496116_0000287 | 3300048919 | Bacteria | 85981 |
| 440 | Ga0496118_0001131 | 3300048921 | Bacteria | 41154 |
| 441 | Ga0496119_0001829 | 3300048922 | Bacteria | 24640 |
| 442 | Ga0496120_0099811 | 3300048923 | Bacteria | 1536 |
| 443 | Ga0496126_0017059 | 3300048929 | Bacteria | 7244 |
| 444 | Ga0496126_0029367 | 3300048929 | Bacteria | 5223 |
| 445 | Ga0501031_0037133 | 3300049568 | Bacteria | 3178 |
| 446 | Ga0501033_0106086 | 3300049570 | Bacteria | 2047 |
| 447 | Ga0501033_0321948 | 3300049570 | Bacteria | 1086 |
| 448 | Ga0501034_0132090 | 3300049571 | Bacteria | 2479 |
| 449 | Ga0501036_0079635 | 3300049572 | Bacteria | 2770 |
| 450 | Ga0501036_0454634 | 3300049572 | Bacteria | 1067 |
| 451 | Ga0501036_0492639 | 3300049572 | Bacteria | 1020 |
| 452 | Ga0501039_0043263 | 3300049575 | Bacteria | 3479 |
| 453 | Ga0501039_0423929 | 3300049575 | Bacteria | 1045 |
| 454 | Ga0501040_0052848 | 3300049576 | Bacteria | 2782 |
| 455 | Ga0501040_0068215 | 3300049576 | Bacteria | 2453 |
| 456 | Ga0501040_0071891 | 3300049576 | Bacteria | 2389 |
| 457 | Ga0501040_0084046 | 3300049576 | Bacteria | 2208 |
| 458 | Ga0501040_0114100 | 3300049576 | Bacteria | 1891 |
| 459 | Ga0501041_0040756 | 3300049577 | Bacteria | 2820 |
| 460 | Ga0501041_0052699 | 3300049577 | Bacteria | 2481 |
| 461 | Ga0501041_0151507 | 3300049577 | Bacteria | 1448 |
| 462 | Ga0501042_0068382 | 3300049578 | Bacteria | 2540 |
| 463 | Ga0501042_0102429 | 3300049578 | Bacteria | 2059 |
| 464 | Ga0501042_0123265 | 3300049578 | Bacteria | 1866 |
| 465 | Ga0501043_0017517 | 3300049579 | Bacteria | 5617 |
| 466 | Ga0501043_0104976 | 3300049579 | Bacteria | 2221 |
| 467 | Ga0501043_0200980 | 3300049579 | Bacteria | 1547 |
| 468 | Ga0501046_0088022 | 3300049580 | Bacteria | 2392 |
| 469 | Ga0501046_0274680 | 3300049580 | Bacteria | 1235 |
| 470 | Ga0501047_0119739 | 3300049581 | Bacteria | 2515 |
| 471 | Ga0501047_0128384 | 3300049581 | Bacteria | 2415 |
| 472 | Ga0501047_0202093 | 3300049581 | Bacteria | 1848 |
| 473 | Ga0501048_0082367 | 3300049582 | Bacteria | 2270 |
| 474 | Ga0501048_0133012 | 3300049582 | Bacteria | 1758 |
| 475 | Ga0501048_0221058 | 3300049582 | Bacteria | 1343 |
| 476 | Ga0501048_0257338 | 3300049582 | Bacteria | 1240 |
| 477 | Ga0501071_0011003 | 3300049587 | Bacteria | 6076 |
| 478 | Ga0501071_0025508 | 3300049587 | Bacteria | 4141 |
| 479 | Ga0501071_0196619 | 3300049587 | Bacteria | 1514 |
| 480 | Ga0501071_0284180 | 3300049587 | Bacteria | 1252 |
| 481 | Ga0501072_0004275 | 3300049588 | Bacteria | 10836 |
| 482 | Ga0501073_0088077 | 3300049589 | Bacteria | 2159 |
| 483 | Ga0501073_0192065 | 3300049589 | Bacteria | 1413 |
| 484 | Ga0501073_0264995 | 3300049589 | Bacteria | 1186 |
| 485 | Ga0501074_0097028 | 3300049590 | Bacteria | 2110 |
| 486 | Ga0501074_0128562 | 3300049590 | Bacteria | 1813 |
| 487 | Ga0501074_0313305 | 3300049590 | Bacteria | 1115 |
| 488 | Ga0501075_0027525 | 3300049591 | Bacteria | 4190 |
| 489 | Ga0501075_0452135 | 3300049591 | Bacteria | 979 |
| 490 | Ga0501076_0005348 | 3300049592 | Bacteria | 9219 |
| 491 | Ga0501076_0027079 | 3300049592 | Bacteria | 4446 |
| 492 | Ga0501076_0110831 | 3300049592 | Bacteria | 2218 |
| 493 | Ga0501076_0126686 | 3300049592 | Bacteria | 2069 |
| 494 | Ga0501077_0006258 | 3300049593 | Bacteria | 7280 |
| 495 | Ga0501077_0015746 | 3300049593 | Bacteria | 4762 |
| 496 | Ga0501077_0303916 | 3300049593 | Bacteria | 1016 |
| 497 | Ga0501079_0013750 | 3300049741 | Bacteria | 6172 |
| 498 | Ga0501079_0051735 | 3300049741 | Bacteria | 3172 |
| 499 | Ga0501079_0066757 | 3300049741 | Bacteria | 2776 |
| 500 | Ga0501079_0191988 | 3300049741 | Bacteria | 1594 |
