F466324

General Info

Members Datasets Scaffolds Average Seq Length
583 276 1166 255

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2891554331|2891560021
Length 282
Sequence RRASRRSSADGPGGARPRLAVWKFASCDGCQLTLLDCEEELLSVAARVEIAYFLEASSAPGPGPYDLSLVEGSITTPDDLERIRHVRRVSKRLVTIGACATAGGIQALRDFADVREFLSVVYARPDYIATLDRSTPISAHVPVDFELRGCPIDRRQLLEVVSAFLAGRRPVVPPNSVCVECKARGNACVMVAHGTPCLGPVTQAGCGALCPAFNRGCYGCFGPMESPNVRALNRQLRELGMSTPELVRVYRTFNAAEEPFRQAAEEADPELRDHEKTPGEDR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
86 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
87 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
88 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
91 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
92 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
93 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
110 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
123 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
124 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
127 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
146 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
147 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
250 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
251 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
252 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
257 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
258 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
259 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
260 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
261 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
262 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
263 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
264 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
265 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
266 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
267 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
268 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
269 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
270 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
271 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
272 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
273 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
274 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
275 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
276 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.23
Metatranscriptomes 0.34
Isolates 3.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.37
Nodule 0
Rhizoplane 8.06
Rhizosphere 85.93
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100002886 3300005329 Bacteria 13772
2 Ga0070683_100037296 3300005329 Bacteria 4449
3 Ga0070680_100024283 3300005336 Bacteria 4840
4 Ga0070682_100016668 3300005337 Bacteria 4277
5 Ga0070660_100430553 3300005339 Bacteria 1093
6 Ga0070689_100121821 3300005340 Bacteria 2084
7 Ga0070692_10080541 3300005345 Bacteria 1753
8 Ga0070668_100027553 3300005347 Bacteria 4314
9 Ga0070688_100036350 3300005365 Bacteria 2995
10 Ga0070688_100343114 3300005365 Bacteria 1091
11 Ga0070659_100026977 3300005366 Bacteria 4423
12 Ga0070667_100060562 3300005367 Bacteria 3203
13 Ga0070714_100001436 3300005435 Bacteria 17333
14 Ga0070714_100350421 3300005435 Bacteria 1386
15 Ga0070714_100553625 3300005435 Bacteria 1101
16 Ga0070713_100090733 3300005436 Bacteria 2627
17 Ga0070713_100708136 3300005436 Bacteria 961
18 Ga0070710_10012451 3300005437 Bacteria 4226
19 Ga0070681_10003921 3300005458 Bacteria 14025
20 Ga0070706_100219482 3300005467 Bacteria 1775
21 Ga0070698_100292268 3300005471 Bacteria 1561
22 Ga0070679_100048380 3300005530 Bacteria 4237
23 Ga0070679_100542428 3300005530 Bacteria 1107
24 Ga0070684_100001127 3300005535 Bacteria 19160
25 Ga0070684_100003477 3300005535 Bacteria 11821
26 Ga0070684_100014569 3300005535 Bacteria 6375
27 Ga0070684_100041317 3300005535 Bacteria 3975
28 Ga0070686_100131939 3300005544 Bacteria 1729
29 Ga0070696_100150688 3300005546 Bacteria 1707
30 Ga0070693_100045573 3300005547 Bacteria 2486
31 Ga0070665_100516451 3300005548 Bacteria 1206
32 Ga0070664_100164037 3300005564 Bacteria 1968
33 Ga0068857_100001815 3300005577 Bacteria 17170
34 Ga0068857_100108753 3300005577 Bacteria 2491
35 Ga0070702_100011197 3300005615 Bacteria 4455
36 Ga0068864_100140059 3300005618 Bacteria 2181
37 Ga0068861_100046449 3300005719 Bacteria 3274
38 Ga0068858_100494219 3300005842 Bacteria 1182
39 Ga0068860_100013421 3300005843 Bacteria 8034
40 Ga0070717_10124009 3300006028 Bacteria 2216
41 Ga0075365_10474522 3300006038 Bacteria 884
42 Ga0075364_10002312 3300006051 Bacteria 10685
43 Ga0070716_100278513 3300006173 Bacteria 1153
44 Ga0070712_100025348 3300006175 Bacteria 3941
45 Ga0097621_100049012 3300006237 Bacteria 3430
46 Ga0075428_100531892 3300006844 Bacteria 1257
47 Ga0075434_100000835 3300006871 Bacteria 24504
48 Ga0068865_100067493 3300006881 Bacteria 2526
49 Ga0068865_100190941 3300006881 Bacteria 1584
50 Ga0075435_100105427 3300007076 Bacteria 2340
51 Ga0105245_10018491 3300009098 Bacteria 6094
52 Ga0105245_10069618 3300009098 Bacteria 3191
53 Ga0114129_10556788 3300009147 Bacteria 1490
54 Ga0105243_10053483 3300009148 Bacteria 3203
55 Ga0105243_10366879 3300009148 Bacteria 1327
56 Ga0105243_10547489 3300009148 Bacteria 1105
57 Ga0105248_10128630 3300009177 Bacteria 2858
58 Ga0105237_10195012 3300009545 Bacteria 2025
59 Ga0105238_10067999 3300009551 Bacteria 3563
60 Ga0105239_10013652 3300010375 Bacteria 9018
61 Ga0105246_10039370 3300011119 Bacteria 3184
