F466283

General Info

Members Datasets Scaffolds Average Seq Length
583 365 537 316

Family's Representative Sequence

Representative Sequence 3300026023|Ga0207677_10083188|Ga0207677_100831881
Length 345
Sequence LLRRFAPLRKRIAFVAGNDDEPSQATMTASLPAFTDYEPFRPFRADPSQWLPIALDIARSHGLACTEPQIFSTGTNLVVGLDEPLILKIFPPFLRGQFASERASLVQLRGRLAVPIPEIVLEGERDQWPYLVITRVYGQLGSVVWPRLPEDQKERVLFQIGETIADVQRVPLGDLSQIEPRWDQFIQGQIQGCRARHERLGLPQQFLAGLDDLLRDAATLTPLNVNAPPVILTGEFIPENFLLRRELEGWGVSGLIDFGDVMTGRGEYDLLGPSAFMTSGMPRRVQSLFGGFGYSAADITPDLKRRLMALMLLHRASDPVRSICIEGWQQKAADLRELQDLLWPI

Samples

Sample ID Description Type Environment
1 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
7 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
8 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
9 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
10 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
11 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
12 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
13 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
14 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
15 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
16 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
17 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
18 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
19 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
20 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
21 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
22 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
23 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
24 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
25 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
26 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
27 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
28 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
29 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
30 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
31 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
32 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
33 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
92 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
93 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
162 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
163 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
164 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
169 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
170 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
171 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
172 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
182 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
193 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
198 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
199 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
200 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
234 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
238 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
239 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
243 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
244 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
245 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
246 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
247 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
248 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
249 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
250 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
251 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
252 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
255 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
256 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
257 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
264 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
265 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
266 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
267 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
273 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
274 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
282 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
283 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
284 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
285 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
286 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
289 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
290 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
291 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
292 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
307 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
308 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
311 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
315 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
316 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
317 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
320 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
321 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
322 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
323 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
325 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
326 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
327 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
328 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
329 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
330 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
331 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
332 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
333 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
334 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
335 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
336 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
337 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
338 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
339 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
340 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
341 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
342 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
343 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
344 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
345 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
346 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
347 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
348 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
349 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
350 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
351 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
352 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
353 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
354 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
355 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
356 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
357 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
358 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
359 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
360 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
361 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
362 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
363 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
364 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
365 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.75
Metatranscriptomes 0
Isolates 7.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.32
Nodule 6.69
Rhizoplane 3.6
Rhizosphere 69.98
Stem 0
Stem Tuber 0
Unclassified 8.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10005160 3300003203 Bacteria 6059
2 JGI25165J46597_1005485 3300003214 Bacteria 2433
3 JGI25153J46596_10006239 3300003215 Bacteria 6098
4 rootH2_10211234 3300003320 Bacteria 1214
5 Ga0055543_1002478 3300004625 Bacteria 6089
6 Ga0065165_1001304 3300005262 Bacteria 27869
7 Ga0070683_100013043 3300005329 Bacteria 7236
8 Ga0070683_100136917 3300005329 Bacteria 2319
9 Ga0070670_100492120 3300005331 Bacteria 1090
10 Ga0068869_100075431 3300005334 Bacteria 2505