| 501 | Ga0501080_0027770 | 3300049742 | Bacteria | 5262 |
| 502 | Ga0501080_0098751 | 3300049742 | Bacteria | 2710 |
| 503 | Ga0501081_0017819 | 3300049743 | Bacteria | 4708 |
| 504 | Ga0501081_0078888 | 3300049743 | Bacteria | 2302 |
| 505 | Ga0501081_0269441 | 3300049743 | Bacteria | 1245 |
| 506 | Ga0501083_0151139 | 3300049744 | Bacteria | 1520 |
| 507 | Ga0501083_0342288 | 3300049744 | Bacteria | 972 |
| 508 | Ga0501083_0394607 | 3300049744 | Bacteria | 900 |
| 509 | Ga0501035_0285715 | 3300049822 | Bacteria | 1393 |
| 510 | Ga0501035_0359736 | 3300049822 | Bacteria | 1217 |
| 511 | Ga0501044_0115477 | 3300049823 | Bacteria | 2690 |
| 512 | Ga0501044_0476112 | 3300049823 | Bacteria | 1152 |
| 513 | Ga0501045_0026420 | 3300049824 | Bacteria | 4176 |
| 514 | Ga0501045_0027963 | 3300049824 | Bacteria | 4067 |
| 515 | Ga0501045_0028678 | 3300049824 | Bacteria | 4017 |
| 516 | Ga0501045_0128775 | 3300049824 | Bacteria | 1881 |
| 517 | Ga0501045_0183323 | 3300049824 | Bacteria | 1560 |
| 518 | Ga0501045_0229705 | 3300049824 | Bacteria | 1381 |
| 519 | Ga0501045_0397826 | 3300049824 | Bacteria | 1025 |
| 520 | Ga0501045_0421943 | 3300049824 | Bacteria | 992 |
| 521 | Ga0501045_0526042 | 3300049824 | Bacteria | 878 |
| 522 | nmdc:mga00v17_9715_c1 | 3300050491 | Bacteria | 5220 |
| 523 | nmdc:mga0yw44_35552_c1 | 3300050492 | Bacteria | 2929 |
| 524 | nmdc:mga05p37_270300_c1 | 3300050507 | Bacteria | 2031 |
| 525 | nmdc:mga05p37_280702_c1 | 3300050507 | Bacteria | 1986 |
| 526 | nmdc:mga0rr50_337252_c1 | 3300050513 | Bacteria | 1266 |
| 527 | nmdc:mga0a205_49054_c1 | 3300050515 | Bacteria | 4074 |
| 528 | Ga0495601_0004355 | 3300053077 | Bacteria | 8182 |
| 529 | Ga0495601_0031818 | 3300053077 | Bacteria | 3280 |
| 530 | Ga0495601_0042768 | 3300053077 | Bacteria | 2844 |
| 531 | Ga0495601_0101822 | 3300053077 | Bacteria | 1855 |
| 532 | Ga0495601_0136640 | 3300053077 | Bacteria | 1598 |
| 533 | Ga0495601_0209185 | 3300053077 | Bacteria | 1274 |
| 534 | Ga0495595_0004814 | 3300053084 | Bacteria | 5435 |
| 535 | Ga0495595_0021157 | 3300053084 | Bacteria | 2839 |
| 536 | Ga0495595_0040671 | 3300053084 | Bacteria | 2125 |
| 537 | Ga0495595_0046825 | 3300053084 | Bacteria | 1993 |
| 538 | Ga0495619_0050678 | 3300053085 | Bacteria | 2741 |
| 539 | Ga0495619_0098370 | 3300053085 | Bacteria | 1989 |
| 540 | Ga0495619_0100107 | 3300053085 | Bacteria | 1972 |
| 541 | Ga0495619_0128671 | 3300053085 | Bacteria | 1739 |
| 542 | Ga0495619_0381963 | 3300053085 | Bacteria | 973 |
| 543 | Ga0500651_0167190 | 3300053093 | Bacteria | 1313 |
| 544 | Ga0500654_098496 | 3300053099 | Bacteria | 1261 |
| 545 | Ga0500573_0117149 | 3300053140 | Bacteria | 1486 |
| 546 | Ga0500577_0028100 | 3300053142 | Bacteria | 1934 |
| 547 | Ga0501084_0040909 | 3300054114 | Bacteria | 3878 |
| 548 | Ga0501084_0048023 | 3300054114 | Bacteria | 3574 |
| 549 | Ga0501084_0101199 | 3300054114 | Bacteria | 2420 |
| 550 | Ga0501084_0108315 | 3300054114 | Bacteria | 2334 |
| 551 | Ga0501084_0164419 | 3300054114 | Bacteria | 1873 |
| 552 | Ga0501084_0213362 | 3300054114 | Bacteria | 1629 |
| 553 | Ga0501084_0272934 | 3300054114 | Bacteria | 1428 |
| 554 | Ga0590071_034367 | 3300059421 | Bacteria | 1213 |
| 555 | Ga0501082_0017331 | 3300060353 | Bacteria | 6205 |
| 556 | Ga0501082_0041174 | 3300060353 | Bacteria | 3983 |
| 557 | Ga0501082_0068049 | 3300060353 | Bacteria | 3067 |
| 558 | Ga0501082_0155335 | 3300060353 | Bacteria | 1988 |
| 559 | Ga0530510_0003053 | 3300061734 | Bacteria | 11497 |
| 560 | Ga0530510_0020270 | 3300061734 | Bacteria | 4728 |
| 561 | Ga0530510_0211315 | 3300061734 | Bacteria | 1442 |
| 562 | Ga0530510_0333625 | 3300061734 | Bacteria | 1138 |