62 Ga0157374_10205949 3300013296 Bacteria 1928
63 Ga0163162_10235487 3300013306 Bacteria 1961
64 Ga0163162_10343416 3300013306 Bacteria 1625
65 Ga0157372_10826107 3300013307 Bacteria 1076
66 Ga0157375_10311434 3300013308 Bacteria 1739
67 Ga0157375_10888739 3300013308 Bacteria 1035
68 Ga0163163_10124065 3300014325 Bacteria 2619
69 Ga0163163_10392652 3300014325 Bacteria 1445
70 Ga0157377_10015147 3300014745 Bacteria 3936
71 Ga0157377_10019568 3300014745 Bacteria 3538
72 Ga0157379_10400886 3300014968 Bacteria 1261
73 Ga0206353_11636425 3300020082 Bacteria 1949
74 Ga0207692_10008802 3300025898 Bacteria 4192
75 Ga0207692_10065857 3300025898 Bacteria 1892
76 Ga0207699_10113315 3300025906 Bacteria 1742
77 Ga0207707_10009964 3300025912 Bacteria 8240
78 Ga0207693_10042461 3300025915 Bacteria 3579
79 Ga0207663_10117491 3300025916 Bacteria 1815
80 Ga0207660_10056485 3300025917 Bacteria 2809
81 Ga0207660_10246364 3300025917 Bacteria 1409
82 Ga0207657_10324515 3300025919 Bacteria 1217
83 Ga0207652_10002692 3300025921 Bacteria 14903
84 Ga0207687_10011068 3300025927 Bacteria 5898
85 Ga0207700_10051778 3300025928 Bacteria 3066
86 Ga0207700_10068219 3300025928 Bacteria 2725
87 Ga0207700_10084897 3300025928 Bacteria 2483
88 Ga0207664_10005856 3300025929 Bacteria 8405
89 Ga0207664_10123916 3300025929 Bacteria 2167
90 Ga0207664_10125322 3300025929 Bacteria 2156
91 Ga0207664_10138942 3300025929 Bacteria 2053
92 Ga0207664_10450080 3300025929 Bacteria 1149
93 Ga0207709_10073698 3300025935 Bacteria 2176
94 Ga0207709_10342105 3300025935 Bacteria 1126
95 Ga0207670_10209232 3300025936 Bacteria 1486
96 Ga0207689_10606980 3300025942 Bacteria 920
97 Ga0207689_10680693 3300025942 Bacteria 867
98 Ga0207661_10000541 3300025944 Bacteria 24217
99 Ga0207661_10129106 3300025944 Bacteria 2163
100 Ga0207661_10350659 3300025944 Bacteria 1331
101 Ga0207679_10348754 3300025945 Bacteria 1290
102 Ga0207679_10349123 3300025945 Bacteria 1289
103 Ga0207712_10078163 3300025961 Bacteria 2400
104 Ga0207712_10266252 3300025961 Bacteria 1392
105 Ga0207668_10036250 3300025972 Bacteria 3290
106 Ga0207668_10335346 3300025972 Bacteria 1260
107 Ga0207677_10354571 3300026023 Bacteria 1230
108 Ga0207703_10570096 3300026035 Bacteria 1069
109 Ga0207639_10117820 3300026041 Bacteria 2176
110 Ga0207708_10002912 3300026075 Bacteria 12612
111 Ga0207708_10606941 3300026075 Bacteria 928
112 Ga0207702_10017811 3300026078 Bacteria 5881
113 Ga0207641_10020522 3300026088 Bacteria 5427
114 Ga0207641_10216862 3300026088 Bacteria 1772
115 Ga0207641_10676820 3300026088 Bacteria 1015
116 Ga0207676_10015136 3300026095 Bacteria 5563
117 Ga0207676_10108056 3300026095 Bacteria 2322
118 Ga0207676_10996630 3300026095 Bacteria 825
119 Ga0207674_10000360 3300026116 Bacteria 59004
120 Ga0207674_10035695 3300026116 Bacteria 5188
121 Ga0207675_100047539 3300026118 Bacteria 4006
122 Ga0268265_10516342 3300028380 Bacteria 1128
123 Ga0268265_10537380 3300028380 Bacteria 1108
124 Ga0268264_10181632 3300028381 Bacteria 1911
125 Ga0268264_10186337 3300028381 Bacteria 1888
126 Ga0265337_1001058 3300028556 Bacteria 14205
127 Ga0265326_10004173 3300028558 Bacteria 4656
128 Ga0265319_1001115 3300028563 Bacteria 16708
129 Ga0265334_10000767 3300028573 Bacteria 16096
130 Ga0265318_10054789 3300028577 Bacteria 1494
131 Ga0265323_10080053 3300028653 Bacteria 1104
132 Ga0265322_10028516 3300028654 Bacteria 1594
133 Ga0265336_10001315 3300028666 Bacteria 11603
134 Ga0307517_10049780 3300028786 Bacteria 4278
135 Ga0307515_10002223 3300028794 Bacteria 42576
136 Ga0307515_10006214 3300028794 Bacteria 23991
137 Ga0265338_10000858 3300028800 Bacteria 51389
138 Ga0265324_10003471 3300029957 Bacteria 7480
139 Ga0307512_10011401 3300030522 Bacteria 8426
140 Ga0265330_10080806 3300031235 Bacteria 1400
141 Ga0265330_10130352 3300031235 Bacteria 1070
142 Ga0265332_10008842 3300031238 Bacteria 4507
143 Ga0265332_10095968 3300031238 Bacteria 1252
144 Ga0265320_10006085 3300031240 Bacteria 7654
145 Ga0265325_10004476 3300031241 Bacteria 8822
146 Ga0265325_10018549 3300031241 Bacteria 3858
147 Ga0265325_10051804 3300031241 Bacteria 2109
148 Ga0265340_10002058 3300031247 Bacteria 11525
149 Ga0265340_10013035 3300031247 Bacteria 4379
150 Ga0265340_10017346 3300031247 Bacteria 3723
151 Ga0265340_10025977 3300031247 Bacteria 2963
152 Ga0265339_10019659 3300031249 Bacteria 3960
153 Ga0265339_10192419 3300031249 Bacteria 1011
154 Ga0265327_10071494 3300031251 Bacteria 1735
155 Ga0265327_10103054 3300031251 Bacteria 1374
156 Ga0265316_10016543 3300031344 Bacteria 6393
157 Ga0265316_10154981 3300031344 Bacteria 1714
158 Ga0265316_10243227 3300031344 Bacteria 1323
159 Ga0265316_10268873 3300031344 Bacteria 1248
160 Ga0265316_10478633 3300031344 Bacteria 891
161 Ga0307509_10006603 3300031507 Bacteria 15516
162 Ga0265313_10000365 3300031595 Bacteria 49111
163 Ga0265313_10008443 3300031595 Bacteria 6839
164 Ga0307508_10033747 3300031616 Bacteria 4618
165 Ga0307508_10096080 3300031616 Bacteria 2554
166 Ga0307508_10147759 3300031616 Bacteria 1955
167 Ga0316575_10007630 3300031665 Bacteria 3920
168 Ga0316579_10118274 3300031691 Bacteria 1273
169 Ga0265314_10001864 3300031711 Bacteria 22601
170 Ga0265314_10105895 3300031711 Bacteria 1797
171 Ga0265314_10150870 3300031711 Bacteria 1425
172 Ga0265314_10183601 3300031711 Bacteria 1251
173 Ga0265342_10003438 3300031712 Bacteria 13000
174 Ga0265342_10011994 3300031712 Bacteria 5887
175 Ga0265342_10013841 3300031712 Bacteria 5384
176 Ga0316578_10021288 3300031728 Bacteria 3598
177 Ga0316578_10213657 3300031728 Bacteria 1160
178 Ga0307516_10066470 3300031730 Bacteria 3477
179 Ga0307405_10190893 3300031731 Bacteria 1480
180 Ga0307410_10314702 3300031852 Bacteria 1240