11 Ga0070666_10241275 3300005335 Bacteria 1278
12 Ga0070680_100228694 3300005336 Bacteria 1570
13 Ga0070682_100013158 3300005337 Bacteria 4753
14 Ga0068868_100203215 3300005338 Bacteria 1652
15 Ga0068868_100244205 3300005338 Bacteria 1509
16 Ga0070660_100458038 3300005339 Bacteria 1059
17 Ga0070668_100025353 3300005347 Bacteria 4495
18 Ga0070669_100157071 3300005353 Bacteria 1765
19 Ga0070675_100100975 3300005354 Bacteria 2430
20 Ga0070674_100052706 3300005356 Bacteria 2807
21 Ga0070673_100108350 3300005364 Bacteria 2300
22 Ga0070673_100115687 3300005364 Bacteria 2230
23 Ga0070659_100392737 3300005366 Bacteria 1170
24 Ga0070713_100010942 3300005436 Bacteria 6579
25 Ga0070711_100047715 3300005439 Bacteria 2925
26 Ga0070663_100046798 3300005455 Bacteria 3062
27 Ga0070663_100329788 3300005455 Bacteria 1230
28 Ga0070678_100054525 3300005456 Bacteria 2914
29 Ga0070678_100080739 3300005456 Bacteria 2463
30 Ga0070678_100193576 3300005456 Bacteria 1673
31 Ga0070681_10044998 3300005458 Bacteria 4418
32 Ga0070681_10060331 3300005458 Bacteria 3770
33 Ga0070681_10071598 3300005458 Bacteria 3431
34 Ga0070681_10147501 3300005458 Bacteria 2281
35 Ga0070685_10120529 3300005466 Bacteria 1628
36 Ga0070698_100311443 3300005471 Bacteria 1505
37 Ga0070679_100166533 3300005530 Bacteria 2177
38 Ga0070684_100008609 3300005535 Bacteria 7991
39 Ga0070684_100134255 3300005535 Bacteria 2234
40 Ga0070672_100055714 3300005543 Bacteria 3098
41 Ga0070672_100100938 3300005543 Bacteria 2341
42 Ga0070672_100672694 3300005543 Bacteria 905
43 Ga0070686_100124414 3300005544 Bacteria 1775
44 Ga0070665_100036744 3300005548 Bacteria 4925
45 Ga0070665_100094054 3300005548 Bacteria 3002
46 Ga0070665_100128810 3300005548 Bacteria 2533
47 Ga0068855_100058819 3300005563 Bacteria 4499
48 Ga0068855_100170497 3300005563 Bacteria 2465
49 Ga0068855_100318993 3300005563 Bacteria 1718
50 Ga0068857_100296516 3300005577 Bacteria 1490
51 Ga0068854_100408815 3300005578 Bacteria 1125
52 Ga0068852_100133026 3300005616 Bacteria 2293
53 Ga0068859_100049556 3300005617 Bacteria 4217
54 Ga0068859_100142923 3300005617 Bacteria 2466
55 Ga0068859_100299379 3300005617 Bacteria 1702
56 Ga0068866_10092684 3300005718 Bacteria 1649
57 Ga0068861_100102320 3300005719 Bacteria 2280
58 Ga0068861_100388774 3300005719 Bacteria 1235
59 Ga0068851_10156803 3300005834 Bacteria 1248
60 Ga0068858_100130009 3300005842 Bacteria 2360
61 Ga0068858_100131853 3300005842 Bacteria 2344
62 Ga0068858_100149708 3300005842 Bacteria 2193
63 Ga0068858_100242242 3300005842 Bacteria 1711
64 Ga0068858_100255051 3300005842 Bacteria 1666
65 Ga0068860_100127031 3300005843 Bacteria 2444
66 Ga0068862_100137380 3300005844 Bacteria 2167
67 Ga0068862_100187288 3300005844 Bacteria 1860
68 Ga0068862_100244330 3300005844 Bacteria 1633
69 Ga0068862_100270199 3300005844 Bacteria 1555
70 Ga0081455_10009565 3300005937 Bacteria 9956
71 Ga0081455_10012089 3300005937 Bacteria 8629
72 Ga0081455_10029339 3300005937 Bacteria 5016
73 Ga0081455_10098580 3300005937 Bacteria 2352
74 Ga0081540_1008529 3300005983 Bacteria 7152
75 Ga0081540_1033224 3300005983 Bacteria 2805
76 Ga0081540_1035801 3300005983 Bacteria 2657
77 Ga0081540_1043625 3300005983 Bacteria 2298
78 Ga0081540_1048902 3300005983 Bacteria 2114
79 Ga0081540_1061582 3300005983 Bacteria 1788
80 Ga0081539_10000466 3300005985 Bacteria 85716
81 Ga0081539_10026236 3300005985 Bacteria 3724
82 Ga0070717_10024804 3300006028 Bacteria 4765
83 Ga0075365_10027308 3300006038 Bacteria 3631
84 Ga0075365_10326779 3300006038 Bacteria 1080
85 Ga0075364_10071250 3300006051 Bacteria 2289
86 Ga0075364_10142413 3300006051 Bacteria 1613
87 Ga0070712_100166135 3300006175 Bacteria 1708
88 Ga0075367_10074239 3300006178 Bacteria 2050
89 Ga0075369_10004356 3300006186 Bacteria 5221
90 Ga0075366_10153299 3300006195 Bacteria 1396
91 Ga0097621_100166720 3300006237 Bacteria 1896
92 Ga0097621_100239366 3300006237 Bacteria 1586
93 Ga0068871_100170998 3300006358 Bacteria 1863
94 Ga0075428_100075420 3300006844 Bacteria 3683
95 Ga0068865_100033411 3300006881 Bacteria 3445
96 Ga0068865_100317964 3300006881 Bacteria 1251
97 Ga0097620_100049556 3300006931 Bacteria 4217
98 Ga0097620_100142927 3300006931 Bacteria 2466
99 Ga0097620_100299394 3300006931 Bacteria 1702
100 Ga0099825_1039555 3300006941 Bacteria 1441
101 Ga0099824_1022782 3300006942 Bacteria 4041
102 Ga0099822_1000191 3300006943 Bacteria 46107
103 Ga0099794_10037604 3300007265 Bacteria 2292
104 Ga0099795_10024414 3300007788 Bacteria 2016
105 Ga0099795_10033740 3300007788 Bacteria 1779
106 Ga0105240_10033191 3300009093 Bacteria 6672
107 Ga0105240_10045940 3300009093 Bacteria 5537
108 Ga0105245_10081624 3300009098 Bacteria 2956
109 Ga0105245_10264772 3300009098 Bacteria 1674
110 Ga0105247_10083129 3300009101 Bacteria 2022
111 Ga0105247_10149989 3300009101 Bacteria 1535
112 Ga0114129_10539134 3300009147 Bacteria 1519
113 Ga0105243_10154464 3300009148 Bacteria 1972
114 Ga0105242_10237294 3300009176 Bacteria 1637
115 Ga0105242_10302228 3300009176 Bacteria 1461
116 Ga0105237_10061212 3300009545 Bacteria 3765
117 Ga0105237_10185795 3300009545 Bacteria 2078
118 Ga0105237_10293073 3300009545 Bacteria 1630
119 Ga0105238_10053408 3300009551 Bacteria 4061
120 Ga0105249_10058920 3300009553 Bacteria 3521
121 Ga0105239_10063442 3300010375 Bacteria 4057
122 Ga0105239_10084776 3300010375 Bacteria 3491
123 Ga0105239_10109735 3300010375 Bacteria 3058
124 Ga0105246_10011436 3300011119 Bacteria 5508
125 Ga0105246_10071182 3300011119 Bacteria 2448
126 Ga0105246_10079941 3300011119 Bacteria 2326
127 Ga0105246_10172349 3300011119 Bacteria 1658
128 Ga0105246_10297981 3300011119 Bacteria 1300
129 Ga0157370_10059659 3300013104 Bacteria 3625
130 Ga0157370_10217308 3300013104 Bacteria 1771
131 Ga0157369_10004320 3300013105 Bacteria 16785
132 Ga0157369_10047026 3300013105 Bacteria 4686
133 Ga0157374_10041150 3300013296 Bacteria 4257
134 Ga0157378_10153466 3300013297 Bacteria 2147
135 Ga0163162_10091495 3300013306 Bacteria 3125
136 Ga0163162_10243381 3300013306 Bacteria 1930
137 Ga0163162_10303167 3300013306 Bacteria 1730
138 Ga0163162_10433832 3300013306 Bacteria 1446
139 Ga0157372_10068595 3300013307 Bacteria 3987
140 Ga0157372_10108343 3300013307 Bacteria 3179
141 Ga0157375_10021897 3300013308 Bacteria 5874
142 Ga0157375_10032188 3300013308 Bacteria 4971
143 Ga0157375_10185864 3300013308 Bacteria 2231
144 Ga0157375_10393938 3300013308 Bacteria 1552
145 Ga0163163_10005029 3300014325 Bacteria 11395
146 Ga0163163_10273801 3300014325 Bacteria 1739
147 Ga0163163_10516576 3300014325 Bacteria 1257
148 Ga0157380_10273041 3300014326 Bacteria 1542
149 Ga0157379_10094307 3300014968 Bacteria 2685
150 Ga0157379_10192298 3300014968 Bacteria 1844
151 Ga0157376_10034273 3300014969 Bacteria 4098
152 Ga0157376_10086467 3300014969 Bacteria 2703
153 Ga0163161_10140385 3300017792 Bacteria 1829
154 Ga0213874_10018972 3300021377 Bacteria 1867
155 Ga0213876_10006031 3300021384 Bacteria 6623
156 Ga0213876_10062484 3300021384 Bacteria 1966
157 Ga0213875_10058191 3300021388 Bacteria 1809
158 Ga0209233_1006575 3300025261 Bacteria 3737
159 Ga0209758_1015431 3300025297 Bacteria 3955
160 Ga0209758_1020677 3300025297 Bacteria 3101
161 Ga0207697_10070847 3300025315 Bacteria 1461
162 Ga0207692_10000547 3300025898 Bacteria 13349
163 Ga0207688_10153378 3300025901 Bacteria 1362
164 Ga0207647_10235185 3300025904 Bacteria 1053
165 Ga0207699_10000386 3300025906 Bacteria 23177
166 Ga0207699_10068446 3300025906 Bacteria 2162
167 Ga0207645_10077204 3300025907 Bacteria 2134
168 Ga0207654_10107316 3300025911 Bacteria 1731
169 Ga0207707_10000816 3300025912 Bacteria 30547
170 Ga0207707_10016028 3300025912 Bacteria 6536
171 Ga0207707_10153825 3300025912 Bacteria 2011
172 Ga0207695_10006231 3300025913 Bacteria 15536
173 Ga0207671_10094023 3300025914 Bacteria 2262
174 Ga0207671_10187330 3300025914 Bacteria 1612
175 Ga0207660_10160335 3300025917 Bacteria 1735
176 Ga0207662_10066293 3300025918 Bacteria 2175
177 Ga0207657_10076677 3300025919 Bacteria 2819
178 Ga0207652_10010669 3300025921 Bacteria 7399
179 Ga0207652_10060900 3300025921 Bacteria 3258
180 Ga0207652_10262764 3300025921 Bacteria 1557
181 Ga0207694_10202133 3300025924 Bacteria 1617
182 Ga0207687_10011663 3300025927 Bacteria 5746
183 Ga0207700_10080287 3300025928 Bacteria 2543
184 Ga0207709_10052935 3300025935 Bacteria 2496
185 Ga0207704_10158833 3300025938 Bacteria 1606
186 Ga0207665_10001425 3300025939 Bacteria 16086