| 563 | Ga0530510_0445119 | 3300061734 | Bacteria | 979 |
| 564 | 2891560021 | 2891554331 | Bacteria | 8812224 |
| 565 | 2738892304 | 2738541308 | Bacteria | 7020677 |
| 566 | 2739235208 | 2738543011 | Bacteria | 5731169 |
| 567 | 2776371157 | 2775506925 | Bacteria | 7237746 |
| 568 | 2786667391 | 2786546132 | Bacteria | 10419719 |
| 569 | 2863071527 | 2863067949 | Bacteria | 8541735 |
| 570 | 2877676600 | 2877676314 | Bacteria | 9512378 |
| 571 | 2884697096 | 2884693830 | Bacteria | 11273186 |
| 572 | 2889301793 | 2889300758 | Bacteria | 5690814 |
| 573 | 2891398426 | 2891395885 | Bacteria | 9251614 |
| 574 | 2895449144 | 2895442618 | Bacteria | 11027144 |
| 575 | 2939747207 | 2939743619 | Bacteria | 5762299 |
| 576 | 2954673545 | 2954673503 | Bacteria | 9685905 |
| 577 | 2954690445 | 2954682443 | Bacteria | 9862841 |
| 578 | 2954712621 | 2954711539 | Bacteria | 10867210 |
| 579 | 2954722577 | 2954721474 | Bacteria | 10456478 |
| 580 | 2954739281 | 2954731030 | Bacteria | 10243860 |
| 581 | 2954741456 | 2954740390 | Bacteria | 10229294 |
| 582 | 2954758110 | 2954749733 | Bacteria | 10366972 |
| 583 | 8054164577 | 8054160619 | Bacteria | 7783213 |
| 584 | Ga0070683_100002886 | |||
| 585 | Ga0070683_100037296 | |||
| 586 | Ga0070680_100024283 | |||
| 587 | Ga0070682_100016668 | |||
| 588 | Ga0070660_100430553 | |||
| 589 | Ga0070689_100121821 | |||
| 590 | Ga0070692_10080541 | |||
| 591 | Ga0070668_100027553 | |||
| 592 | Ga0070688_100036350 | |||
| 593 | Ga0070688_100343114 | |||
| 594 | Ga0070659_100026977 | |||
| 595 | Ga0070667_100060562 | |||
| 596 | Ga0070714_100001436 | |||
| 597 | Ga0070714_100350421 | |||
| 598 | Ga0070714_100553625 | |||
| 599 | Ga0070713_100090733 | |||
| 600 | Ga0070713_100708136 | |||
| 601 | Ga0070710_10012451 | |||
| 602 | Ga0070681_10003921 | |||
| 603 | Ga0070706_100219482 | |||
| 604 | Ga0070698_100292268 | |||
| 605 | Ga0070679_100048380 | |||
| 606 | Ga0070679_100542428 | |||
| 607 | Ga0070684_100001127 | |||
| 608 | Ga0070684_100003477 | |||
| 609 | Ga0070684_100014569 | |||
| 610 | Ga0070684_100041317 | |||
| 611 | Ga0070686_100131939 | |||
| 612 | Ga0070696_100150688 | |||
| 613 | Ga0070693_100045573 | |||
| 614 | Ga0070665_100516451 | |||
| 615 | Ga0070664_100164037 | |||
| 616 | Ga0068857_100001815 | |||
| 617 | Ga0068857_100108753 | |||
| 618 | Ga0070702_100011197 | |||
| 619 | Ga0068864_100140059 | |||
| 620 | Ga0068861_100046449 | |||
| 621 | Ga0068858_100494219 | |||
| 622 | Ga0068860_100013421 | |||
| 623 | Ga0070717_10124009 | |||
| 624 | Ga0075365_10474522 | |||
| 625 | Ga0075364_10002312 | |||
| 626 | Ga0070716_100278513 | |||
| 627 | Ga0070712_100025348 | |||
| 628 | Ga0097621_100049012 | |||
| 629 | Ga0075428_100531892 | |||
| 630 | Ga0075434_100000835 | |||
| 631 | Ga0068865_100067493 | |||
| 632 | Ga0068865_100190941 | |||
| 633 | Ga0075435_100105427 | |||
| 634 | Ga0105245_10018491 | |||
| 635 | Ga0105245_10069618 | |||
| 636 | Ga0114129_10556788 | |||
| 637 | Ga0105243_10053483 | |||
| 638 | Ga0105243_10366879 | |||
| 639 | Ga0105243_10547489 | |||
| 640 | Ga0105248_10128630 | |||
| 641 | Ga0105237_10195012 | |||
| 642 | Ga0105238_10067999 | |||
| 643 | Ga0105239_10013652 | |||
| 644 | Ga0105246_10039370 | |||
| 645 | Ga0157374_10205949 | |||
| 646 | Ga0163162_10235487 | |||
| 647 | Ga0163162_10343416 | |||
| 648 | Ga0157372_10826107 | |||
| 649 | Ga0157375_10311434 | |||
| 650 | Ga0157375_10888739 | |||
| 651 | Ga0163163_10124065 | |||
| 652 | Ga0163163_10392652 | |||
| 653 | Ga0157377_10015147 | |||
| 654 | Ga0157377_10019568 | |||
| 655 | Ga0157379_10400886 | |||
| 656 | Ga0206353_11636425 | |||
| 657 | Ga0207692_10008802 | |||