181 Ga0307406_10293717 3300031901 Bacteria 1245
182 Ga0307407_10362856 3300031903 Bacteria 1029
183 Ga0307409_100240342 3300031995 Bacteria 1648
184 Ga0307415_100007578 3300032126 Bacteria 5947
185 Ga0307415_100047333 3300032126 Bacteria 2895
186 Ga0307415_100201714 3300032126 Bacteria 1579
187 Ga0307415_100478919 3300032126 Bacteria 1083
188 Ga0316593_10062895 3300032168 Bacteria 1272
189 Ga0373934_0006208 3300035086 Bacteria 4429
190 Ga0373944_0076148 3300035089 Bacteria 1101
191 Ga0373923_0061725 3300035111 Bacteria 1593
192 Ga0373923_0082406 3300035111 Bacteria 1397
193 Ga0373954_0006278 3300035118 Bacteria 5181
194 Ga0373954_0035348 3300035118 Bacteria 2317
195 Ga0373956_0005567 3300035119 Bacteria 5037
196 Ga0373956_0110713 3300035119 Bacteria 1278
197 Ga0373957_0005067 3300035120 Bacteria 4065
198 Ga0373946_0278615 3300035171 Bacteria 822
199 Ga0373955_0005956 3300035172 Bacteria 5523
200 Ga0373955_0013658 3300035172 Bacteria 3934
201 Ga0316574_0043130 3300035398 Bacteria 2786
202 Ga0373924_0028441 3300035410 Bacteria 2228
203 Ga0373924_0037174 3300035410 Bacteria 1981
204 Ga0373935_0010988 3300035692 Bacteria 5437
205 Ga0373935_0048774 3300035692 Bacteria 2682
206 Ga0373927_0033540 3300035695 Bacteria 3343
207 Ga0373933_0003694 3300035724 Bacteria 8463
208 Ga0373933_0004859 3300035724 Bacteria 7335
209 Ga0373947_0148187 3300035725 Bacteria 1510
210 Ga0373937_0005836 3300036401 Bacteria 10585
211 Ga0373937_0059398 3300036401 Bacteria 3514
212 Ga0373937_0151000 3300036401 Bacteria 2176
213 Ga0373937_0227702 3300036401 Bacteria 1755
214 Ga0316582_0272897 3300036647 Bacteria 1160
215 Ga0373925_0311157 3300037068 Bacteria 1273
216 Ga0373925_0426695 3300037068 Bacteria 1084
217 Ga0395900_0397718 3300037418 Bacteria 1343
218 Ga0395898_0153805 3300037466 Bacteria 2201
219 Ga0395905_0095818 3300037471 Bacteria 2786
220 Ga0395901_0011378 3300038443 Bacteria 9017
221 Ga0395901_0145970 3300038443 Bacteria 2487
222 Ga0395901_0263819 3300038443 Bacteria 1792
223 Ga0395901_0465738 3300038443 Bacteria 1291
224 Ga0400483_120008 3300039062 Bacteria 3120
225 Ga0400483_156580 3300039062 Bacteria 2841
226 Ga0436363_0555582 3300039450 Bacteria 1996
227 Ga0436363_0759113 3300039450 Bacteria 7088
228 Ga0439451_000586 3300042009 Bacteria 6916
229 Ga0439455_0028555 3300042012 Bacteria 1374
230 Ga0439458_0002877 3300042157 Bacteria 4139
231 Ga0466972_0079454 3300044658 Bacteria 1562
232 Ga0466966_0376273 3300044684 Unclassified 853
233 Ga0466961_0257889 3300044693 Bacteria 1069
234 Ga0451576_0018904 3300045051 Bacteria 7532
235 Ga0495592_0004491 3300046454 Bacteria 10211
236 Ga0495592_0057192 3300046454 Bacteria 2879
237 Ga0495592_0217338 3300046454 Bacteria 1280
238 Ga0495603_0006628 3300046455 Bacteria 6947
239 Ga0495603_0054054 3300046455 Bacteria 2381
240 Ga0495603_0060416 3300046455 Bacteria 2239
241 Ga0495603_0084818 3300046455 Bacteria 1855
242 Ga0495629_0122766 3300046459 Bacteria 1809
243 Ga0495629_0156174 3300046459 Bacteria 1585
244 Ga0495629_0173814 3300046459 Bacteria 1494
245 Ga0495641_0028366 3300046461 Bacteria 2710
246 Ga0495641_0102400 3300046461 Bacteria 1277
247 Ga0495651_0004793 3300046462 Bacteria 10355
248 Ga0495651_0006250 3300046462 Bacteria 9106
249 Ga0495651_0008423 3300046462 Bacteria 7902
250 Ga0495651_0030003 3300046462 Bacteria 4240
251 Ga0495651_0050271 3300046462 Bacteria 3216
252 Ga0495651_0111717 3300046462 Bacteria 2020
253 Ga0495653_0010061 3300046463 Bacteria 7737
254 Ga0495653_0017859 3300046463 Bacteria 5767
255 Ga0495653_0031650 3300046463 Bacteria 4203
256 Ga0495653_0056624 3300046463 Bacteria 2988
257 Ga0495653_0097034 3300046463 Bacteria 2142
258 Ga0495653_0311629 3300046463 Bacteria 1023
259 Ga0495580_0032729 3300046472 Bacteria 3749
260 Ga0495580_0160645 3300046472 Bacteria 1555
261 Ga0495582_0012497 3300046473 Bacteria 4680
262 Ga0495582_0017116 3300046473 Bacteria 3968
263 Ga0495582_0026885 3300046473 Bacteria 3153
264 Ga0495582_0031078 3300046473 Bacteria 2934
265 Ga0495639_0072538 3300046475 Bacteria 1592
266 Ga0495639_0146578 3300046475 Bacteria 1137
267 Ga0495662_0016526 3300046476 Bacteria 3574
268 Ga0495664_0021019 3300046477 Bacteria 3768
269 Ga0495664_0036811 3300046477 Bacteria 2886
270 Ga0495594_0164170 3300046499 Bacteria 1263
271 Ga0495608_0001055 3300046511 Bacteria 19397
272 Ga0495608_0002908 3300046511 Bacteria 12260
273 Ga0495608_0048173 3300046511 Bacteria 2832
274 Ga0495618_0009086 3300046514 Bacteria 5999
275 Ga0495618_0102781 3300046514 Bacteria 1829
276 Ga0495628_0004315 3300046516 Bacteria 12634
277 Ga0495628_0063770 3300046516 Bacteria 2886
278 Ga0495628_0094193 3300046516 Bacteria 2315
279 Ga0495630_0009173 3300046517 Bacteria 7115
280 Ga0495630_0011778 3300046517 Bacteria 6338
281 Ga0495630_0019942 3300046517 Bacteria 4936
282 Ga0495630_0028014 3300046517 Bacteria 4186
283 Ga0495630_0034497 3300046517 Bacteria 3778
284 Ga0495630_0092675 3300046517 Bacteria 2283
285 Ga0495630_0180460 3300046517 Bacteria 1610
286 Ga0495630_0544515 3300046517 Bacteria 890
287 Ga0495666_0003828 3300046526 Bacteria 7612
288 Ga0495666_0143264 3300046526 Bacteria 1113
289 Ga0495652_0007315 3300046529 Bacteria 10183
290 Ga0495652_0018787 3300046529 Bacteria 6160
291 Ga0495652_0040913 3300046529 Bacteria 4003
292 Ga0495652_0045794 3300046529 Bacteria 3758
293 Ga0495652_0064870 3300046529 Bacteria 3070
294 Ga0495665_0002165 3300046531 Bacteria 10624
295 Ga0495665_0023909 3300046531 Bacteria 3283
296 Ga0495665_0054438 3300046531 Bacteria 2114
297 Ga0495665_0059027 3300046531 Bacteria 2025
298 Ga0495665_0067785 3300046531 Bacteria 1882
299 Ga0495665_0137208 3300046531 Bacteria 1279