187 Ga0207691_10043846 3300025940 Bacteria 4120
188 Ga0207691_10056812 3300025940 Bacteria 3564
189 Ga0207689_10132535 3300025942 Bacteria 2051
190 Ga0207689_10232134 3300025942 Bacteria 1525
191 Ga0207661_10015027 3300025944 Bacteria 5686
192 Ga0207661_10241050 3300025944 Bacteria 1604
193 Ga0207679_10384057 3300025945 Bacteria 1232
194 Ga0207667_10054494 3300025949 Bacteria 4206
195 Ga0207667_10177915 3300025949 Bacteria 2185
196 Ga0207667_10506228 3300025949 Bacteria 1224
197 Ga0207668_10010779 3300025972 Bacteria 5535
198 Ga0207668_10017444 3300025972 Bacteria 4498
199 Ga0207668_10211583 3300025972 Bacteria 1551
200 Ga0207668_10356067 3300025972 Bacteria 1225
201 Ga0207640_10164248 3300025981 Bacteria 1647
202 Ga0207677_10083188 3300026023 Bacteria 2303
203 Ga0207639_10058388 3300026041 Bacteria 2968
204 Ga0207639_10111932 3300026041 Bacteria 2226
205 Ga0207678_10027066 3300026067 Bacteria 5001
206 Ga0207678_10194728 3300026067 Bacteria 1732
207 Ga0207708_10346341 3300026075 Bacteria 1218
208 Ga0207702_10043472 3300026078 Bacteria 3772
209 Ga0207648_10018779 3300026089 Bacteria 6251
210 Ga0207674_10311608 3300026116 Bacteria 1523
211 Ga0207675_100071021 3300026118 Bacteria 3255
212 Ga0207675_100108650 3300026118 Bacteria 2616
213 Ga0207675_100125592 3300026118 Bacteria 2430
214 Ga0207675_100289114 3300026118 Bacteria 1594
215 Ga0207683_10028790 3300026121 Bacteria 4806
216 Ga0207683_10037875 3300026121 Bacteria 4201
217 Ga0207683_10061169 3300026121 Bacteria 3314
218 Ga0207683_10101869 3300026121 Bacteria 2564
219 Ga0207683_10107730 3300026121 Bacteria 2493
220 Ga0207683_10121783 3300026121 Bacteria 2343
221 Ga0207683_10163379 3300026121 Bacteria 2014
222 Ga0207698_10280814 3300026142 Bacteria 1540
223 Ga0209589_1000055 3300027357 Bacteria 111890
224 Ga0209489_100128 3300027361 Bacteria 111890
225 Ga0209700_100137 3300027363 Bacteria 111890
226 Ga0209179_1005696 3300027512 Bacteria 1966
227 Ga0209179_1009592 3300027512 Bacteria 1665
228 Ga0209588_1028322 3300027671 Bacteria 1783
229 Ga0268266_10042528 3300028379 Bacteria 3881
230 Ga0268266_10179348 3300028379 Bacteria 1927
231 Ga0268265_10105795 3300028380 Bacteria 2284
232 Ga0268265_10112000 3300028380 Bacteria 2230
233 Ga0268265_10199029 3300028380 Bacteria 1736
234 Ga0268265_10300959 3300028380 Bacteria 1444
235 Ga0265337_1013180 3300028556 Bacteria 2785
236 Ga0265319_1013300 3300028563 Bacteria 3281
237 Ga0265334_10001581 3300028573 Bacteria 10962
238 Ga0265318_10019887 3300028577 Bacteria 2718
239 Ga0265336_10001044 3300028666 Bacteria 13533
240 Ga0265338_10000024 3300028800 Bacteria 297778
241 Ga0265324_10003580 3300029957 Bacteria 7322
242 Ga0265332_10042052 3300031238 Bacteria 1976
243 Ga0265328_10034325 3300031239 Bacteria 1879
244 Ga0265325_10025938 3300031241 Bacteria 3179
245 Ga0265339_10072118 3300031249 Bacteria 1838
246 Ga0265331_10041322 3300031250 Bacteria 2241
247 Ga0307509_10237597 3300031507 Bacteria 1618
248 Ga0307509_10305253 3300031507 Bacteria 1337
249 Ga0307509_10402687 3300031507 Bacteria 1074
250 Ga0265313_10040983 3300031595 Bacteria 2285
251 Ga0307508_10039969 3300031616 Bacteria 4213
252 Ga0265314_10181694 3300031711 Bacteria 1260
253 Ga0307516_10096712 3300031730 Bacteria 2773
254 Ga0307406_10144211 3300031901 Bacteria 1690
255 Ga0307409_100094838 3300031995 Bacteria 2456
256 Ga0307409_100305476 3300031995 Bacteria 1482
257 Ga0307416_100193344 3300032002 Bacteria 1922
258 Ga0307416_100432717 3300032002 Bacteria 1363
259 Ga0307411_10318663 3300032005 Bacteria 1254
260 Ga0307415_100239642 3300032126 Bacteria 1466
261 Ga0307507_10094791 3300033179 Bacteria 2535
262 Ga0307510_10007534 3300033180 Bacteria 12965
263 Ga0307510_10053110 3300033180 Bacteria 4264
264 Ga0315911_1000024 3300033442 Bacteria 97712
265 Ga0373934_0001199 3300035086 Bacteria 9393
266 Ga0373923_0000022 3300035111 Bacteria 23262
267 Ga0373923_0007505 3300035111 Bacteria 3837
268 Ga0373936_0016695 3300035113 Bacteria 2825
269 Ga0373945_0005833 3300035116 Bacteria 3953
270 Ga0373945_0035171 3300035116 Bacteria 1789
271 Ga0373953_0000468 3300035117 Bacteria 11120
272 Ga0373954_0000519 3300035118 Bacteria 14460
273 Ga0373954_0134691 3300035118 Bacteria 1204
274 Ga0373956_0002504 3300035119 Bacteria 7478
275 Ga0373956_0111959 3300035119 Bacteria 1271
276 Ga0373957_0000581 3300035120 Bacteria 9243
277 Ga0373943_0001466 3300035170 Bacteria 10672
278 Ga0373943_0026917 3300035170 Bacteria 2698
279 Ga0373943_0044897 3300035170 Bacteria 2151
280 Ga0373946_0025124 3300035171 Bacteria 2341
281 Ga0373955_0000402 3300035172 Bacteria 18349
282 Ga0373924_0003157 3300035410 Bacteria 5631
283 Ga0373924_0006169 3300035410 Bacteria 4284
284 Ga0373935_0000244 3300035692 Bacteria 26819
285 Ga0373935_0045315 3300035692 Bacteria 2775
286 Ga0373935_0081433 3300035692 Bacteria 2104
287 Ga0373927_0025022 3300035695 Bacteria 3903
288 Ga0373927_0097055 3300035695 Bacteria 1915
289 Ga0373933_0000114 3300035724 Bacteria 52016
290 Ga0373933_0000374 3300035724 Bacteria 28691
291 Ga0373933_0098258 3300035724 Bacteria 1814
292 Ga0373947_0004892 3300035725 Bacteria 7840
293 Ga0373937_0003416 3300036401 Bacteria 13330
294 Ga0373925_0012695 3300037068 Bacteria 6101
295 Ga0373925_0062792 3300037068 Bacteria 2793
296 Ga0395900_0026692 3300037418 Bacteria 5912
297 Ga0395898_0004631 3300037466 Bacteria 15002
298 Ga0395898_0073042 3300037466 Bacteria 3313
299 Ga0436364_0777503 3300037853 Bacteria 3747
300 Ga0395901_0059735 3300038443 Bacteria 3967
301 Ga0436365_1115617 3300039437 Bacteria 2530
302 Ga0436365_1293604 3300039437 Bacteria 3359
303 Ga0436363_1082211 3300039450 Bacteria 2150
304 Ga0436362_0749727 3300039453 Bacteria 2643
305 Ga0466957_0042736 3300044842 Bacteria 2743
306 Ga0466957_0087966 3300044842 Bacteria 1943
307 Ga0466960_0045989 3300044901 Bacteria 2087
308 Ga0466958_0275431 3300045836 Bacteria 1078
309 Ga0495592_0002074 3300046454 Bacteria 14129
310 Ga0495592_0142504 3300046454 Bacteria 1665
311 Ga0495603_0000370 3300046455 Bacteria 24383
312 Ga0495603_0025895 3300046455 Bacteria 3546
313 Ga0495590_0047989 3300046457 Bacteria 1489
314 Ga0495629_0000081 3300046459 Bacteria 85305
315 Ga0495629_0000380 3300046459 Bacteria 37205
316 Ga0495629_0210465 3300046459 Bacteria 1343
317 Ga0495638_0011951 3300046460 Bacteria 5968
318 Ga0495638_0053069 3300046460 Bacteria 2523
319 Ga0495638_0164057 3300046460 Bacteria 1279
320 Ga0495641_0010022 3300046461 Bacteria 5556
321 Ga0495651_0014993 3300046462 Bacteria 5989
322 Ga0495580_0003868 3300046472 Bacteria 12674
323 Ga0495582_0000051 3300046473 Bacteria 59010
324 Ga0495605_0047519 3300046474 Bacteria 2105
325 Ga0495639_0000010 3300046475 Bacteria 93685
326 Ga0495639_0018281 3300046475 Bacteria 3050
327 Ga0495639_0031626 3300046475 Bacteria 2357
328 Ga0495664_0009894 3300046477 Bacteria 5349
329 Ga0495664_0041991 3300046477 Bacteria 2707
330 Ga0495664_0093780 3300046477 Bacteria 1806
331 Ga0495664_0254464 3300046477 Bacteria 1062
332 Ga0495584_0067523 3300046491 Bacteria 1797
333 Ga0495584_0107481 3300046491 Bacteria 1411
334 Ga0495584_0116425 3300046491 Bacteria 1353
335 Ga0495584_0167027 3300046491 Bacteria 1118
336 Ga0495585_0028557 3300046492 Bacteria 3181
337 Ga0495594_0001074 3300046499 Bacteria 14256
338 Ga0495594_0045416 3300046499 Bacteria 2411
339 Ga0495594_0156642 3300046499 Bacteria 1294
340 Ga0495608_0008172 3300046511 Bacteria 7348
341 Ga0495610_0022155 3300046512 Bacteria 3480
342 Ga0495616_0038018 3300046513 Bacteria 2473
343 Ga0495616_0057832 3300046513 Bacteria 1911
344 Ga0495618_0084248 3300046514 Bacteria 2031
345 Ga0495628_0006360 3300046516 Bacteria 10325
346 Ga0495628_0058702 3300046516 Bacteria 3022
347 Ga0495628_0073947 3300046516 Bacteria 2655
348 Ga0495630_0005257 3300046517 Bacteria 9131
349 Ga0495630_0027348 3300046517 Bacteria 4230
350 Ga0495631_0084020 3300046518 Bacteria 1372
351 Ga0495631_0139210 3300046518 Bacteria 1042
352 Ga0495632_0045554 3300046519 Bacteria 2184
353 Ga0495643_0010324 3300046522 Bacteria 5750
354 Ga0495644_0059195 3300046523 Bacteria 1440
355 Ga0495663_0018464 3300046525 Bacteria 1986
356 Ga0495652_0007397 3300046529 Bacteria 10125
357 Ga0495652_0028959 3300046529 Bacteria 4866
358 Ga0495652_0066013 3300046529 Bacteria 3039
359 Ga0495665_0000005 3300046531 Bacteria 86491
360 Ga0495640_0000301 3300046533 Bacteria 33996
361 Ga0495640_0029278 3300046533 Bacteria 3956
362 Ga0495640_0038921 3300046533 Bacteria 3341
363 Ga0495586_0074156 3300046535 Bacteria 1862