| 658 | Ga0207692_10065857 | |||
| 659 | Ga0207699_10113315 | |||
| 660 | Ga0207707_10009964 | |||
| 661 | Ga0207693_10042461 | |||
| 662 | Ga0207663_10117491 | |||
| 663 | Ga0207660_10056485 | |||
| 664 | Ga0207660_10246364 | |||
| 665 | Ga0207657_10324515 | |||
| 666 | Ga0207652_10002692 | |||
| 667 | Ga0207687_10011068 | |||
| 668 | Ga0207700_10051778 | |||
| 669 | Ga0207700_10068219 | |||
| 670 | Ga0207700_10084897 | |||
| 671 | Ga0207664_10005856 | |||
| 672 | Ga0207664_10123916 | |||
| 673 | Ga0207664_10125322 | |||
| 674 | Ga0207664_10138942 | |||
| 675 | Ga0207664_10450080 | |||
| 676 | Ga0207709_10073698 | |||
| 677 | Ga0207709_10342105 | |||
| 678 | Ga0207670_10209232 | |||
| 679 | Ga0207689_10606980 | |||
| 680 | Ga0207689_10680693 | |||
| 681 | Ga0207661_10000541 | |||
| 682 | Ga0207661_10129106 | |||
| 683 | Ga0207661_10350659 | |||
| 684 | Ga0207679_10348754 | |||
| 685 | Ga0207679_10349123 | |||
| 686 | Ga0207712_10078163 | |||
| 687 | Ga0207712_10266252 | |||
| 688 | Ga0207668_10036250 | |||
| 689 | Ga0207668_10335346 | |||
| 690 | Ga0207677_10354571 | |||
| 691 | Ga0207703_10570096 | |||
| 692 | Ga0207639_10117820 | |||
| 693 | Ga0207708_10002912 | |||
| 694 | Ga0207708_10606941 | |||
| 695 | Ga0207702_10017811 | |||
| 696 | Ga0207641_10020522 | |||
| 697 | Ga0207641_10216862 | |||
| 698 | Ga0207641_10676820 | |||
| 699 | Ga0207676_10015136 | |||
| 700 | Ga0207676_10108056 | |||
| 701 | Ga0207676_10996630 | |||
| 702 | Ga0207674_10000360 | |||
| 703 | Ga0207674_10035695 | |||
| 704 | Ga0207675_100047539 | |||
| 705 | Ga0268265_10516342 | |||
| 706 | Ga0268265_10537380 | |||
| 707 | Ga0268264_10181632 | |||
| 708 | Ga0268264_10186337 | |||
| 709 | Ga0265337_1001058 | |||
| 710 | Ga0265326_10004173 | |||
| 711 | Ga0265319_1001115 | |||
| 712 | Ga0265334_10000767 | |||
| 713 | Ga0265318_10054789 | |||
| 714 | Ga0265323_10080053 | |||
| 715 | Ga0265322_10028516 | |||
| 716 | Ga0265336_10001315 | |||
| 717 | Ga0307517_10049780 | |||
| 718 | Ga0307515_10002223 | |||
| 719 | Ga0307515_10006214 | |||
| 720 | Ga0265338_10000858 | |||
| 721 | Ga0265324_10003471 | |||
| 722 | Ga0307512_10011401 | |||
| 723 | Ga0265330_10080806 | |||
| 724 | Ga0265330_10130352 | |||
| 725 | Ga0265332_10008842 | |||
| 726 | Ga0265332_10095968 | |||
| 727 | Ga0265320_10006085 | |||
| 728 | Ga0265325_10004476 | |||
| 729 | Ga0265325_10018549 | |||
| 730 | Ga0265325_10051804 | |||
| 731 | Ga0265340_10002058 | |||
| 732 | Ga0265340_10013035 | |||
| 733 | Ga0265340_10017346 | |||
| 734 | Ga0265340_10025977 | |||
| 735 | Ga0265339_10019659 | |||
| 736 | Ga0265339_10192419 | |||
| 737 | Ga0265327_10071494 | |||
| 738 | Ga0265327_10103054 | |||
| 739 | Ga0265316_10016543 | |||
| 740 | Ga0265316_10154981 | |||
| 741 | Ga0265316_10243227 | |||
| 742 | Ga0265316_10268873 | |||
| 743 | Ga0265316_10478633 | |||
| 744 | Ga0307509_10006603 | |||
| 745 | Ga0265313_10000365 | |||
| 746 | Ga0265313_10008443 | |||
| 747 | Ga0307508_10033747 | |||
| 748 | Ga0307508_10096080 | |||
| 749 | Ga0307508_10147759 | |||
| 750 | Ga0316575_10007630 | |||
| 751 | Ga0316579_10118274 | |||
| 752 | Ga0265314_10001864 | |||
| 753 | Ga0265314_10105895 | |||
| 754 | Ga0265314_10150870 | |||
| 755 | Ga0265314_10183601 | |||
| 756 | Ga0265342_10003438 | |||
| 757 | Ga0265342_10011994 | |||
| 758 | Ga0265342_10013841 | |||
| 759 | Ga0316578_10021288 | |||
| 760 | Ga0316578_10213657 | |||
| 761 | Ga0307516_10066470 | |||
| 762 | Ga0307405_10190893 | |||
| 763 | Ga0307410_10314702 | |||
| 764 | Ga0307406_10293717 | |||
| 765 | Ga0307407_10362856 | |||
| 766 | Ga0307409_100240342 | |||
| 767 | Ga0307415_100007578 | |||
| 768 | Ga0307415_100047333 | |||