300 Ga0495640_0004351 3300046533 Bacteria 11308
301 Ga0495640_0010782 3300046533 Bacteria 7051
302 Ga0495640_0012455 3300046533 Bacteria 6496
303 Ga0495640_0111643 3300046533 Bacteria 1786
304 Ga0495586_0001735 3300046535 Bacteria 11886
305 Ga0495586_0047009 3300046535 Bacteria 2328
306 Ga0495586_0109316 3300046535 Bacteria 1538
307 Ga0495586_0122794 3300046535 Bacteria 1451
308 Ga0495587_0009534 3300046536 Bacteria 6218
309 Ga0495587_0009899 3300046536 Bacteria 6083
310 Ga0495587_0010516 3300046536 Bacteria 5885
311 Ga0495587_0100433 3300046536 Bacteria 1668
312 Ga0495645_0036512 3300046543 Bacteria 3581
313 Ga0495645_0146333 3300046543 Bacteria 1645
314 Ga0495645_0397379 3300046543 Bacteria 879
315 Ga0495667_0011451 3300046559 Bacteria 6002
316 Ga0495667_0011586 3300046559 Bacteria 5970
317 Ga0495667_0012302 3300046559 Bacteria 5800
318 Ga0495667_0022542 3300046559 Bacteria 4242
319 Ga0495667_0259750 3300046559 Bacteria 1105
320 Ga0495667_0297147 3300046559 Bacteria 1023
321 Ga0495667_0403606 3300046559 Bacteria 861
322 Ga0495634_0011536 3300046642 Bacteria 6429
323 Ga0495634_0026972 3300046642 Bacteria 4003
324 Ga0495634_0137796 3300046642 Bacteria 1551
325 Ga0495635_0001919 3300046663 Bacteria 14140
326 Ga0495635_0008742 3300046663 Bacteria 7071
327 Ga0495635_0019605 3300046663 Bacteria 4712
328 Ga0495635_0252271 3300046663 Bacteria 1189
329 Ga0495588_0032842 3300046674 Bacteria 2618
330 Ga0495588_0164274 3300046674 Bacteria 1174
331 Ga0495657_0004334 3300046675 Bacteria 11336
332 Ga0495657_0006683 3300046675 Bacteria 9003
333 Ga0495657_0014217 3300046675 Bacteria 5848
334 Ga0495657_0026751 3300046675 Bacteria 4082
335 Ga0495599_0002309 3300046678 Bacteria 11089
336 Ga0495599_0066803 3300046678 Bacteria 2246
337 Ga0495599_0131138 3300046678 Bacteria 1557
338 Ga0495599_0257013 3300046678 Bacteria 1062
339 Ga0495623_0111039 3300046679 Bacteria 1661
340 Ga0495646_0013377 3300046680 Bacteria 5215
341 Ga0495646_0027462 3300046680 Bacteria 3571
342 Ga0495646_0038742 3300046680 Bacteria 2941
343 Ga0495646_0060757 3300046680 Bacteria 2252
344 Ga0495647_0003397 3300046681 Bacteria 5099
345 Ga0495647_0026568 3300046681 Bacteria 2122
346 Ga0495647_0103452 3300046681 Bacteria 1182
347 Ga0495658_0066435 3300046683 Bacteria 2083
348 Ga0495658_0075065 3300046683 Bacteria 1972
349 Ga0495658_0075073 3300046683 Bacteria 1972
350 Ga0495658_0201465 3300046683 Bacteria 1241
351 Ga0495658_0204953 3300046683 Bacteria 1230
352 Ga0495613_0006126 3300046689 Bacteria 9001
353 Ga0495613_0016340 3300046689 Bacteria 5530
354 Ga0495613_0104001 3300046689 Bacteria 2050
355 Ga0495624_0225517 3300046690 Bacteria 1136
356 Ga0495600_0028142 3300046809 Bacteria 3635
357 Ga0495600_0036965 3300046809 Bacteria 3173
358 Ga0495600_0044369 3300046809 Bacteria 2900
359 Ga0495600_0063109 3300046809 Bacteria 2420
360 Ga0495600_0110851 3300046809 Bacteria 1787
361 Ga0495581_0002255 3300047315 Bacteria 10848
362 Ga0495581_0030785 3300047315 Bacteria 3109
363 Ga0495581_0139371 3300047315 Bacteria 1414
364 Ga0495604_0000981 3300047317 Bacteria 23800
365 Ga0495604_0043120 3300047317 Bacteria 3533
366 Ga0495604_0058603 3300047317 Bacteria 2956
367 Ga0495674_0014798 3300047319 Bacteria 7299
368 Ga0495674_0030939 3300047319 Bacteria 4863
369 Ga0495674_0031990 3300047319 Bacteria 4774
370 Ga0495674_0150553 3300047319 Bacteria 1951
371 Ga0495674_0563089 3300047319 Bacteria 906
372 Ga0495676_0042817 3300047321 Bacteria 3713
373 Ga0495676_0096114 3300047321 Bacteria 2203
374 Ga0495680_0003252 3300047322 Bacteria 16128
375 Ga0495680_0007627 3300047322 Bacteria 9884
376 Ga0495680_0019081 3300047322 Bacteria 5803
377 Ga0495680_0058994 3300047322 Bacteria 2964
378 Ga0495680_0173854 3300047322 Bacteria 1558
379 Ga0495684_0007018 3300047471 Bacteria 8749
380 Ga0495684_0008259 3300047471 Bacteria 8058
381 Ga0495684_0019498 3300047471 Bacteria 5224
382 Ga0495684_0295072 3300047471 Bacteria 1166
383 Ga0495593_0039528 3300047673 Bacteria 2543
384 Ga0495593_0199987 3300047673 Bacteria 1004
385 Ga0495602_0010197 3300048088 Bacteria 9752
386 Ga0495602_0031499 3300048088 Bacteria 5013
387 Ga0495602_0046275 3300048088 Bacteria 3931
388 Ga0495602_0053038 3300048088 Bacteria 3594
389 Ga0495602_0082238 3300048088 Bacteria 2703
390 Ga0495602_0224406 3300048088 Bacteria 1416
391 Ga0495614_0028733 3300048089 Bacteria 2394
392 Ga0496100_0039350 3300048903 Bacteria 3003
393 Ga0496100_0237199 3300048903 Bacteria 1344
394 Ga0496100_0302040 3300048903 Bacteria 1198
395 Ga0496101_0057693 3300048904 Bacteria 2809
396 Ga0496101_0108020 3300048904 Bacteria 2091
397 Ga0496102_0025005 3300048905 Bacteria 5312
398 Ga0496104_0047803 3300048907 Bacteria 4033
399 Ga0496104_0052456 3300048907 Bacteria 3852
400 Ga0496104_0073395 3300048907 Bacteria 3255
401 Ga0496104_0417955 3300048907 Bacteria 1253
402 Ga0496104_0664785 3300048907 Bacteria 950
403 Ga0496105_0004567 3300048908 Bacteria 10428
404 Ga0496105_0026916 3300048908 Bacteria 4693
405 Ga0496105_0047114 3300048908 Bacteria 3557
406 Ga0496108_0011849 3300048911 Bacteria 7095
407 Ga0496108_0013036 3300048911 Bacteria 6774
408 Ga0496108_0027222 3300048911 Bacteria 4719
409 Ga0496109_0002012 3300048912 Bacteria 16870
410 Ga0496109_0005694 3300048912 Bacteria 10431
411 Ga0496109_0007237 3300048912 Bacteria 9386
412 Ga0496109_0026608 3300048912 Bacteria 5160
413 Ga0496109_0079968 3300048912 Bacteria 3012
414 Ga0496109_0594836 3300048912 Bacteria 1042
415 Ga0496110_0000406 3300048913 Bacteria 29240
416 Ga0496110_0019694 3300048913 Bacteria 5685
417 Ga0496110_0029275 3300048913 Bacteria 4738
418 Ga0496110_0344619 3300048913 Bacteria 1357
419 Ga0496111_0009722 3300048914 Bacteria 6429