364 Ga0495587_0002764 3300046536 Bacteria 11712
365 Ga0495598_0001714 3300046537 Bacteria 4394
366 Ga0495598_0014228 3300046537 Bacteria 1986
367 Ga0495645_0011053 3300046543 Bacteria 6344
368 Ga0495622_0001809 3300046557 Bacteria 10530
369 Ga0495622_0051134 3300046557 Bacteria 1917
370 Ga0495633_0028798 3300046558 Bacteria 2704
371 Ga0495633_0091097 3300046558 Bacteria 1417
372 Ga0495667_0002956 3300046559 Bacteria 11399
373 Ga0495656_0004197 3300046615 Bacteria 4920
374 Ga0495656_0010666 3300046615 Bacteria 3347
375 Ga0495668_0089959 3300046616 Bacteria 1682
376 Ga0495668_0100025 3300046616 Bacteria 1586
377 Ga0495634_0000764 3300046642 Bacteria 31101
378 Ga0495634_0010702 3300046642 Bacteria 6713
379 Ga0495611_0046609 3300046648 Bacteria 1944
380 Ga0495611_0132196 3300046648 Bacteria 1164
381 Ga0495625_0060007 3300046660 Bacteria 2696
382 Ga0495625_0062924 3300046660 Bacteria 2621
383 Ga0495625_0100848 3300046660 Bacteria 1984
384 Ga0495635_0000213 3300046663 Bacteria 36809
385 Ga0495635_0011036 3300046663 Bacteria 6334
386 Ga0495635_0274639 3300046663 Bacteria 1133
387 Ga0495659_0001624 3300046664 Bacteria 7546
388 Ga0495659_0002657 3300046664 Bacteria 5753
389 Ga0495588_0008118 3300046674 Bacteria 4800
390 Ga0495588_0016706 3300046674 Bacteria 3550
391 Ga0495588_0079805 3300046674 Bacteria 1708
392 Ga0495657_0015790 3300046675 Bacteria 5516
393 Ga0495599_0043648 3300046678 Bacteria 2814
394 Ga0495599_0059778 3300046678 Bacteria 2384
395 Ga0495646_0009214 3300046680 Bacteria 6264
396 Ga0495646_0012040 3300046680 Bacteria 5503
397 Ga0495646_0017126 3300046680 Bacteria 4600
398 Ga0495647_0019117 3300046681 Bacteria 2447
399 Ga0495647_0021128 3300046681 Bacteria 2342
400 Ga0495658_0008495 3300046683 Bacteria 5090
401 Ga0495658_0011732 3300046683 Bacteria 4416
402 Ga0495658_0149931 3300046683 Bacteria 1432
403 Ga0495669_0025017 3300046684 Bacteria 2602
404 Ga0495669_0069057 3300046684 Bacteria 1608
405 Ga0495613_0007909 3300046689 Bacteria 7909
406 Ga0495613_0041536 3300046689 Bacteria 3406
407 Ga0495624_0000094 3300046690 Bacteria 59911
408 Ga0495649_0031715 3300046694 Bacteria 2913
409 Ga0495589_0087310 3300046794 Bacteria 1515
410 Ga0495589_0099858 3300046794 Bacteria 1405
411 Ga0495600_0001029 3300046809 Bacteria 15081
412 Ga0495660_0041199 3300046810 Bacteria 2559
413 Ga0495581_0001146 3300047315 Bacteria 14489
414 Ga0495581_0227254 3300047315 Bacteria 1092
415 Ga0495604_0005951 3300047317 Bacteria 9677
416 Ga0495604_0181886 3300047317 Bacteria 1470
417 Ga0495636_0034558 3300047318 Bacteria 2081
418 Ga0495674_0000134 3300047319 Bacteria 56618
419 Ga0495674_0013244 3300047319 Bacteria 7754
420 Ga0495672_0016185 3300047320 Bacteria 5039
421 Ga0495672_0041142 3300047320 Bacteria 2797
422 Ga0495672_0099378 3300047320 Bacteria 1582
423 Ga0495676_0111796 3300047321 Bacteria 2003
424 Ga0495680_0002637 3300047322 Bacteria 18206
425 Ga0495683_0086940 3300047323 Bacteria 1519
426 Ga0495675_0000756 3300047444 Bacteria 20233
427 Ga0495677_0039017 3300047445 Bacteria 1736
428 Ga0495677_0052584 3300047445 Bacteria 1501
429 Ga0495684_0000052 3300047471 Bacteria 85125
430 Ga0495684_0005982 3300047471 Bacteria 9452
431 Ga0495684_0007719 3300047471 Bacteria 8329
432 Ga0495593_0000084 3300047673 Bacteria 41155
433 Ga0495593_0000518 3300047673 Bacteria 21864
434 Ga0495593_0030563 3300047673 Bacteria 2947
435 Ga0495614_0056293 3300048089 Bacteria 1688
436 Ga0495615_0013052 3300048090 Bacteria 1728
437 Ga0495626_0039608 3300048091 Bacteria 2230
438 Ga0496100_0013812 3300048903 Bacteria 4671
439 Ga0496102_0005804 3300048905 Bacteria 10496
440 Ga0496103_0023140 3300048906 Bacteria 3746
441 Ga0496104_0039927 3300048907 Bacteria 4396
442 Ga0496106_0247514 3300048909 Bacteria 1425
443 Ga0496106_0347380 3300048909 Bacteria 1192
444 Ga0496107_0016390 3300048910 Bacteria 5202
445 Ga0496107_0208845 3300048910 Bacteria 1452
446 Ga0496108_0012856 3300048911 Bacteria 6818
447 Ga0496109_0016364 3300048912 Bacteria 6482
448 Ga0496110_0100507 3300048913 Bacteria 2592
449 Ga0496111_0025250 3300048914 Bacteria 4192
450 Ga0496112_0069765 3300048915 Bacteria 3471
451 Ga0496112_0413543 3300048915 Bacteria 1288
452 Ga0496113_0020850 3300048916 Bacteria 4615
453 Ga0496113_0416570 3300048916 Bacteria 1079
454 Ga0496114_0016833 3300048917 Bacteria 5896
455 Ga0496114_0178261 3300048917 Bacteria 1855
456 Ga0496115_0001776 3300048918 Bacteria 15451
457 Ga0496115_0391744 3300048918 Bacteria 1128
458 Ga0496117_0010024 3300048920 Bacteria 8707
459 Ga0496118_0012015 3300048921 Bacteria 8367
460 Ga0496118_0124129 3300048921 Bacteria 1676
461 Ga0496118_0135871 3300048921 Bacteria 1569
462 Ga0496120_0052513 3300048923 Bacteria 2321
463 Ga0496121_0002340 3300048924 Bacteria 29257
464 Ga0496121_0004993 3300048924 Bacteria 17367
465 Ga0496121_0060700 3300048924 Bacteria 3108
466 Ga0496121_0101832 3300048924 Bacteria 2214
467 Ga0496121_0184619 3300048924 Bacteria 1501
468 Ga0496121_0230402 3300048924 Bacteria 1298
469 Ga0496121_0248698 3300048924 Bacteria 1234
470 Ga0496124_0223048 3300048927 Bacteria 1416
471 Ga0496125_0157408 3300048928 Bacteria 1549
472 Ga0496126_0089405 3300048929 Bacteria 2711
473 Ga0496126_0119677 3300048929 Bacteria 2285
474 Ga0496126_0199212 3300048929 Bacteria 1692
475 Ga0496126_0284739 3300048929 Bacteria 1368
476 Ga0496126_0286454 3300048929 Bacteria 1363
477 Ga0496126_0373232 3300048929 Bacteria 1163
478 Ga0501047_0046968 3300049581 Bacteria 4172
479 Ga0501067_0066626 3300049583 Bacteria 1993
480 Ga0501070_0064188 3300049586 Bacteria 3041
481 nmdc:mga00v17_121556_c1 3300050491 Bacteria 1663
482 nmdc:mga0yw44_246584_c1 3300050492 Bacteria 1188
483 nmdc:mga0yw44_77243_c1 3300050492 Bacteria 2080
484 nmdc:mga0k408_196813_c1 3300050493 Bacteria 1203
485 nmdc:mga0sz30_13283_c1 3300050516 Bacteria 3222
486 Ga0495601_0032539 3300053077 Bacteria 3247
487 Ga0495601_0215782 3300053077 Bacteria 1253
488 Ga0495612_0147994 3300053078 Bacteria 1021
489 Ga0500635_0013807 3300053080 Bacteria 2354
490 Ga0500635_0018312 3300053080 Bacteria 2111
491 Ga0500635_0024833 3300053080 Bacteria 1884
492 Ga0495595_0000279 3300053084 Bacteria 20119
493 Ga0495619_0091211 3300053085 Bacteria 2063
494 Ga0500578_0140548 3300053086 Bacteria 1510
495 Ga0500643_000091 3300053087 Bacteria 93825
496 Ga0500651_0001238 3300053093 Bacteria 12692
497 Ga0500566_0000762 3300053094 Bacteria 18172
498 Ga0500640_104185 3300053095 Bacteria 1167
499 Ga0500641_0028991 3300053096 Bacteria 2166
500 Ga0500641_0032707 3300053096 Bacteria 2059
501 Ga0500554_002407 3300053102 Bacteria 3676
502 Ga0500554_006683 3300053102 Bacteria 2605
503 Ga0500555_001359 3300053103 Bacteria 7623
504 Ga0500556_0010118 3300053104 Bacteria 2759
505 Ga0500562_005656 3300053108 Bacteria 3145
506 Ga0500562_029053 3300053108 Bacteria 1454
507 Ga0500595_000199 3300053119 Bacteria 40993
508 Ga0500595_002625 3300053119 Bacteria 8752
509 Ga0500595_009809 3300053119 Bacteria 3846
510 Ga0500595_028833 3300053119 Bacteria 1889
511 Ga0500595_039188 3300053119 Bacteria 1535
512 Ga0500614_044558 3300053123 Bacteria 1141
513 Ga0500618_000261 3300053125 Bacteria 41070
514 Ga0500642_0001930 3300053130 Bacteria 6007
515 Ga0500642_0031781 3300053130 Bacteria 2209
516 Ga0500658_0003734 3300053134 Bacteria 5735
517 Ga0500561_0051472 3300053137 Bacteria 1125
518 Ga0500568_0080002 3300053139 Bacteria 1241
519 Ga0500568_0095530 3300053139 Bacteria 1118
520 Ga0500588_0037424 3300053146 Bacteria 1441
521 Ga0500590_014489 3300053148 Bacteria 4066
522 Ga0500603_007126 3300053150 Bacteria 2449
523 Ga0500622_0025248 3300053156 Bacteria 3140
524 Ga0500622_0035703 3300053156 Bacteria 2601
525 Ga0500630_055180 3300053159 Bacteria 1910
526 Ga0500633_0044065 3300053160 Bacteria 1513
527 Ga0500634_0131051 3300053161 Bacteria 1204
528 Ga0500638_017623 3300053162 Bacteria 3318
529 Ga0500639_002046 3300053163 Bacteria 10075
530 Ga0500636_0095356 3300053177 Bacteria 1698
531 Ga0500636_0099606 3300053177 Bacteria 1654
532 Ga0500637_0000155 3300053178 Bacteria 25033
533 Ga0500637_0000757 3300053178 Bacteria 12952
534 Ga0500637_0078433 3300053178 Bacteria 1906
535 Ga0500596_001525 3300053735 Bacteria 4691
536 Ga0500599_000697 3300053736 Bacteria 3628
537 Ga0500661_000885 3300055283 Bacteria 5610

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048921 Ga0496118_0135871 Ga0496118_0135871_762_1559 260
2 3300005339 Ga0070660_100458038 Ga0070660_1004580381 266
3 3300025981 Ga0207640_10164248 Ga0207640_101642483 270