| 769 | Ga0307415_100201714 | |||
| 770 | Ga0307415_100478919 | |||
| 771 | Ga0316593_10062895 | |||
| 772 | Ga0373934_0006208 | |||
| 773 | Ga0373944_0076148 | |||
| 774 | Ga0373923_0061725 | |||
| 775 | Ga0373923_0082406 | |||
| 776 | Ga0373954_0006278 | |||
| 777 | Ga0373954_0035348 | |||
| 778 | Ga0373956_0005567 | |||
| 779 | Ga0373956_0110713 | |||
| 780 | Ga0373957_0005067 | |||
| 781 | Ga0373946_0278615 | |||
| 782 | Ga0373955_0005956 | |||
| 783 | Ga0373955_0013658 | |||
| 784 | Ga0316574_0043130 | |||
| 785 | Ga0373924_0028441 | |||
| 786 | Ga0373924_0037174 | |||
| 787 | Ga0373935_0010988 | |||
| 788 | Ga0373935_0048774 | |||
| 789 | Ga0373927_0033540 | |||
| 790 | Ga0373933_0003694 | |||
| 791 | Ga0373933_0004859 | |||
| 792 | Ga0373947_0148187 | |||
| 793 | Ga0373937_0005836 | |||
| 794 | Ga0373937_0059398 | |||
| 795 | Ga0373937_0151000 | |||
| 796 | Ga0373937_0227702 | |||
| 797 | Ga0316582_0272897 | |||
| 798 | Ga0373925_0311157 | |||
| 799 | Ga0373925_0426695 | |||
| 800 | Ga0395900_0397718 | |||
| 801 | Ga0395898_0153805 | |||
| 802 | Ga0395905_0095818 | |||
| 803 | Ga0395901_0011378 | |||
| 804 | Ga0395901_0145970 | |||
| 805 | Ga0395901_0263819 | |||
| 806 | Ga0395901_0465738 | |||
| 807 | Ga0400483_120008 | |||
| 808 | Ga0400483_156580 | |||
| 809 | Ga0436363_0555582 | |||
| 810 | Ga0436363_0759113 | |||
| 811 | Ga0439451_000586 | |||
| 812 | Ga0439455_0028555 | |||
| 813 | Ga0439458_0002877 | |||
| 814 | Ga0466972_0079454 | |||
| 815 | Ga0466966_0376273 | |||
| 816 | Ga0466961_0257889 | |||
| 817 | Ga0451576_0018904 | |||
| 818 | Ga0495592_0004491 | |||
| 819 | Ga0495592_0057192 | |||
| 820 | Ga0495592_0217338 | |||
| 821 | Ga0495603_0006628 | |||
| 822 | Ga0495603_0054054 | |||
| 823 | Ga0495603_0060416 | |||
| 824 | Ga0495603_0084818 | |||
| 825 | Ga0495629_0122766 | |||
| 826 | Ga0495629_0156174 | |||
| 827 | Ga0495629_0173814 | |||
| 828 | Ga0495641_0028366 | |||
| 829 | Ga0495641_0102400 | |||
| 830 | Ga0495651_0004793 | |||
| 831 | Ga0495651_0006250 | |||
| 832 | Ga0495651_0008423 | |||
| 833 | Ga0495651_0030003 | |||
| 834 | Ga0495651_0050271 | |||
| 835 | Ga0495651_0111717 | |||
| 836 | Ga0495653_0010061 | |||
| 837 | Ga0495653_0017859 | |||
| 838 | Ga0495653_0031650 | |||
| 839 | Ga0495653_0056624 | |||
| 840 | Ga0495653_0097034 | |||
| 841 | Ga0495653_0311629 | |||
| 842 | Ga0495580_0032729 | |||
| 843 | Ga0495580_0160645 | |||
| 844 | Ga0495582_0012497 | |||
| 845 | Ga0495582_0017116 | |||
| 846 | Ga0495582_0026885 | |||
| 847 | Ga0495582_0031078 | |||
| 848 | Ga0495639_0072538 | |||
| 849 | Ga0495639_0146578 | |||
| 850 | Ga0495662_0016526 | |||
| 851 | Ga0495664_0021019 | |||
| 852 | Ga0495664_0036811 | |||
| 853 | Ga0495594_0164170 | |||
| 854 | Ga0495608_0001055 | |||
| 855 | Ga0495608_0002908 | |||
| 856 | Ga0495608_0048173 | |||
| 857 | Ga0495618_0009086 | |||
| 858 | Ga0495618_0102781 | |||
| 859 | Ga0495628_0004315 | |||
| 860 | Ga0495628_0063770 | |||
| 861 | Ga0495628_0094193 | |||
| 862 | Ga0495630_0009173 | |||
| 863 | Ga0495630_0011778 | |||
| 864 | Ga0495630_0019942 | |||
| 865 | Ga0495630_0028014 | |||
| 866 | Ga0495630_0034497 | |||
| 867 | Ga0495630_0092675 | |||
| 868 | Ga0495630_0180460 | |||
| 869 | Ga0495630_0544515 | |||
| 870 | Ga0495666_0003828 | |||
| 871 | Ga0495666_0143264 | |||
| 872 | Ga0495652_0007315 | |||
| 873 | Ga0495652_0018787 | |||
| 874 | Ga0495652_0040913 | |||
| 875 | Ga0495652_0045794 | |||
| 876 | Ga0495652_0064870 | |||
| 877 | Ga0495665_0002165 | |||
| 878 | Ga0495665_0023909 | |||
| 879 | Ga0495665_0054438 | |||
| 880 | Ga0495665_0059027 | |||
| 881 | Ga0495665_0067785 | |||
| 882 | Ga0495665_0137208 | |||
| 883 | Ga0495640_0004351 | |||