420 Ga0496111_0014070 3300048914 Bacteria 5457
421 Ga0496111_0018769 3300048914 Bacteria 4793
422 Ga0496111_0032072 3300048914 Bacteria 3746
423 Ga0496112_0026479 3300048915 Bacteria 5581
424 Ga0496112_0048320 3300048915 Bacteria 4172
425 Ga0496112_0064761 3300048915 Bacteria 3607
426 Ga0496112_0296834 3300048915 Bacteria 1562
427 Ga0496112_0345434 3300048915 Bacteria 1431
428 Ga0496113_0012247 3300048916 Bacteria 5758
429 Ga0496113_0015723 3300048916 Bacteria 5211
430 Ga0496113_0029630 3300048916 Bacteria 3956
431 Ga0496113_0162739 3300048916 Bacteria 1765
432 Ga0496114_0001070 3300048917 Bacteria 20594
433 Ga0496114_0036636 3300048917 Bacteria 4055
434 Ga0496114_0098388 3300048917 Bacteria 2494
435 Ga0496115_0124897 3300048918 Bacteria 2119
436 Ga0496115_0159558 3300048918 Bacteria 1864
437 Ga0496115_0205522 3300048918 Bacteria 1627
438 Ga0496115_0342492 3300048918 Bacteria 1220
439 Ga0496116_0000287 3300048919 Bacteria 85981
440 Ga0496118_0001131 3300048921 Bacteria 41154
441 Ga0496119_0001829 3300048922 Bacteria 24640
442 Ga0496120_0099811 3300048923 Bacteria 1536
443 Ga0496126_0017059 3300048929 Bacteria 7244
444 Ga0496126_0029367 3300048929 Bacteria 5223
445 Ga0501031_0037133 3300049568 Bacteria 3178
446 Ga0501033_0106086 3300049570 Bacteria 2047
447 Ga0501033_0321948 3300049570 Bacteria 1086
448 Ga0501034_0132090 3300049571 Bacteria 2479
449 Ga0501036_0079635 3300049572 Bacteria 2770
450 Ga0501036_0454634 3300049572 Bacteria 1067
451 Ga0501036_0492639 3300049572 Bacteria 1020
452 Ga0501039_0043263 3300049575 Bacteria 3479
453 Ga0501039_0423929 3300049575 Bacteria 1045
454 Ga0501040_0052848 3300049576 Bacteria 2782
455 Ga0501040_0068215 3300049576 Bacteria 2453
456 Ga0501040_0071891 3300049576 Bacteria 2389
457 Ga0501040_0084046 3300049576 Bacteria 2208
458 Ga0501040_0114100 3300049576 Bacteria 1891
459 Ga0501041_0040756 3300049577 Bacteria 2820
460 Ga0501041_0052699 3300049577 Bacteria 2481
461 Ga0501041_0151507 3300049577 Bacteria 1448
462 Ga0501042_0068382 3300049578 Bacteria 2540
463 Ga0501042_0102429 3300049578 Bacteria 2059
464 Ga0501042_0123265 3300049578 Bacteria 1866
465 Ga0501043_0017517 3300049579 Bacteria 5617
466 Ga0501043_0104976 3300049579 Bacteria 2221
467 Ga0501043_0200980 3300049579 Bacteria 1547
468 Ga0501046_0088022 3300049580 Bacteria 2392
469 Ga0501046_0274680 3300049580 Bacteria 1235
470 Ga0501047_0119739 3300049581 Bacteria 2515
471 Ga0501047_0128384 3300049581 Bacteria 2415
472 Ga0501047_0202093 3300049581 Bacteria 1848
473 Ga0501048_0082367 3300049582 Bacteria 2270
474 Ga0501048_0133012 3300049582 Bacteria 1758
475 Ga0501048_0221058 3300049582 Bacteria 1343
476 Ga0501048_0257338 3300049582 Bacteria 1240
477 Ga0501071_0011003 3300049587 Bacteria 6076
478 Ga0501071_0025508 3300049587 Bacteria 4141
479 Ga0501071_0196619 3300049587 Bacteria 1514
480 Ga0501071_0284180 3300049587 Bacteria 1252
481 Ga0501072_0004275 3300049588 Bacteria 10836
482 Ga0501073_0088077 3300049589 Bacteria 2159
483 Ga0501073_0192065 3300049589 Bacteria 1413
484 Ga0501073_0264995 3300049589 Bacteria 1186
485 Ga0501074_0097028 3300049590 Bacteria 2110
486 Ga0501074_0128562 3300049590 Bacteria 1813
487 Ga0501074_0313305 3300049590 Bacteria 1115
488 Ga0501075_0027525 3300049591 Bacteria 4190
489 Ga0501075_0452135 3300049591 Bacteria 979
490 Ga0501076_0005348 3300049592 Bacteria 9219
491 Ga0501076_0027079 3300049592 Bacteria 4446
492 Ga0501076_0110831 3300049592 Bacteria 2218
493 Ga0501076_0126686 3300049592 Bacteria 2069
494 Ga0501077_0006258 3300049593 Bacteria 7280
495 Ga0501077_0015746 3300049593 Bacteria 4762
496 Ga0501077_0303916 3300049593 Bacteria 1016
497 Ga0501079_0013750 3300049741 Bacteria 6172
498 Ga0501079_0051735 3300049741 Bacteria 3172
499 Ga0501079_0066757 3300049741 Bacteria 2776
500 Ga0501079_0191988 3300049741 Bacteria 1594
501 Ga0501080_0027770 3300049742 Bacteria 5262
502 Ga0501080_0098751 3300049742 Bacteria 2710
503 Ga0501081_0017819 3300049743 Bacteria 4708
504 Ga0501081_0078888 3300049743 Bacteria 2302
505 Ga0501081_0269441 3300049743 Bacteria 1245
506 Ga0501083_0151139 3300049744 Bacteria 1520
507 Ga0501083_0342288 3300049744 Bacteria 972
508 Ga0501083_0394607 3300049744 Bacteria 900
509 Ga0501035_0285715 3300049822 Bacteria 1393
510 Ga0501035_0359736 3300049822 Bacteria 1217
511 Ga0501044_0115477 3300049823 Bacteria 2690
512 Ga0501044_0476112 3300049823 Bacteria 1152
513 Ga0501045_0026420 3300049824 Bacteria 4176
514 Ga0501045_0027963 3300049824 Bacteria 4067
515 Ga0501045_0028678 3300049824 Bacteria 4017
516 Ga0501045_0128775 3300049824 Bacteria 1881
517 Ga0501045_0183323 3300049824 Bacteria 1560
518 Ga0501045_0229705 3300049824 Bacteria 1381
519 Ga0501045_0397826 3300049824 Bacteria 1025
520 Ga0501045_0421943 3300049824 Bacteria 992
521 Ga0501045_0526042 3300049824 Bacteria 878
522 nmdc:mga00v17_9715_c1 3300050491 Bacteria 5220
523 nmdc:mga0yw44_35552_c1 3300050492 Bacteria 2929
524 nmdc:mga05p37_270300_c1 3300050507 Bacteria 2031
525 nmdc:mga05p37_280702_c1 3300050507 Bacteria 1986
526 nmdc:mga0rr50_337252_c1 3300050513 Bacteria 1266
527 nmdc:mga0a205_49054_c1 3300050515 Bacteria 4074
528 Ga0495601_0004355 3300053077 Bacteria 8182
529 Ga0495601_0031818 3300053077 Bacteria 3280
530 Ga0495601_0042768 3300053077 Bacteria 2844
531 Ga0495601_0101822 3300053077 Bacteria 1855
532 Ga0495601_0136640 3300053077 Bacteria 1598
533 Ga0495601_0209185 3300053077 Bacteria 1274
534 Ga0495595_0004814 3300053084 Bacteria 5435
535 Ga0495595_0021157 3300053084 Bacteria 2839
536 Ga0495595_0040671 3300053084 Bacteria 2125
537 Ga0495595_0046825 3300053084 Bacteria 1993
538 Ga0495619_0050678 3300053085 Bacteria 2741
539 Ga0495619_0098370 3300053085 Bacteria 1989