4 3300005578 Ga0068854_100408815 Ga0068854_1004088151 272
5 3300047445 Ga0495677_0039017 Ga0495677_0039017_418_1242 272
6 3300053146 Ga0500588_0037424 Ga0500588_0037424_11_835 273
7 iso_pu_bacteria 8019659431 8019667412 275
8 3300005543 Ga0070672_100672694 Ga0070672_1006726942 276
9 3300026121 Ga0207683_10061169 Ga0207683_100611693 276
10 3300025942 Ga0207689_10132535 Ga0207689_101325351 277
11 3300046477 Ga0495664_0254464 Ga0495664_0254464_190_1032 280
12 3300046529 Ga0495652_0028959 Ga0495652_0028959_3233_4090 284
13 3300005548 Ga0070665_100036744 Ga0070665_1000367444 285
14 3300028379 Ga0268266_10042528 Ga0268266_100425284 285
15 3300048923 Ga0496120_0052513 Ga0496120_0052513_1025_2002 285
16 3300053087 Ga0500643_000091 Ga0500643_000091_82784_83764 286
17 3300053104 Ga0500556_0010118 Ga0500556_0010118_1031_2011 286
18 iso_pu_bacteria 8019555841 8019563233 289
19 3300011119 Ga0105246_10297981 Ga0105246_102979812 291
20 3300031711 Ga0265314_10181694 Ga0265314_101816941 292
21 3300037466 Ga0395898_0073042 Ga0395898_0073042_15_896 293
22 3300005458 Ga0070681_10071598 Ga0070681_100715982 301
23 3300025912 Ga0207707_10016028 Ga0207707_100160284 301
24 3300053177 Ga0500636_0099606 Ga0500636_0099606_480_1430 303
25 3300003214 JGI25165J46597_1005485 JGI25165J46597_10054852 305
26 3300025261 Ga0209233_1006575 Ga0209233_10065752 305
27 3300005548 Ga0070665_100128810 Ga0070665_1001288102 307
28 3300033180 Ga0307510_10053110 Ga0307510_100531102 307
29 3300046460 Ga0495638_0053069 Ga0495638_0053069_1484_2440 307
30 3300035111 Ga0373923_0007505 Ga0373923_0007505_28_957 309
31 3300035116 Ga0373945_0005833 Ga0373945_0005833_1446_2375 309
32 3300035170 Ga0373943_0026917 Ga0373943_0026917_1609_2538 309
33 3300037068 Ga0373925_0062792 Ga0373925_0062792_443_1372 309
34 3300044842 Ga0466957_0042736 Ga0466957_0042736_25_954 309
35 3300046475 Ga0495639_0018281 Ga0495639_0018281_1840_2769 309
36 3300046477 Ga0495664_0041991 Ga0495664_0041991_1452_2381 309
37 3300046514 Ga0495618_0084248 Ga0495618_0084248_1082_2011 309
38 3300046516 Ga0495628_0058702 Ga0495628_0058702_1475_2404 309
39 3300046517 Ga0495630_0027348 Ga0495630_0027348_1785_2714 309
40 3300046529 Ga0495652_0066013 Ga0495652_0066013_1501_2430 309
41 3300046533 Ga0495640_0038921 Ga0495640_0038921_1247_2176 309
42 3300046663 Ga0495635_0274639 Ga0495635_0274639_138_1067 309
43 3300046680 Ga0495646_0012040 Ga0495646_0012040_166_1095 309
44 3300046683 Ga0495658_0008495 Ga0495658_0008495_1619_2548 309
45 3300046689 Ga0495613_0041536 Ga0495613_0041536_1168_2097 309
46 3300047471 Ga0495684_0005982 Ga0495684_0005982_1546_2475 309
47 3300047673 Ga0495593_0030563 Ga0495593_0030563_1702_2631 309
48 3300048924 Ga0496121_0184619 Ga0496121_0184619_172_1125 309
49 3300004625 Ga0055543_1002478 Ga0055543_10024785 311
50 3300005262 Ga0065165_1001304 Ga0065165_100130417 311
51 3300033180 Ga0307510_10007534 Ga0307510_100075344 311
52 3300035692 Ga0373935_0045315 Ga0373935_0045315_878_1849 311
53 3300044901 Ga0466960_0045989 Ga0466960_0045989_800_1747 311
54 3300046460 Ga0495638_0011951 Ga0495638_0011951_1056_2036 311
55 3300046694 Ga0495649_0031715 Ga0495649_0031715_1760_2740 311
56 3300053103 Ga0500555_001359 Ga0500555_001359_1038_2018 311
57 3300053108 Ga0500562_005656 Ga0500562_005656_459_1439 311
58 3300053130 Ga0500642_0031781 Ga0500642_0031781_162_1142 311
59 3300053134 Ga0500658_0003734 Ga0500658_0003734_3074_4054 311
60 3300053156 Ga0500622_0025248 Ga0500622_0025248_470_1450 311
61 3300053736 Ga0500599_000697 Ga0500599_000697_2058_3038 311
62 iso_pu_bacteria 2511231028 2511400233 311
63 iso_pu_bacteria 2513237096 2513656478 311
64 iso_pu_bacteria 2513237098 2513673004 311
65 iso_pu_bacteria 2513237137 2513858948 311
66 iso_pu_bacteria 2513237145 2513917343 311
67 iso_pu_bacteria 2517572143 2517889566 311
68 iso_pu_bacteria 2791355197 2793073653 311
69 iso_pu_bacteria 2903748898 2903754119 311
70 iso_pu_bacteria 2904690495 2904692132 311
71 iso_pu_bacteria 2908756301 2908757414 311
72 iso_pu_bacteria 2935630451 2935635065 311
73 iso_pu_bacteria 2941507105 2941511656 311
74 iso_pu_bacteria 2941515067 2941519361 311
75 iso_pu_bacteria 2941523033 2941527515 311
76 iso_pu_bacteria 8019565922 8019573312 311
77 3300035170 Ga0373943_0044897 Ga0373943_0044897_622_1629 312
78 iso_pu_bacteria 2524023228 2524539558 312
79 iso_pu_bacteria 2908739725 2908748066 312
80 iso_pu_bacteria 2922361189 2922363302 312
81 iso_pu_bacteria 2922425934 2922433526 312
82 iso_pu_bacteria 8006994254 8007000276 312
83 iso_pu_bacteria 8056689827 8056692778 312
84 3300025906 Ga0207699_10068446 Ga0207699_100684462 313
85 3300026089 Ga0207648_10018779 Ga0207648_100187793 313
86 3300048929 Ga0496126_0089405 Ga0496126_0089405_1539_2483 313
87 iso_pu_bacteria 2513237101 2513694895 313
88 iso_pu_bacteria 2667528175 2671121244 313
89 iso_pu_bacteria 2721755755 2723842052 313
90 iso_pu_bacteria 2791355199 2793077398 313
91 iso_pu_bacteria 2841911363 2841913566 313
92 iso_pu_bacteria 2841917233 2841919313 313
93 iso_pu_bacteria 2874604998 2874610330 313
94 iso_pu_bacteria 2876808645 2876812807 313
95 iso_pu_bacteria 2879110137 2879111651 313
96 iso_pu_bacteria 2885374607 2885375072 313
97 iso_pu_bacteria 2889033259 2889035042 313
98 iso_pu_bacteria 2903768456 2903772297 313
99 iso_pu_bacteria 2904699407 2904709388 313
100 iso_pu_bacteria 2906610324 2906613054 313
101 iso_pu_bacteria 2922386360 2922388585 313
102 iso_pu_bacteria 8006933436 8006935577 313
103 iso_pu_bacteria 8006984368 8006985902 313
104 iso_pu_bacteria 8056673599 8056677757 313
105 3300005331 Ga0070670_100492120 Ga0070670_1004921201 314
106 3300005334 Ga0068869_100075431 Ga0068869_1000754312 314
107 3300005347 Ga0070668_100025353 Ga0070668_1000253532 314
108 3300005436 Ga0070713_100010942 Ga0070713_1000109421 314
109 3300005455 Ga0070663_100046798 Ga0070663_1000467982 314
110 3300005456 Ga0070678_100080739 Ga0070678_1000807392 314
111 3300005458 Ga0070681_10147501 Ga0070681_101475012 314
112 3300005563 Ga0068855_100170497 Ga0068855_1001704972 314
113 3300005577 Ga0068857_100296516 Ga0068857_1002965162 314
114 3300005617 Ga0068859_100049556 Ga0068859_1000495562 314
115 3300005719 Ga0068861_100102320 Ga0068861_1001023202 314
116 3300005842 Ga0068858_100130009 Ga0068858_1001300092 314
117 3300005843 Ga0068860_100127031 Ga0068860_1001270312 314
118 3300005844 Ga0068862_100187288 Ga0068862_1001872882 314
119 3300005983 Ga0081540_1033224 Ga0081540_10332242 314
120 3300006051 Ga0075364_10071250 Ga0075364_100712502 314
121 3300006175 Ga0070712_100166135 Ga0070712_1001661353 314
122 3300006237 Ga0097621_100166720 Ga0097621_1001667202 314
123 3300006358 Ga0068871_100170998 Ga0068871_1001709982 314
124 3300006931 Ga0097620_100049556 Ga0097620_1000495562 314
125 3300009098 Ga0105245_10081624 Ga0105245_100816242 314
126 3300009101 Ga0105247_10083129 Ga0105247_100831291 314
127 3300009545 Ga0105237_10061212 Ga0105237_100612122 314
128 3300010375 Ga0105239_10109735 Ga0105239_101097353 314
129 3300011119 Ga0105246_10071182 Ga0105246_100711822 314
130 3300013297 Ga0157378_10153466 Ga0157378_101534662 314
131 3300013306 Ga0163162_10433832 Ga0163162_104338321 314
132 3300013308 Ga0157375_10393938 Ga0157375_103939382 314
133 3300014968 Ga0157379_10192298 Ga0157379_101922982 314
134 3300014969 Ga0157376_10034273 Ga0157376_100342734 314
135 3300025315 Ga0207697_10070847 Ga0207697_100708472 314
136 3300025901 Ga0207688_10153378 Ga0207688_101533782 314
137 3300025904 Ga0207647_10235185 Ga0207647_102351851 314
138 3300025911 Ga0207654_10107316 Ga0207654_101073162 314
139 3300025912 Ga0207707_10153825 Ga0207707_101538253 314
140 3300025914 Ga0207671_10094023 Ga0207671_100940232 314
141 3300025921 Ga0207652_10010669 Ga0207652_100106693 314
142 3300025924 Ga0207694_10202133 Ga0207694_102021331 314
143 3300025927 Ga0207687_10011663 Ga0207687_100116634 314
144 3300025928 Ga0207700_10080287 Ga0207700_100802872 314
145 3300025949 Ga0207667_10177915 Ga0207667_101779152 314
146 3300025972 Ga0207668_10010779 Ga0207668_100107794 314
147 3300026116 Ga0207674_10311608 Ga0207674_103116081 314
148 3300026118 Ga0207675_100071021 Ga0207675_1000710212 314
149 3300026118 Ga0207675_100108650 Ga0207675_1001086502 314
150 3300026121 Ga0207683_10121783 Ga0207683_101217832 314
151 3300028380 Ga0268265_10112000 Ga0268265_101120002 314
152 3300031901 Ga0307406_10144211 Ga0307406_101442112 314
153 3300044842 Ga0466957_0087966 Ga0466957_0087966_865_1809 314