| 884 | Ga0495640_0010782 | |||
| 885 | Ga0495640_0012455 | |||
| 886 | Ga0495640_0111643 | |||
| 887 | Ga0495586_0001735 | |||
| 888 | Ga0495586_0047009 | |||
| 889 | Ga0495586_0109316 | |||
| 890 | Ga0495586_0122794 | |||
| 891 | Ga0495587_0009534 | |||
| 892 | Ga0495587_0009899 | |||
| 893 | Ga0495587_0010516 | |||
| 894 | Ga0495587_0100433 | |||
| 895 | Ga0495645_0036512 | |||
| 896 | Ga0495645_0146333 | |||
| 897 | Ga0495645_0397379 | |||
| 898 | Ga0495667_0011451 | |||
| 899 | Ga0495667_0011586 | |||
| 900 | Ga0495667_0012302 | |||
| 901 | Ga0495667_0022542 | |||
| 902 | Ga0495667_0259750 | |||
| 903 | Ga0495667_0297147 | |||
| 904 | Ga0495667_0403606 | |||
| 905 | Ga0495634_0011536 | |||
| 906 | Ga0495634_0026972 | |||
| 907 | Ga0495634_0137796 | |||
| 908 | Ga0495635_0001919 | |||
| 909 | Ga0495635_0008742 | |||
| 910 | Ga0495635_0019605 | |||
| 911 | Ga0495635_0252271 | |||
| 912 | Ga0495588_0032842 | |||
| 913 | Ga0495588_0164274 | |||
| 914 | Ga0495657_0004334 | |||
| 915 | Ga0495657_0006683 | |||
| 916 | Ga0495657_0014217 | |||
| 917 | Ga0495657_0026751 | |||
| 918 | Ga0495599_0002309 | |||
| 919 | Ga0495599_0066803 | |||
| 920 | Ga0495599_0131138 | |||
| 921 | Ga0495599_0257013 | |||
| 922 | Ga0495623_0111039 | |||
| 923 | Ga0495646_0013377 | |||
| 924 | Ga0495646_0027462 | |||
| 925 | Ga0495646_0038742 | |||
| 926 | Ga0495646_0060757 | |||
| 927 | Ga0495647_0003397 | |||
| 928 | Ga0495647_0026568 | |||
| 929 | Ga0495647_0103452 | |||
| 930 | Ga0495658_0066435 | |||
| 931 | Ga0495658_0075065 | |||
| 932 | Ga0495658_0075073 | |||
| 933 | Ga0495658_0201465 | |||
| 934 | Ga0495658_0204953 | |||
| 935 | Ga0495613_0006126 | |||
| 936 | Ga0495613_0016340 | |||
| 937 | Ga0495613_0104001 | |||
| 938 | Ga0495624_0225517 | |||
| 939 | Ga0495600_0028142 | |||
| 940 | Ga0495600_0036965 | |||
| 941 | Ga0495600_0044369 | |||
| 942 | Ga0495600_0063109 | |||
| 943 | Ga0495600_0110851 | |||
| 944 | Ga0495581_0002255 | |||
| 945 | Ga0495581_0030785 | |||
| 946 | Ga0495581_0139371 | |||
| 947 | Ga0495604_0000981 | |||
| 948 | Ga0495604_0043120 | |||
| 949 | Ga0495604_0058603 | |||
| 950 | Ga0495674_0014798 | |||
| 951 | Ga0495674_0030939 | |||
| 952 | Ga0495674_0031990 | |||
| 953 | Ga0495674_0150553 | |||
| 954 | Ga0495674_0563089 | |||
| 955 | Ga0495676_0042817 | |||
| 956 | Ga0495676_0096114 | |||
| 957 | Ga0495680_0003252 | |||
| 958 | Ga0495680_0007627 | |||
| 959 | Ga0495680_0019081 | |||
| 960 | Ga0495680_0058994 | |||
| 961 | Ga0495680_0173854 | |||
| 962 | Ga0495684_0007018 | |||
| 963 | Ga0495684_0008259 | |||
| 964 | Ga0495684_0019498 | |||
| 965 | Ga0495684_0295072 | |||
| 966 | Ga0495593_0039528 | |||
| 967 | Ga0495593_0199987 | |||
| 968 | Ga0495602_0010197 | |||
| 969 | Ga0495602_0031499 | |||
| 970 | Ga0495602_0046275 | |||
| 971 | Ga0495602_0053038 | |||
| 972 | Ga0495602_0082238 | |||
| 973 | Ga0495602_0224406 | |||
| 974 | Ga0495614_0028733 | |||
| 975 | Ga0496100_0039350 | |||
| 976 | Ga0496100_0237199 | |||
| 977 | Ga0496100_0302040 | |||
| 978 | Ga0496101_0057693 | |||
| 979 | Ga0496101_0108020 | |||
| 980 | Ga0496102_0025005 | |||
| 981 | Ga0496104_0047803 | |||
| 982 | Ga0496104_0052456 | |||
| 983 | Ga0496104_0073395 | |||
| 984 | Ga0496104_0417955 | |||
| 985 | Ga0496104_0664785 | |||
| 986 | Ga0496105_0004567 | |||
| 987 | Ga0496105_0026916 | |||
| 988 | Ga0496105_0047114 | |||
| 989 | Ga0496108_0011849 | |||
| 990 | Ga0496108_0013036 | |||
| 991 | Ga0496108_0027222 | |||
| 992 | Ga0496109_0002012 | |||
| 993 | Ga0496109_0005694 | |||
| 994 | Ga0496109_0007237 | |||
| 995 | Ga0496109_0026608 | |||
| 996 | Ga0496109_0079968 | |||
| 997 | Ga0496109_0594836 | |||
| 998 | Ga0496110_0000406 | |||