540 Ga0495619_0100107 3300053085 Bacteria 1972
541 Ga0495619_0128671 3300053085 Bacteria 1739
542 Ga0495619_0381963 3300053085 Bacteria 973
543 Ga0500651_0167190 3300053093 Bacteria 1313
544 Ga0500654_098496 3300053099 Bacteria 1261
545 Ga0500573_0117149 3300053140 Bacteria 1486
546 Ga0500577_0028100 3300053142 Bacteria 1934
547 Ga0501084_0040909 3300054114 Bacteria 3878
548 Ga0501084_0048023 3300054114 Bacteria 3574
549 Ga0501084_0101199 3300054114 Bacteria 2420
550 Ga0501084_0108315 3300054114 Bacteria 2334
551 Ga0501084_0164419 3300054114 Bacteria 1873
552 Ga0501084_0213362 3300054114 Bacteria 1629
553 Ga0501084_0272934 3300054114 Bacteria 1428
554 Ga0590071_034367 3300059421 Bacteria 1213
555 Ga0501082_0017331 3300060353 Bacteria 6205
556 Ga0501082_0041174 3300060353 Bacteria 3983
557 Ga0501082_0068049 3300060353 Bacteria 3067
558 Ga0501082_0155335 3300060353 Bacteria 1988
559 Ga0530510_0003053 3300061734 Bacteria 11497
560 Ga0530510_0020270 3300061734 Bacteria 4728
561 Ga0530510_0211315 3300061734 Bacteria 1442
562 Ga0530510_0333625 3300061734 Bacteria 1138
563 Ga0530510_0445119 3300061734 Bacteria 979
564 2891560021 2891554331 Bacteria 8812224
565 2738892304 2738541308 Bacteria 7020677
566 2739235208 2738543011 Bacteria 5731169
567 2776371157 2775506925 Bacteria 7237746
568 2786667391 2786546132 Bacteria 10419719
569 2863071527 2863067949 Bacteria 8541735
570 2877676600 2877676314 Bacteria 9512378
571 2884697096 2884693830 Bacteria 11273186
572 2889301793 2889300758 Bacteria 5690814
573 2891398426 2891395885 Bacteria 9251614
574 2895449144 2895442618 Bacteria 11027144
575 2939747207 2939743619 Bacteria 5762299
576 2954673545 2954673503 Bacteria 9685905
577 2954690445 2954682443 Bacteria 9862841
578 2954712621 2954711539 Bacteria 10867210
579 2954722577 2954721474 Bacteria 10456478
580 2954739281 2954731030 Bacteria 10243860
581 2954741456 2954740390 Bacteria 10229294
582 2954758110 2954749733 Bacteria 10366972
583 8054164577 8054160619 Bacteria 7783213
584 Ga0070683_100002886
585 Ga0070683_100037296
586 Ga0070680_100024283
587 Ga0070682_100016668
588 Ga0070660_100430553
589 Ga0070689_100121821
590 Ga0070692_10080541
591 Ga0070668_100027553
592 Ga0070688_100036350
593 Ga0070688_100343114
594 Ga0070659_100026977
595 Ga0070667_100060562
596 Ga0070714_100001436
597 Ga0070714_100350421
598 Ga0070714_100553625
599 Ga0070713_100090733
600 Ga0070713_100708136
601 Ga0070710_10012451
602 Ga0070681_10003921
603 Ga0070706_100219482
604 Ga0070698_100292268
605 Ga0070679_100048380
606 Ga0070679_100542428
607 Ga0070684_100001127
608 Ga0070684_100003477
609 Ga0070684_100014569
610 Ga0070684_100041317
611 Ga0070686_100131939
612 Ga0070696_100150688
613 Ga0070693_100045573
614 Ga0070665_100516451
615 Ga0070664_100164037
616 Ga0068857_100001815
617 Ga0068857_100108753
618 Ga0070702_100011197
619 Ga0068864_100140059
620 Ga0068861_100046449
621 Ga0068858_100494219
622 Ga0068860_100013421
623 Ga0070717_10124009
624 Ga0075365_10474522
625 Ga0075364_10002312
626 Ga0070716_100278513
627 Ga0070712_100025348
628 Ga0097621_100049012
629 Ga0075428_100531892
630 Ga0075434_100000835
631 Ga0068865_100067493
632 Ga0068865_100190941
633 Ga0075435_100105427
634 Ga0105245_10018491
635 Ga0105245_10069618
636 Ga0114129_10556788
637 Ga0105243_10053483
638 Ga0105243_10366879
639 Ga0105243_10547489
640 Ga0105248_10128630
641 Ga0105237_10195012
642 Ga0105238_10067999
643 Ga0105239_10013652
644 Ga0105246_10039370
645 Ga0157374_10205949
646 Ga0163162_10235487
647 Ga0163162_10343416
648 Ga0157372_10826107
649 Ga0157375_10311434
650 Ga0157375_10888739
651 Ga0163163_10124065
652 Ga0163163_10392652
653 Ga0157377_10015147
654 Ga0157377_10019568
655 Ga0157379_10400886
656 Ga0206353_11636425
657 Ga0207692_10008802
658 Ga0207692_10065857
659 Ga0207699_10113315
660 Ga0207707_10009964
661 Ga0207693_10042461
662 Ga0207663_10117491
663 Ga0207660_10056485
664 Ga0207660_10246364
665 Ga0207657_10324515
666 Ga0207652_10002692
667 Ga0207687_10011068
668 Ga0207700_10051778
669 Ga0207700_10068219
670 Ga0207700_10084897
671 Ga0207664_10005856
672 Ga0207664_10123916
673 Ga0207664_10125322
674 Ga0207664_10138942
675 Ga0207664_10450080
676 Ga0207709_10073698
677 Ga0207709_10342105
678 Ga0207670_10209232
679 Ga0207689_10606980
680 Ga0207689_10680693
681 Ga0207661_10000541
682 Ga0207661_10129106
683 Ga0207661_10350659
684 Ga0207679_10348754
685 Ga0207679_10349123
686 Ga0207712_10078163
687 Ga0207712_10266252
688 Ga0207668_10036250
689 Ga0207668_10335346
690 Ga0207677_10354571
691 Ga0207703_10570096
692 Ga0207639_10117820
693 Ga0207708_10002912
694 Ga0207708_10606941
695 Ga0207702_10017811
696 Ga0207641_10020522
697 Ga0207641_10216862
698 Ga0207641_10676820
699 Ga0207676_10015136
700 Ga0207676_10108056
701 Ga0207676_10996630
702 Ga0207674_10000360
703 Ga0207674_10035695
704 Ga0207675_100047539
705 Ga0268265_10516342
706 Ga0268265_10537380
707 Ga0268264_10181632
708 Ga0268264_10186337
709 Ga0265337_1001058
710 Ga0265326_10004173
711 Ga0265319_1001115
712 Ga0265334_10000767
713 Ga0265318_10054789
714 Ga0265323_10080053
715 Ga0265322_10028516
716 Ga0265336_10001315
717 Ga0307517_10049780
718 Ga0307515_10002223
719 Ga0307515_10006214
720 Ga0265338_10000858
721 Ga0265324_10003471
722 Ga0307512_10011401
723 Ga0265330_10080806
724 Ga0265330_10130352
725 Ga0265332_10008842
726 Ga0265332_10095968
727 Ga0265320_10006085
728 Ga0265325_10004476
729 Ga0265325_10018549
730 Ga0265325_10051804
731 Ga0265340_10002058
732 Ga0265340_10013035
733 Ga0265340_10017346
734 Ga0265340_10025977
735 Ga0265339_10019659
736 Ga0265339_10192419
737 Ga0265327_10071494
738 Ga0265327_10103054
739 Ga0265316_10016543
740 Ga0265316_10154981