154 3300045836 Ga0466958_0275431 Ga0466958_0275431_122_1066 314
155 3300046513 Ga0495616_0038018 Ga0495616_0038018_935_1882 314
156 3300046519 Ga0495632_0045554 Ga0495632_0045554_852_1799 314
157 3300046660 Ga0495625_0060007 Ga0495625_0060007_1416_2363 314
158 3300047320 Ga0495672_0041142 Ga0495672_0041142_418_1368 314
159 3300048091 Ga0495626_0039608 Ga0495626_0039608_222_1169 314
160 3300048916 Ga0496113_0416570 Ga0496113_0416570_78_1028 314
161 3300048929 Ga0496126_0119677 Ga0496126_0119677_1246_2193 314
162 3300048929 Ga0496126_0286454 Ga0496126_0286454_13_960 314
163 3300048929 Ga0496126_0373232 Ga0496126_0373232_59_1009 314
164 3300050491 nmdc:mga00v17_121556_c1 nmdc:mga00v17_121556_c1_605_1555 314
165 3300053096 Ga0500641_0028991 Ga0500641_0028991_296_1246 314
166 3300053125 Ga0500618_000261 Ga0500618_000261_6081_7034 314
167 3300053160 Ga0500633_0044065 Ga0500633_0044065_533_1483 314
168 3300003215 JGI25153J46596_10006239 JGI25153J46596_100062395 315
169 3300003320 rootH2_10211234 rootH2_102112341 315
170 3300005329 Ga0070683_100013043 Ga0070683_1000130433 315
171 3300005329 Ga0070683_100136917 Ga0070683_1001369172 315
172 3300005335 Ga0070666_10241275 Ga0070666_102412751 315
173 3300005336 Ga0070680_100228694 Ga0070680_1002286942 315
174 3300005337 Ga0070682_100013158 Ga0070682_1000131581 315
175 3300005338 Ga0068868_100203215 Ga0068868_1002032152 315
176 3300005338 Ga0068868_100244205 Ga0068868_1002442052 315
177 3300005353 Ga0070669_100157071 Ga0070669_1001570711 315
178 3300005354 Ga0070675_100100975 Ga0070675_1001009752 315
179 3300005356 Ga0070674_100052706 Ga0070674_1000527062 315
180 3300005364 Ga0070673_100108350 Ga0070673_1001083502 315
181 3300005364 Ga0070673_100115687 Ga0070673_1001156871 315
182 3300005366 Ga0070659_100392737 Ga0070659_1003927371 315
183 3300005439 Ga0070711_100047715 Ga0070711_1000477152 315
184 3300005455 Ga0070663_100329788 Ga0070663_1003297881 315
185 3300005456 Ga0070678_100054525 Ga0070678_1000545253 315
186 3300005456 Ga0070678_100193576 Ga0070678_1001935762 315
187 3300005458 Ga0070681_10044998 Ga0070681_100449982 315
188 3300005458 Ga0070681_10060331 Ga0070681_100603313 315
189 3300005466 Ga0070685_10120529 Ga0070685_101205292 315
190 3300005471 Ga0070698_100311443 Ga0070698_1003114431 315
191 3300005530 Ga0070679_100166533 Ga0070679_1001665332 315
192 3300005535 Ga0070684_100008609 Ga0070684_1000086095 315
193 3300005535 Ga0070684_100134255 Ga0070684_1001342552 315
194 3300005543 Ga0070672_100055714 Ga0070672_1000557142 315
195 3300005543 Ga0070672_100100938 Ga0070672_1001009382 315
196 3300005544 Ga0070686_100124414 Ga0070686_1001244142 315
197 3300005548 Ga0070665_100094054 Ga0070665_1000940542 315
198 3300005563 Ga0068855_100058819 Ga0068855_1000588191 315
199 3300005563 Ga0068855_100318993 Ga0068855_1003189932 315
200 3300005616 Ga0068852_100133026 Ga0068852_1001330261 315
201 3300005617 Ga0068859_100142923 Ga0068859_1001429232 315
202 3300005617 Ga0068859_100299379 Ga0068859_1002993792 315
203 3300005718 Ga0068866_10092684 Ga0068866_100926841 315
204 3300005719 Ga0068861_100388774 Ga0068861_1003887741 315
205 3300005834 Ga0068851_10156803 Ga0068851_101568031 315
206 3300005842 Ga0068858_100131853 Ga0068858_1001318531 315
207 3300005842 Ga0068858_100149708 Ga0068858_1001497082 315
208 3300005842 Ga0068858_100242242 Ga0068858_1002422421 315
209 3300005842 Ga0068858_100255051 Ga0068858_1002550512 315
210 3300005844 Ga0068862_100137380 Ga0068862_1001373801 315
211 3300005844 Ga0068862_100244330 Ga0068862_1002443302 315
212 3300005844 Ga0068862_100270199 Ga0068862_1002701991 315
213 3300005937 Ga0081455_10009565 Ga0081455_100095657 315
214 3300005937 Ga0081455_10029339 Ga0081455_100293394 315
215 3300005937 Ga0081455_10098580 Ga0081455_100985802 315
216 3300005983 Ga0081540_1008529 Ga0081540_10085292 315
217 3300005983 Ga0081540_1043625 Ga0081540_10436252 315
218 3300005983 Ga0081540_1048902 Ga0081540_10489022 315
219 3300005983 Ga0081540_1061582 Ga0081540_10615822 315
220 3300006028 Ga0070717_10024804 Ga0070717_100248044 315
221 3300006038 Ga0075365_10027308 Ga0075365_100273082 315
222 3300006038 Ga0075365_10326779 Ga0075365_103267791 315
223 3300006051 Ga0075364_10142413 Ga0075364_101424131 315
224 3300006178 Ga0075367_10074239 Ga0075367_100742392 315
225 3300006186 Ga0075369_10004356 Ga0075369_100043564 315
226 3300006195 Ga0075366_10153299 Ga0075366_101532992 315
227 3300006237 Ga0097621_100239366 Ga0097621_1002393662 315
228 3300006844 Ga0075428_100075420 Ga0075428_1000754202 315
229 3300006881 Ga0068865_100033411 Ga0068865_1000334111 315
230 3300006881 Ga0068865_100317964 Ga0068865_1003179641 315
231 3300006931 Ga0097620_100142927 Ga0097620_1001429272 315
232 3300006931 Ga0097620_100299394 Ga0097620_1002993942 315
233 3300006941 Ga0099825_1039555 Ga0099825_10395552 315
234 3300006942 Ga0099824_1022782 Ga0099824_10227822 315
235 3300006943 Ga0099822_1000191 Ga0099822_10001912 315
236 3300007265 Ga0099794_10037604 Ga0099794_100376042 315
237 3300007788 Ga0099795_10024414 Ga0099795_100244142 315
238 3300007788 Ga0099795_10033740 Ga0099795_100337402 315
239 3300009093 Ga0105240_10033191 Ga0105240_100331915 315
240 3300009093 Ga0105240_10045940 Ga0105240_100459402 315
241 3300009098 Ga0105245_10264772 Ga0105245_102647722 315
242 3300009101 Ga0105247_10149989 Ga0105247_101499892 315
243 3300009147 Ga0114129_10539134 Ga0114129_105391342 315
244 3300009148 Ga0105243_10154464 Ga0105243_101544642 315
245 3300009176 Ga0105242_10237294 Ga0105242_102372942 315
246 3300009176 Ga0105242_10302228 Ga0105242_103022282 315
247 3300009545 Ga0105237_10185795 Ga0105237_101857952 315
248 3300009545 Ga0105237_10293073 Ga0105237_102930732 315
249 3300009551 Ga0105238_10053408 Ga0105238_100534083 315
250 3300009553 Ga0105249_10058920 Ga0105249_100589203 315
251 3300010375 Ga0105239_10063442 Ga0105239_100634422 315
252 3300010375 Ga0105239_10084776 Ga0105239_100847763 315
253 3300011119 Ga0105246_10011436 Ga0105246_100114364 315
254 3300011119 Ga0105246_10079941 Ga0105246_100799412 315
255 3300011119 Ga0105246_10172349 Ga0105246_101723491 315
256 3300013104 Ga0157370_10059659 Ga0157370_100596592 315
257 3300013104 Ga0157370_10217308 Ga0157370_102173082 315
258 3300013105 Ga0157369_10004320 Ga0157369_1000432012 315
259 3300013105 Ga0157369_10047026 Ga0157369_100470264 315
260 3300013296 Ga0157374_10041150 Ga0157374_100411504 315
261 3300013306 Ga0163162_10091495 Ga0163162_100914952 315
262 3300013306 Ga0163162_10243381 Ga0163162_102433812 315
263 3300013306 Ga0163162_10303167 Ga0163162_103031672 315
264 3300013307 Ga0157372_10068595 Ga0157372_100685953 315
265 3300013307 Ga0157372_10108343 Ga0157372_101083432 315
266 3300013308 Ga0157375_10021897 Ga0157375_100218973 315
267 3300013308 Ga0157375_10032188 Ga0157375_100321884 315
268 3300013308 Ga0157375_10185864 Ga0157375_101858642 315
269 3300014325 Ga0163163_10005029 Ga0163163_100050299 315
270 3300014325 Ga0163163_10273801 Ga0163163_102738012 315
271 3300014325 Ga0163163_10516576 Ga0163163_105165761 315
272 3300014326 Ga0157380_10273041 Ga0157380_102730411 315
273 3300014968 Ga0157379_10094307 Ga0157379_100943072 315
274 3300014969 Ga0157376_10086467 Ga0157376_100864672 315
275 3300017792 Ga0163161_10140385 Ga0163161_101403852 315
276 3300021377 Ga0213874_10018972 Ga0213874_100189723 315
277 3300021384 Ga0213876_10006031 Ga0213876_100060314 315
278 3300021384 Ga0213876_10062484 Ga0213876_100624843 315
279 3300021388 Ga0213875_10058191 Ga0213875_100581912 315
280 3300025297 Ga0209758_1015431 Ga0209758_10154312 315
281 3300025297 Ga0209758_1020677 Ga0209758_10206772 315
282 3300025898 Ga0207692_10000547 Ga0207692_100005475 315
283 3300025906 Ga0207699_10000386 Ga0207699_100003867 315
284 3300025907 Ga0207645_10077204 Ga0207645_100772042 315
285 3300025912 Ga0207707_10000816 Ga0207707_1000081629 315
286 3300025913 Ga0207695_10006231 Ga0207695_1000623110 315
287 3300025914 Ga0207671_10187330 Ga0207671_101873302 315
288 3300025917 Ga0207660_10160335 Ga0207660_101603352 315
289 3300025918 Ga0207662_10066293 Ga0207662_100662932 315
290 3300025919 Ga0207657_10076677 Ga0207657_100766771 315
291 3300025921 Ga0207652_10060900 Ga0207652_100609003 315
292 3300025921 Ga0207652_10262764 Ga0207652_102627642 315
293 3300025935 Ga0207709_10052935 Ga0207709_100529352 315
294 3300025938 Ga0207704_10158833 Ga0207704_101588332 315
295 3300025939 Ga0207665_10001425 Ga0207665_1000142511 315