| 999 | Ga0496110_0019694 | |||
| 1000 | Ga0496110_0029275 | |||
| 1001 | Ga0496110_0344619 | |||
| 1002 | Ga0496111_0009722 | |||
| 1003 | Ga0496111_0014070 | |||
| 1004 | Ga0496111_0018769 | |||
| 1005 | Ga0496111_0032072 | |||
| 1006 | Ga0496112_0026479 | |||
| 1007 | Ga0496112_0048320 | |||
| 1008 | Ga0496112_0064761 | |||
| 1009 | Ga0496112_0296834 | |||
| 1010 | Ga0496112_0345434 | |||
| 1011 | Ga0496113_0012247 | |||
| 1012 | Ga0496113_0015723 | |||
| 1013 | Ga0496113_0029630 | |||
| 1014 | Ga0496113_0162739 | |||
| 1015 | Ga0496114_0001070 | |||
| 1016 | Ga0496114_0036636 | |||
| 1017 | Ga0496114_0098388 | |||
| 1018 | Ga0496115_0124897 | |||
| 1019 | Ga0496115_0159558 | |||
| 1020 | Ga0496115_0205522 | |||
| 1021 | Ga0496115_0342492 | |||
| 1022 | Ga0496116_0000287 | |||
| 1023 | Ga0496118_0001131 | |||
| 1024 | Ga0496119_0001829 | |||
| 1025 | Ga0496120_0099811 | |||
| 1026 | Ga0496126_0017059 | |||
| 1027 | Ga0496126_0029367 | |||
| 1028 | Ga0501031_0037133 | |||
| 1029 | Ga0501033_0106086 | |||
| 1030 | Ga0501033_0321948 | |||
| 1031 | Ga0501034_0132090 | |||
| 1032 | Ga0501036_0079635 | |||
| 1033 | Ga0501036_0454634 | |||
| 1034 | Ga0501036_0492639 | |||
| 1035 | Ga0501039_0043263 | |||
| 1036 | Ga0501039_0423929 | |||
| 1037 | Ga0501040_0052848 | |||
| 1038 | Ga0501040_0068215 | |||
| 1039 | Ga0501040_0071891 | |||
| 1040 | Ga0501040_0084046 | |||
| 1041 | Ga0501040_0114100 | |||
| 1042 | Ga0501041_0040756 | |||
| 1043 | Ga0501041_0052699 | |||
| 1044 | Ga0501041_0151507 | |||
| 1045 | Ga0501042_0068382 | |||
| 1046 | Ga0501042_0102429 | |||
| 1047 | Ga0501042_0123265 | |||
| 1048 | Ga0501043_0017517 | |||
| 1049 | Ga0501043_0104976 | |||
| 1050 | Ga0501043_0200980 | |||
| 1051 | Ga0501046_0088022 | |||
| 1052 | Ga0501046_0274680 | |||
| 1053 | Ga0501047_0119739 | |||
| 1054 | Ga0501047_0128384 | |||
| 1055 | Ga0501047_0202093 | |||
| 1056 | Ga0501048_0082367 | |||
| 1057 | Ga0501048_0133012 | |||
| 1058 | Ga0501048_0221058 | |||
| 1059 | Ga0501048_0257338 | |||
| 1060 | Ga0501071_0011003 | |||
| 1061 | Ga0501071_0025508 | |||
| 1062 | Ga0501071_0196619 | |||
| 1063 | Ga0501071_0284180 | |||
| 1064 | Ga0501072_0004275 | |||
| 1065 | Ga0501073_0088077 | |||
| 1066 | Ga0501073_0192065 | |||
| 1067 | Ga0501073_0264995 | |||
| 1068 | Ga0501074_0097028 | |||
| 1069 | Ga0501074_0128562 | |||
| 1070 | Ga0501074_0313305 | |||
| 1071 | Ga0501075_0027525 | |||
| 1072 | Ga0501075_0452135 | |||
| 1073 | Ga0501076_0005348 | |||
| 1074 | Ga0501076_0027079 | |||
| 1075 | Ga0501076_0110831 | |||
| 1076 | Ga0501076_0126686 | |||
| 1077 | Ga0501077_0006258 | |||
| 1078 | Ga0501077_0015746 | |||
| 1079 | Ga0501077_0303916 | |||
| 1080 | Ga0501079_0013750 | |||
| 1081 | Ga0501079_0051735 | |||
| 1082 | Ga0501079_0066757 | |||
| 1083 | Ga0501079_0191988 | |||
| 1084 | Ga0501080_0027770 | |||
| 1085 | Ga0501080_0098751 | |||
| 1086 | Ga0501081_0017819 | |||
| 1087 | Ga0501081_0078888 | |||
| 1088 | Ga0501081_0269441 | |||
| 1089 | Ga0501083_0151139 | |||
| 1090 | Ga0501083_0342288 | |||
| 1091 | Ga0501083_0394607 | |||
| 1092 | Ga0501035_0285715 | |||
| 1093 | Ga0501035_0359736 | |||
| 1094 | Ga0501044_0115477 | |||
| 1095 | Ga0501044_0476112 | |||
| 1096 | Ga0501045_0026420 | |||
| 1097 | Ga0501045_0027963 | |||
| 1098 | Ga0501045_0028678 | |||
| 1099 | Ga0501045_0128775 | |||
| 1100 | Ga0501045_0183323 | |||
| 1101 | Ga0501045_0229705 | |||
| 1102 | Ga0501045_0397826 | |||
| 1103 | Ga0501045_0421943 | |||
| 1104 | Ga0501045_0526042 | |||
| 1105 | nmdc:mga00v17_9715_c1 | |||
| 1106 | nmdc:mga0yw44_35552_c1 | |||
| 1107 | nmdc:mga05p37_270300_c1 | |||
| 1108 | nmdc:mga05p37_280702_c1 | |||