741 Ga0265316_10243227
742 Ga0265316_10268873
743 Ga0265316_10478633
744 Ga0307509_10006603
745 Ga0265313_10000365
746 Ga0265313_10008443
747 Ga0307508_10033747
748 Ga0307508_10096080
749 Ga0307508_10147759
750 Ga0316575_10007630
751 Ga0316579_10118274
752 Ga0265314_10001864
753 Ga0265314_10105895
754 Ga0265314_10150870
755 Ga0265314_10183601
756 Ga0265342_10003438
757 Ga0265342_10011994
758 Ga0265342_10013841
759 Ga0316578_10021288
760 Ga0316578_10213657
761 Ga0307516_10066470
762 Ga0307405_10190893
763 Ga0307410_10314702
764 Ga0307406_10293717
765 Ga0307407_10362856
766 Ga0307409_100240342
767 Ga0307415_100007578
768 Ga0307415_100047333
769 Ga0307415_100201714
770 Ga0307415_100478919
771 Ga0316593_10062895
772 Ga0373934_0006208
773 Ga0373944_0076148
774 Ga0373923_0061725
775 Ga0373923_0082406
776 Ga0373954_0006278
777 Ga0373954_0035348
778 Ga0373956_0005567
779 Ga0373956_0110713
780 Ga0373957_0005067
781 Ga0373946_0278615
782 Ga0373955_0005956
783 Ga0373955_0013658
784 Ga0316574_0043130
785 Ga0373924_0028441
786 Ga0373924_0037174
787 Ga0373935_0010988
788 Ga0373935_0048774
789 Ga0373927_0033540
790 Ga0373933_0003694
791 Ga0373933_0004859
792 Ga0373947_0148187
793 Ga0373937_0005836
794 Ga0373937_0059398
795 Ga0373937_0151000
796 Ga0373937_0227702
797 Ga0316582_0272897
798 Ga0373925_0311157
799 Ga0373925_0426695
800 Ga0395900_0397718
801 Ga0395898_0153805
802 Ga0395905_0095818
803 Ga0395901_0011378
804 Ga0395901_0145970
805 Ga0395901_0263819
806 Ga0395901_0465738
807 Ga0400483_120008
808 Ga0400483_156580
809 Ga0436363_0555582
810 Ga0436363_0759113
811 Ga0439451_000586
812 Ga0439455_0028555
813 Ga0439458_0002877
814 Ga0466972_0079454
815 Ga0466966_0376273
816 Ga0466961_0257889
817 Ga0451576_0018904
818 Ga0495592_0004491
819 Ga0495592_0057192
820 Ga0495592_0217338
821 Ga0495603_0006628
822 Ga0495603_0054054
823 Ga0495603_0060416
824 Ga0495603_0084818
825 Ga0495629_0122766
826 Ga0495629_0156174
827 Ga0495629_0173814
828 Ga0495641_0028366
829 Ga0495641_0102400
830 Ga0495651_0004793
831 Ga0495651_0006250
832 Ga0495651_0008423
833 Ga0495651_0030003
834 Ga0495651_0050271
835 Ga0495651_0111717
836 Ga0495653_0010061
837 Ga0495653_0017859
838 Ga0495653_0031650
839 Ga0495653_0056624
840 Ga0495653_0097034
841 Ga0495653_0311629
842 Ga0495580_0032729
843 Ga0495580_0160645
844 Ga0495582_0012497
845 Ga0495582_0017116
846 Ga0495582_0026885
847 Ga0495582_0031078
848 Ga0495639_0072538
849 Ga0495639_0146578
850 Ga0495662_0016526
851 Ga0495664_0021019
852 Ga0495664_0036811
853 Ga0495594_0164170
854 Ga0495608_0001055
855 Ga0495608_0002908
856 Ga0495608_0048173
857 Ga0495618_0009086
858 Ga0495618_0102781
859 Ga0495628_0004315
860 Ga0495628_0063770
861 Ga0495628_0094193
862 Ga0495630_0009173
863 Ga0495630_0011778
864 Ga0495630_0019942
865 Ga0495630_0028014
866 Ga0495630_0034497
867 Ga0495630_0092675
868 Ga0495630_0180460
869 Ga0495630_0544515
870 Ga0495666_0003828
871 Ga0495666_0143264
872 Ga0495652_0007315
873 Ga0495652_0018787
874 Ga0495652_0040913
875 Ga0495652_0045794
876 Ga0495652_0064870
877 Ga0495665_0002165
878 Ga0495665_0023909
879 Ga0495665_0054438
880 Ga0495665_0059027
881 Ga0495665_0067785
882 Ga0495665_0137208
883 Ga0495640_0004351
884 Ga0495640_0010782
885 Ga0495640_0012455
886 Ga0495640_0111643
887 Ga0495586_0001735
888 Ga0495586_0047009
889 Ga0495586_0109316
890 Ga0495586_0122794
891 Ga0495587_0009534
892 Ga0495587_0009899
893 Ga0495587_0010516
894 Ga0495587_0100433
895 Ga0495645_0036512
896 Ga0495645_0146333
897 Ga0495645_0397379
898 Ga0495667_0011451
899 Ga0495667_0011586
900 Ga0495667_0012302
901 Ga0495667_0022542
902 Ga0495667_0259750
903 Ga0495667_0297147
904 Ga0495667_0403606
905 Ga0495634_0011536
906 Ga0495634_0026972
907 Ga0495634_0137796
908 Ga0495635_0001919
909 Ga0495635_0008742
910 Ga0495635_0019605
911 Ga0495635_0252271
912 Ga0495588_0032842
913 Ga0495588_0164274
914 Ga0495657_0004334
915 Ga0495657_0006683
916 Ga0495657_0014217
917 Ga0495657_0026751
918 Ga0495599_0002309
919 Ga0495599_0066803
920 Ga0495599_0131138
921 Ga0495599_0257013
922 Ga0495623_0111039
923 Ga0495646_0013377
924 Ga0495646_0027462
925 Ga0495646_0038742
926 Ga0495646_0060757
927 Ga0495647_0003397
928 Ga0495647_0026568
929 Ga0495647_0103452
930 Ga0495658_0066435
931 Ga0495658_0075065
932 Ga0495658_0075073
933 Ga0495658_0201465
934 Ga0495658_0204953
935 Ga0495613_0006126
936 Ga0495613_0016340
937 Ga0495613_0104001
938 Ga0495624_0225517
939 Ga0495600_0028142
940 Ga0495600_0036965
941 Ga0495600_0044369
942 Ga0495600_0063109
943 Ga0495600_0110851
944 Ga0495581_0002255
945 Ga0495581_0030785
946 Ga0495581_0139371
947 Ga0495604_0000981
948 Ga0495604_0043120
949 Ga0495604_0058603
950 Ga0495674_0014798
951 Ga0495674_0030939
952 Ga0495674_0031990
953 Ga0495674_0150553
954 Ga0495674_0563089
955 Ga0495676_0042817
956 Ga0495676_0096114
957 Ga0495680_0003252
958 Ga0495680_0007627
959 Ga0495680_0019081
960 Ga0495680_0058994
961 Ga0495680_0173854
962 Ga0495684_0007018
963 Ga0495684_0008259
964 Ga0495684_0019498
965 Ga0495684_0295072
966 Ga0495593_0039528
967 Ga0495593_0199987
968 Ga0495602_0010197
969 Ga0495602_0031499
970 Ga0495602_0046275
971 Ga0495602_0053038
972 Ga0495602_0082238
973 Ga0495602_0224406
974 Ga0495614_0028733
975 Ga0496100_0039350
976 Ga0496100_0237199
977 Ga0496100_0302040
978 Ga0496101_0057693
979 Ga0496101_0108020
980 Ga0496102_0025005
981 Ga0496104_0047803
982 Ga0496104_0052456
983 Ga0496104_0073395
984 Ga0496104_0417955
985 Ga0496104_0664785
986 Ga0496105_0004567
987 Ga0496105_0026916
988 Ga0496105_0047114
989 Ga0496108_0011849
990 Ga0496108_0013036
991 Ga0496108_0027222
992 Ga0496109_0002012
993 Ga0496109_0005694
994 Ga0496109_0007237
995 Ga0496109_0026608