296 3300025940 Ga0207691_10043846 Ga0207691_100438462 315
297 3300025940 Ga0207691_10056812 Ga0207691_100568121 315
298 3300025942 Ga0207689_10232134 Ga0207689_102321341 315
299 3300025944 Ga0207661_10015027 Ga0207661_100150274 315
300 3300025944 Ga0207661_10241050 Ga0207661_102410502 315
301 3300025945 Ga0207679_10384057 Ga0207679_103840572 315
302 3300025949 Ga0207667_10054494 Ga0207667_100544944 315
303 3300025949 Ga0207667_10506228 Ga0207667_105062281 315
304 3300025972 Ga0207668_10017444 Ga0207668_100174444 315
305 3300025972 Ga0207668_10211583 Ga0207668_102115831 315
306 3300025972 Ga0207668_10356067 Ga0207668_103560671 315
307 3300026023 Ga0207677_10083188 Ga0207677_100831881 315
308 3300026041 Ga0207639_10058388 Ga0207639_100583882 315
309 3300026041 Ga0207639_10111932 Ga0207639_101119322 315
310 3300026067 Ga0207678_10027066 Ga0207678_100270663 315
311 3300026067 Ga0207678_10194728 Ga0207678_101947281 315
312 3300026075 Ga0207708_10346341 Ga0207708_103463412 315
313 3300026078 Ga0207702_10043472 Ga0207702_100434723 315
314 3300026118 Ga0207675_100125592 Ga0207675_1001255922 315
315 3300026118 Ga0207675_100289114 Ga0207675_1002891141 315
316 3300026121 Ga0207683_10028790 Ga0207683_100287904 315
317 3300026121 Ga0207683_10037875 Ga0207683_100378753 315
318 3300026121 Ga0207683_10107730 Ga0207683_101077302 315
319 3300026121 Ga0207683_10163379 Ga0207683_101633792 315
320 3300026142 Ga0207698_10280814 Ga0207698_102808141 315
321 3300027357 Ga0209589_1000055 Ga0209589_10000552 315
322 3300027361 Ga0209489_100128 Ga0209489_1001282 315
323 3300027363 Ga0209700_100137 Ga0209700_1001372 315
324 3300027512 Ga0209179_1005696 Ga0209179_10056962 315
325 3300027512 Ga0209179_1009592 Ga0209179_10095922 315
326 3300027671 Ga0209588_1028322 Ga0209588_10283222 315
327 3300028379 Ga0268266_10179348 Ga0268266_101793481 315
328 3300028380 Ga0268265_10105795 Ga0268265_101057951 315
329 3300028380 Ga0268265_10199029 Ga0268265_101990292 315
330 3300028380 Ga0268265_10300959 Ga0268265_103009592 315
331 3300028556 Ga0265337_1013180 Ga0265337_10131801 315
332 3300028563 Ga0265319_1013300 Ga0265319_10133003 315
333 3300028573 Ga0265334_10001581 Ga0265334_1000158111 315
334 3300028577 Ga0265318_10019887 Ga0265318_100198872 315
335 3300028666 Ga0265336_10001044 Ga0265336_100010441 315
336 3300028800 Ga0265338_10000024 Ga0265338_10000024116 315
337 3300029957 Ga0265324_10003580 Ga0265324_100035802 315
338 3300031238 Ga0265332_10042052 Ga0265332_100420522 315
339 3300031239 Ga0265328_10034325 Ga0265328_100343252 315
340 3300031241 Ga0265325_10025938 Ga0265325_100259382 315
341 3300031249 Ga0265339_10072118 Ga0265339_100721181 315
342 3300031250 Ga0265331_10041322 Ga0265331_100413222 315
343 3300031507 Ga0307509_10305253 Ga0307509_103052531 315
344 3300031595 Ga0265313_10040983 Ga0265313_100409832 315
345 3300031616 Ga0307508_10039969 Ga0307508_100399692 315
346 3300031730 Ga0307516_10096712 Ga0307516_100967122 315
347 3300031995 Ga0307409_100094838 Ga0307409_1000948382 315
348 3300031995 Ga0307409_100305476 Ga0307409_1003054762 315
349 3300032002 Ga0307416_100193344 Ga0307416_1001933442 315
350 3300032002 Ga0307416_100432717 Ga0307416_1004327171 315
351 3300032005 Ga0307411_10318663 Ga0307411_103186631 315
352 3300032126 Ga0307415_100239642 Ga0307415_1002396422 315
353 3300033442 Ga0315911_1000024 Ga0315911_100002446 315
354 3300035086 Ga0373934_0001199 Ga0373934_0001199_5910_6860 315
355 3300035111 Ga0373923_0000022 Ga0373923_0000022_7114_8064 315
356 3300035113 Ga0373936_0016695 Ga0373936_0016695_862_1812 315
357 3300035116 Ga0373945_0035171 Ga0373945_0035171_582_1532 315
358 3300035117 Ga0373953_0000468 Ga0373953_0000468_6279_7229 315
359 3300035118 Ga0373954_0000519 Ga0373954_0000519_4391_5341 315
360 3300035118 Ga0373954_0134691 Ga0373954_0134691_39_992 315
361 3300035119 Ga0373956_0002504 Ga0373956_0002504_101_1051 315
362 3300035119 Ga0373956_0111959 Ga0373956_0111959_200_1153 315
363 3300035120 Ga0373957_0000581 Ga0373957_0000581_1852_2802 315
364 3300035170 Ga0373943_0001466 Ga0373943_0001466_1151_2101 315
365 3300035171 Ga0373946_0025124 Ga0373946_0025124_1178_2128 315
366 3300035172 Ga0373955_0000402 Ga0373955_0000402_9958_10908 315
367 3300035410 Ga0373924_0003157 Ga0373924_0003157_1840_2790 315
368 3300035410 Ga0373924_0006169 Ga0373924_0006169_1428_2378 315
369 3300035692 Ga0373935_0000244 Ga0373935_0000244_19312_20262 315
370 3300035692 Ga0373935_0081433 Ga0373935_0081433_10_963 315
371 3300035695 Ga0373927_0025022 Ga0373927_0025022_2063_3016 315
372 3300035695 Ga0373927_0097055 Ga0373927_0097055_32_985 315
373 3300035724 Ga0373933_0000114 Ga0373933_0000114_44483_45433 315
374 3300035724 Ga0373933_0000374 Ga0373933_0000374_15507_16457 315
375 3300035724 Ga0373933_0098258 Ga0373933_0098258_696_1646 315
376 3300035725 Ga0373947_0004892 Ga0373947_0004892_1041_1991 315
377 3300036401 Ga0373937_0003416 Ga0373937_0003416_3857_4807 315
378 3300037068 Ga0373925_0012695 Ga0373925_0012695_782_1732 315
379 3300037418 Ga0395900_0026692 Ga0395900_0026692_2415_3365 315
380 3300037466 Ga0395898_0004631 Ga0395898_0004631_11848_12798 315
381 3300037853 Ga0436364_0777503 Ga0436364_0777503_1400_2395 315
382 3300038443 Ga0395901_0059735 Ga0395901_0059735_493_1443 315
383 3300039437 Ga0436365_1115617 Ga0436365_1115617_928_1878 315
384 3300039437 Ga0436365_1293604 Ga0436365_1293604_545_1498 315
385 3300039450 Ga0436363_1082211 Ga0436363_1082211_202_1155 315
386 3300039453 Ga0436362_0749727 Ga0436362_0749727_564_1514 315
387 3300046454 Ga0495592_0002074 Ga0495592_0002074_5079_6029 315
388 3300046454 Ga0495592_0142504 Ga0495592_0142504_695_1645 315
389 3300046455 Ga0495603_0000370 Ga0495603_0000370_14388_15338 315
390 3300046457 Ga0495590_0047989 Ga0495590_0047989_245_1198 315
391 3300046459 Ga0495629_0000081 Ga0495629_0000081_10701_11651 315
392 3300046459 Ga0495629_0000380 Ga0495629_0000380_23206_24156 315
393 3300046459 Ga0495629_0210465 Ga0495629_0210465_313_1281 315
394 3300046460 Ga0495638_0164057 Ga0495638_0164057_286_1239 315
395 3300046461 Ga0495641_0010022 Ga0495641_0010022_4240_5190 315
396 3300046462 Ga0495651_0014993 Ga0495651_0014993_265_1215 315
397 3300046472 Ga0495580_0003868 Ga0495580_0003868_10153_11103 315
398 3300046473 Ga0495582_0000051 Ga0495582_0000051_34150_35100 315
399 3300046474 Ga0495605_0047519 Ga0495605_0047519_356_1309 315
400 3300046475 Ga0495639_0000010 Ga0495639_0000010_65337_66287 315
401 3300046475 Ga0495639_0031626 Ga0495639_0031626_60_1013 315
402 3300046477 Ga0495664_0009894 Ga0495664_0009894_3199_4149 315
403 3300046477 Ga0495664_0093780 Ga0495664_0093780_708_1661 315
404 3300046491 Ga0495584_0067523 Ga0495584_0067523_117_1070 315
405 3300046491 Ga0495584_0107481 Ga0495584_0107481_22_978 315
406 3300046491 Ga0495584_0116425 Ga0495584_0116425_175_1128 315
407 3300046491 Ga0495584_0167027 Ga0495584_0167027_10_963 315
408 3300046492 Ga0495585_0028557 Ga0495585_0028557_2009_2962 315
409 3300046499 Ga0495594_0001074 Ga0495594_0001074_9056_10006 315
410 3300046499 Ga0495594_0045416 Ga0495594_0045416_261_1214 315
411 3300046499 Ga0495594_0156642 Ga0495594_0156642_295_1251 315
412 3300046511 Ga0495608_0008172 Ga0495608_0008172_1448_2398 315
413 3300046513 Ga0495616_0057832 Ga0495616_0057832_517_1470 315
414 3300046516 Ga0495628_0006360 Ga0495628_0006360_1410_2360 315
415 3300046516 Ga0495628_0073947 Ga0495628_0073947_830_1780 315
416 3300046517 Ga0495630_0005257 Ga0495630_0005257_1033_1983 315
417 3300046518 Ga0495631_0139210 Ga0495631_0139210_35_988 315
418 3300046523 Ga0495644_0059195 Ga0495644_0059195_373_1326 315
419 3300046525 Ga0495663_0018464 Ga0495663_0018464_560_1513 315
420 3300046529 Ga0495652_0007397 Ga0495652_0007397_652_1602 315
421 3300046531 Ga0495665_0000005 Ga0495665_0000005_52464_53414 315
422 3300046533 Ga0495640_0000301 Ga0495640_0000301_28927_29877 315
423 3300046533 Ga0495640_0029278 Ga0495640_0029278_1003_1953 315
424 3300046535 Ga0495586_0074156 Ga0495586_0074156_229_1179 315
425 3300046536 Ga0495587_0002764 Ga0495587_0002764_9315_10265 315
426 3300046537 Ga0495598_0001714 Ga0495598_0001714_1269_2222 315
427 3300046537 Ga0495598_0014228 Ga0495598_0014228_111_1064 315
428 3300046543 Ga0495645_0011053 Ga0495645_0011053_1002_1952 315
429 3300046557 Ga0495622_0001809 Ga0495622_0001809_8610_9560 315
430 3300046557 Ga0495622_0051134 Ga0495622_0051134_500_1453 315
431 3300046558 Ga0495633_0028798 Ga0495633_0028798_289_1242 315