| 1109 | nmdc:mga0rr50_337252_c1 | |||
| 1110 | nmdc:mga0a205_49054_c1 | |||
| 1111 | Ga0495601_0004355 | |||
| 1112 | Ga0495601_0031818 | |||
| 1113 | Ga0495601_0042768 | |||
| 1114 | Ga0495601_0101822 | |||
| 1115 | Ga0495601_0136640 | |||
| 1116 | Ga0495601_0209185 | |||
| 1117 | Ga0495595_0004814 | |||
| 1118 | Ga0495595_0021157 | |||
| 1119 | Ga0495595_0040671 | |||
| 1120 | Ga0495595_0046825 | |||
| 1121 | Ga0495619_0050678 | |||
| 1122 | Ga0495619_0098370 | |||
| 1123 | Ga0495619_0100107 | |||
| 1124 | Ga0495619_0128671 | |||
| 1125 | Ga0495619_0381963 | |||
| 1126 | Ga0500651_0167190 | |||
| 1127 | Ga0500654_098496 | |||
| 1128 | Ga0500573_0117149 | |||
| 1129 | Ga0500577_0028100 | |||
| 1130 | Ga0501084_0040909 | |||
| 1131 | Ga0501084_0048023 | |||
| 1132 | Ga0501084_0101199 | |||
| 1133 | Ga0501084_0108315 | |||
| 1134 | Ga0501084_0164419 | |||
| 1135 | Ga0501084_0213362 | |||
| 1136 | Ga0501084_0272934 | |||
| 1137 | Ga0590071_034367 | |||
| 1138 | Ga0501082_0017331 | |||
| 1139 | Ga0501082_0041174 | |||
| 1140 | Ga0501082_0068049 | |||
| 1141 | Ga0501082_0155335 | |||
| 1142 | Ga0530510_0003053 | |||
| 1143 | Ga0530510_0020270 | |||
| 1144 | Ga0530510_0211315 | |||
| 1145 | Ga0530510_0333625 | |||
| 1146 | Ga0530510_0445119 | |||
| 1147 | 2891560021 | |||
| 1148 | 2738892304 | |||
| 1149 | 2739235208 | |||
| 1150 | 2776371157 | |||
| 1151 | 2786667391 | |||
| 1152 | 2863071527 | |||
| 1153 | 2877676600 | |||
| 1154 | 2884697096 | |||
| 1155 | 2889301793 | |||
| 1156 | 2891398426 | |||
| 1157 | 2895449144 | |||
| 1158 | 2939747207 | |||
| 1159 | 2954673545 | |||
| 1160 | 2954690445 | |||
| 1161 | 2954712621 | |||
| 1162 | 2954722577 | |||
| 1163 | 2954739281 | |||
| 1164 | 2954741456 | |||
| 1165 | 2954758110 | |||
| 1166 | 8054164577 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6qgr-assembly1.cif.gz_G | the f420-reducing [nife] hydrogenase complex from methanosarcina barkeri at the nia-s state | 0.7638 | 1 | 152 |
| 7t2r-assembly1.cif.gz_E | structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state | 0.7369 | 1 | 161 |
| 5xfa-assembly1.cif.gz_C | crystal structure of nad+-reducing [nife]-hydrogenase in the h2-reduced state | 0.7315 | 2 | 161 |
| 7ard-assembly1.cif.gz_B | cryo-em structure of polytomella complex-i (complete composition) | 0.7291 | 5 | 154 |
| 7ak6-assembly1.cif.gz_B | cryo-em structure of nd6-p25l mutant respiratory complex i from mus musculus at 3.8 a | 0.6985 | 4 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q60340_4_160_3.40.50.700 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit | 0.7936 | 4 | 154 | 3.40.50.700 |
| af_Q58591_5_180_3.40.50.700 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit | 0.7423 | 4 | 165 | 3.40.50.700 |
| af_Q60340_4_160_3.40.50.700 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit | 0.714 | 4 | 154 | 3.40.50.700 |
| af_I6XUD2_20_159_3.40.50.12280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7078 | 3 | 155 | 3.40.50.12280 |
| af_Q58136_4_129_3.40.50.700 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit | 0.7013 | 14 | 154 | 3.40.50.700 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C7PJ64-F1-model_v4 | NADH:ubiquinone oxidoreductase-like 20kDa subunit domain-containing protein | 0.9136 | 2 | 82 |
GO:0016491
GO:0051538 |
| AF-A0A354BKR5-F1-model_v4 | Oxidoreductase | 0.8999 | 2 | 86 |
GO:0016491
GO:0051536 |
| AF-A0A662GJ17-F1-model_v4 | NADH:ubiquinone oxidoreductase | 0.8938 | 2 | 87 |
GO:0016491
GO:0051536 |
| AF-A0A3D4Z3F7-F1-model_v4 | Oxidoreductase | 0.8895 | 13 | 88 |
GO:0016491
GO:0051536 |
| AF-A0A3D4Z3F7-F1-model_v4 | Oxidoreductase | 0.8788 | 13 | 88 |
GO:0016491
GO:0051536 |