996 Ga0496109_0079968
997 Ga0496109_0594836
998 Ga0496110_0000406
999 Ga0496110_0019694
1000 Ga0496110_0029275
1001 Ga0496110_0344619
1002 Ga0496111_0009722
1003 Ga0496111_0014070
1004 Ga0496111_0018769
1005 Ga0496111_0032072
1006 Ga0496112_0026479
1007 Ga0496112_0048320
1008 Ga0496112_0064761
1009 Ga0496112_0296834
1010 Ga0496112_0345434
1011 Ga0496113_0012247
1012 Ga0496113_0015723
1013 Ga0496113_0029630
1014 Ga0496113_0162739
1015 Ga0496114_0001070
1016 Ga0496114_0036636
1017 Ga0496114_0098388
1018 Ga0496115_0124897
1019 Ga0496115_0159558
1020 Ga0496115_0205522
1021 Ga0496115_0342492
1022 Ga0496116_0000287
1023 Ga0496118_0001131
1024 Ga0496119_0001829
1025 Ga0496120_0099811
1026 Ga0496126_0017059
1027 Ga0496126_0029367
1028 Ga0501031_0037133
1029 Ga0501033_0106086
1030 Ga0501033_0321948
1031 Ga0501034_0132090
1032 Ga0501036_0079635
1033 Ga0501036_0454634
1034 Ga0501036_0492639
1035 Ga0501039_0043263
1036 Ga0501039_0423929
1037 Ga0501040_0052848
1038 Ga0501040_0068215
1039 Ga0501040_0071891
1040 Ga0501040_0084046
1041 Ga0501040_0114100
1042 Ga0501041_0040756
1043 Ga0501041_0052699
1044 Ga0501041_0151507
1045 Ga0501042_0068382
1046 Ga0501042_0102429
1047 Ga0501042_0123265
1048 Ga0501043_0017517
1049 Ga0501043_0104976
1050 Ga0501043_0200980
1051 Ga0501046_0088022
1052 Ga0501046_0274680
1053 Ga0501047_0119739
1054 Ga0501047_0128384
1055 Ga0501047_0202093
1056 Ga0501048_0082367
1057 Ga0501048_0133012
1058 Ga0501048_0221058
1059 Ga0501048_0257338
1060 Ga0501071_0011003
1061 Ga0501071_0025508
1062 Ga0501071_0196619
1063 Ga0501071_0284180
1064 Ga0501072_0004275
1065 Ga0501073_0088077
1066 Ga0501073_0192065
1067 Ga0501073_0264995
1068 Ga0501074_0097028
1069 Ga0501074_0128562
1070 Ga0501074_0313305
1071 Ga0501075_0027525
1072 Ga0501075_0452135
1073 Ga0501076_0005348
1074 Ga0501076_0027079
1075 Ga0501076_0110831
1076 Ga0501076_0126686
1077 Ga0501077_0006258
1078 Ga0501077_0015746
1079 Ga0501077_0303916
1080 Ga0501079_0013750
1081 Ga0501079_0051735
1082 Ga0501079_0066757
1083 Ga0501079_0191988
1084 Ga0501080_0027770
1085 Ga0501080_0098751
1086 Ga0501081_0017819
1087 Ga0501081_0078888
1088 Ga0501081_0269441
1089 Ga0501083_0151139
1090 Ga0501083_0342288
1091 Ga0501083_0394607
1092 Ga0501035_0285715
1093 Ga0501035_0359736
1094 Ga0501044_0115477
1095 Ga0501044_0476112
1096 Ga0501045_0026420
1097 Ga0501045_0027963
1098 Ga0501045_0028678
1099 Ga0501045_0128775
1100 Ga0501045_0183323
1101 Ga0501045_0229705
1102 Ga0501045_0397826
1103 Ga0501045_0421943
1104 Ga0501045_0526042
1105 nmdc:mga00v17_9715_c1
1106 nmdc:mga0yw44_35552_c1
1107 nmdc:mga05p37_270300_c1
1108 nmdc:mga05p37_280702_c1
1109 nmdc:mga0rr50_337252_c1
1110 nmdc:mga0a205_49054_c1
1111 Ga0495601_0004355
1112 Ga0495601_0031818
1113 Ga0495601_0042768
1114 Ga0495601_0101822
1115 Ga0495601_0136640
1116 Ga0495601_0209185
1117 Ga0495595_0004814
1118 Ga0495595_0021157
1119 Ga0495595_0040671
1120 Ga0495595_0046825
1121 Ga0495619_0050678
1122 Ga0495619_0098370
1123 Ga0495619_0100107
1124 Ga0495619_0128671
1125 Ga0495619_0381963
1126 Ga0500651_0167190
1127 Ga0500654_098496
1128 Ga0500573_0117149
1129 Ga0500577_0028100
1130 Ga0501084_0040909
1131 Ga0501084_0048023
1132 Ga0501084_0101199
1133 Ga0501084_0108315
1134 Ga0501084_0164419
1135 Ga0501084_0213362
1136 Ga0501084_0272934
1137 Ga0590071_034367
1138 Ga0501082_0017331
1139 Ga0501082_0041174
1140 Ga0501082_0068049
1141 Ga0501082_0155335
1142 Ga0530510_0003053
1143 Ga0530510_0020270
1144 Ga0530510_0211315
1145 Ga0530510_0333625
1146 Ga0530510_0445119
1147 2891560021
1148 2738892304
1149 2739235208
1150 2776371157
1151 2786667391
1152 2863071527
1153 2877676600
1154 2884697096
1155 2889301793
1156 2891398426
1157 2895449144
1158 2939747207
1159 2954673545
1160 2954690445
1161 2954712621
1162 2954722577
1163 2954739281
1164 2954741456
1165 2954758110
1166 8054164577

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01058

Oxidored_q6

NADH ubiquinone oxidoreductase, 20 Kd subunit

27

164

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qgr-assembly1.cif.gz_G the f420-reducing [nife] hydrogenase complex from methanosarcina barkeri at the nia-s state 0.7638 1 152
7t2r-assembly1.cif.gz_E structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state 0.7369 1 161
5xfa-assembly1.cif.gz_C crystal structure of nad+-reducing [nife]-hydrogenase in the h2-reduced state 0.7315 2 161
7ard-assembly1.cif.gz_B cryo-em structure of polytomella complex-i (complete composition) 0.7291 5 154
7ak6-assembly1.cif.gz_B cryo-em structure of nd6-p25l mutant respiratory complex i from mus musculus at 3.8 a 0.6985 4 154
ID Description Score Start End Superfamily
af_Q60340_4_160_3.40.50.700 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit 0.7936 4 154 3.40.50.700
af_Q58591_5_180_3.40.50.700 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit 0.7423 4 165 3.40.50.700
af_Q60340_4_160_3.40.50.700 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit 0.714 4 154 3.40.50.700
af_I6XUD2_20_159_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7078 3 155 3.40.50.12280
af_Q58136_4_129_3.40.50.700 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit 0.7013 14 154 3.40.50.700
ID Description Score Start End GO Terms
AF-A0A7C7PJ64-F1-model_v4 NADH:ubiquinone oxidoreductase-like 20kDa subunit domain-containing protein 0.9136 2 82 GO:0016491
GO:0051538
AF-A0A354BKR5-F1-model_v4 Oxidoreductase 0.8999 2 86 GO:0016491
GO:0051536
AF-A0A662GJ17-F1-model_v4 NADH:ubiquinone oxidoreductase 0.8938 2 87 GO:0016491
GO:0051536
AF-A0A3D4Z3F7-F1-model_v4 Oxidoreductase 0.8895 13 88 GO:0016491
GO:0051536
AF-A0A3D4Z3F7-F1-model_v4 Oxidoreductase 0.8788 13 88 GO:0016491
GO:0051536

Map