432 3300046558 Ga0495633_0091097 Ga0495633_0091097_167_1120 315
433 3300046559 Ga0495667_0002956 Ga0495667_0002956_3857_4807 315
434 3300046615 Ga0495656_0004197 Ga0495656_0004197_1506_2459 315
435 3300046615 Ga0495656_0010666 Ga0495656_0010666_2175_3128 315
436 3300046616 Ga0495668_0089959 Ga0495668_0089959_624_1577 315
437 3300046616 Ga0495668_0100025 Ga0495668_0100025_356_1309 315
438 3300046642 Ga0495634_0000764 Ga0495634_0000764_10919_11869 315
439 3300046642 Ga0495634_0010702 Ga0495634_0010702_4905_5855 315
440 3300046648 Ga0495611_0046609 Ga0495611_0046609_807_1760 315
441 3300046648 Ga0495611_0132196 Ga0495611_0132196_22_975 315
442 3300046660 Ga0495625_0062924 Ga0495625_0062924_262_1215 315
443 3300046660 Ga0495625_0100848 Ga0495625_0100848_936_1892 315
444 3300046663 Ga0495635_0000213 Ga0495635_0000213_9509_10459 315
445 3300046663 Ga0495635_0011036 Ga0495635_0011036_232_1182 315
446 3300046664 Ga0495659_0001624 Ga0495659_0001624_2188_3141 315
447 3300046664 Ga0495659_0002657 Ga0495659_0002657_1695_2648 315
448 3300046674 Ga0495588_0008118 Ga0495588_0008118_153_1106 315
449 3300046674 Ga0495588_0016706 Ga0495588_0016706_1864_2814 315
450 3300046674 Ga0495588_0079805 Ga0495588_0079805_319_1275 315
451 3300046675 Ga0495657_0015790 Ga0495657_0015790_1448_2398 315
452 3300046678 Ga0495599_0043648 Ga0495599_0043648_1651_2601 315
453 3300046678 Ga0495599_0059778 Ga0495599_0059778_328_1281 315
454 3300046680 Ga0495646_0009214 Ga0495646_0009214_189_1139 315
455 3300046680 Ga0495646_0017126 Ga0495646_0017126_706_1656 315
456 3300046681 Ga0495647_0019117 Ga0495647_0019117_633_1583 315
457 3300046681 Ga0495647_0021128 Ga0495647_0021128_827_1780 315
458 3300046683 Ga0495658_0011732 Ga0495658_0011732_2892_3842 315
459 3300046684 Ga0495669_0025017 Ga0495669_0025017_1628_2584 315
460 3300046684 Ga0495669_0069057 Ga0495669_0069057_559_1512 315
461 3300046689 Ga0495613_0007909 Ga0495613_0007909_1003_1953 315
462 3300046690 Ga0495624_0000094 Ga0495624_0000094_30094_31044 315
463 3300046794 Ga0495589_0087310 Ga0495589_0087310_148_1104 315
464 3300046794 Ga0495589_0099858 Ga0495589_0099858_92_1045 315
465 3300046809 Ga0495600_0001029 Ga0495600_0001029_7152_8102 315
466 3300047315 Ga0495581_0001146 Ga0495581_0001146_4483_5433 315
467 3300047315 Ga0495581_0227254 Ga0495581_0227254_79_1029 315
468 3300047317 Ga0495604_0005951 Ga0495604_0005951_1576_2526 315
469 3300047317 Ga0495604_0181886 Ga0495604_0181886_61_1014 315
470 3300047318 Ga0495636_0034558 Ga0495636_0034558_670_1623 315
471 3300047319 Ga0495674_0000134 Ga0495674_0000134_54099_55049 315
472 3300047319 Ga0495674_0013244 Ga0495674_0013244_6276_7226 315
473 3300047320 Ga0495672_0016185 Ga0495672_0016185_503_1456 315
474 3300047320 Ga0495672_0099378 Ga0495672_0099378_517_1470 315
475 3300047321 Ga0495676_0111796 Ga0495676_0111796_997_1950 315
476 3300047322 Ga0495680_0002637 Ga0495680_0002637_4775_5725 315
477 3300047323 Ga0495683_0086940 Ga0495683_0086940_173_1126 315
478 3300047444 Ga0495675_0000756 Ga0495675_0000756_9325_10275 315
479 3300047445 Ga0495677_0052584 Ga0495677_0052584_380_1333 315
480 3300047471 Ga0495684_0000052 Ga0495684_0000052_53364_54314 315
481 3300047471 Ga0495684_0007719 Ga0495684_0007719_6008_6958 315
482 3300047673 Ga0495593_0000084 Ga0495593_0000084_10829_11779 315
483 3300047673 Ga0495593_0000518 Ga0495593_0000518_6371_7321 315
484 3300048089 Ga0495614_0056293 Ga0495614_0056293_540_1490 315
485 3300048090 Ga0495615_0013052 Ga0495615_0013052_373_1326 315
486 3300048903 Ga0496100_0013812 Ga0496100_0013812_388_1341 315
487 3300048905 Ga0496102_0005804 Ga0496102_0005804_4287_5240 315
488 3300048906 Ga0496103_0023140 Ga0496103_0023140_520_1473 315
489 3300048907 Ga0496104_0039927 Ga0496104_0039927_3121_4074 315
490 3300048909 Ga0496106_0247514 Ga0496106_0247514_158_1114 315
491 3300048909 Ga0496106_0347380 Ga0496106_0347380_173_1126 315
492 3300048910 Ga0496107_0016390 Ga0496107_0016390_196_1149 315
493 3300048911 Ga0496108_0012856 Ga0496108_0012856_4636_5589 315
494 3300048912 Ga0496109_0016364 Ga0496109_0016364_3088_4041 315
495 3300048913 Ga0496110_0100507 Ga0496110_0100507_1217_2170 315
496 3300048914 Ga0496111_0025250 Ga0496111_0025250_476_1429 315
497 3300048915 Ga0496112_0069765 Ga0496112_0069765_2442_3395 315
498 3300048915 Ga0496112_0413543 Ga0496112_0413543_257_1207 315
499 3300048916 Ga0496113_0020850 Ga0496113_0020850_2734_3684 315
500 3300048917 Ga0496114_0016833 Ga0496114_0016833_3959_4912 315
501 3300048917 Ga0496114_0178261 Ga0496114_0178261_61_1017 315
502 3300048918 Ga0496115_0001776 Ga0496115_0001776_11506_12459 315
503 3300048918 Ga0496115_0391744 Ga0496115_0391744_28_978 315
504 3300048921 Ga0496118_0124129 Ga0496118_0124129_220_1218 315
505 3300048924 Ga0496121_0002340 Ga0496121_0002340_12777_13730 315
506 3300048924 Ga0496121_0060700 Ga0496121_0060700_502_1494 315
507 3300048924 Ga0496121_0230402 Ga0496121_0230402_317_1270 315
508 3300048924 Ga0496121_0248698 Ga0496121_0248698_139_1101 315
509 3300048927 Ga0496124_0223048 Ga0496124_0223048_183_1139 315
510 3300048928 Ga0496125_0157408 Ga0496125_0157408_520_1470 315
511 3300048929 Ga0496126_0199212 Ga0496126_0199212_640_1590 315
512 3300049581 Ga0501047_0046968 Ga0501047_0046968_2898_3860 315
513 3300049583 Ga0501067_0066626 Ga0501067_0066626_19_972 315
514 3300049586 Ga0501070_0064188 Ga0501070_0064188_1900_2862 315
515 3300050492 nmdc:mga0yw44_246584_c1 nmdc:mga0yw44_246584_c1_29_1039 315
516 3300050492 nmdc:mga0yw44_77243_c1 nmdc:mga0yw44_77243_c1_1116_2069 315
517 3300050493 nmdc:mga0k408_196813_c1 nmdc:mga0k408_196813_c1_188_1156 315
518 3300050516 nmdc:mga0sz30_13283_c1 nmdc:mga0sz30_13283_c1_1925_2893 315
519 3300053077 Ga0495601_0032539 Ga0495601_0032539_1945_2895 315
520 3300053077 Ga0495601_0215782 Ga0495601_0215782_242_1195 315
521 3300053078 Ga0495612_0147994 Ga0495612_0147994_11_961 315
522 3300053080 Ga0500635_0013807 Ga0500635_0013807_672_1622 315
523 3300053080 Ga0500635_0018312 Ga0500635_0018312_201_1154 315
524 3300053084 Ga0495595_0000279 Ga0495595_0000279_6172_7122 315
525 3300053085 Ga0495619_0091211 Ga0495619_0091211_329_1279 315
526 3300053086 Ga0500578_0140548 Ga0500578_0140548_41_988 315
527 3300053093 Ga0500651_0001238 Ga0500651_0001238_3206_4153 315
528 3300053094 Ga0500566_0000762 Ga0500566_0000762_10857_11810 315
529 3300053095 Ga0500640_104185 Ga0500640_104185_60_1013 315
530 3300053096 Ga0500641_0032707 Ga0500641_0032707_443_1399 315
531 3300053102 Ga0500554_002407 Ga0500554_002407_2095_3045 315
532 3300053102 Ga0500554_006683 Ga0500554_006683_165_1115 315
533 3300053108 Ga0500562_029053 Ga0500562_029053_377_1330 315
534 3300053119 Ga0500595_002625 Ga0500595_002625_6831_7781 315
535 3300053119 Ga0500595_028833 Ga0500595_028833_864_1817 315
536 3300053119 Ga0500595_039188 Ga0500595_039188_351_1304 315
537 3300053123 Ga0500614_044558 Ga0500614_044558_49_1002 315
538 3300053130 Ga0500642_0001930 Ga0500642_0001930_3926_4873 315
539 3300053137 Ga0500561_0051472 Ga0500561_0051472_63_1016 315
540 3300053139 Ga0500568_0080002 Ga0500568_0080002_270_1223 315
541 3300053139 Ga0500568_0095530 Ga0500568_0095530_27_980 315
542 3300053150 Ga0500603_007126 Ga0500603_007126_635_1585 315
543 3300053156 Ga0500622_0035703 Ga0500622_0035703_112_1059 315
544 3300053159 Ga0500630_055180 Ga0500630_055180_350_1303 315
545 3300053161 Ga0500634_0131051 Ga0500634_0131051_37_990 315
546 3300053162 Ga0500638_017623 Ga0500638_017623_1240_2190 315
547 3300053163 Ga0500639_002046 Ga0500639_002046_61_1014 315
548 3300053178 Ga0500637_0000155 Ga0500637_0000155_196_1146 315
549 3300053178 Ga0500637_0000757 Ga0500637_0000757_5930_6880 315
550 3300053178 Ga0500637_0078433 Ga0500637_0078433_71_1024 315
551 3300053735 Ga0500596_001525 Ga0500596_001525_3216_4169 315
552 3300055283 Ga0500661_000885 Ga0500661_000885_3815_4765 315
553 iso_pu_bacteria 2906635258 2906641159 315
554 iso_pu_bacteria 2906660503 2906665715 315
555 iso_pu_bacteria 3005474847 3005483203 315
556 iso_pu_bacteria 8006964411 8006968343 315
557 iso_pu_bacteria 8056681323 8056688434 315
558 3300003203 JGI25406J46586_10005160 JGI25406J46586_100051604 316
559 3300005937 Ga0081455_10012089 Ga0081455_100120895 316
560 3300005983 Ga0081540_1035801 Ga0081540_10358012 316
561 3300005985 Ga0081539_10000466 Ga0081539_1000046621 316
562 3300005985 Ga0081539_10026236 Ga0081539_100262363 316
563 3300026121 Ga0207683_10101869 Ga0207683_101018692 316
564 3300031507 Ga0307509_10237597 Ga0307509_102375971 316
565 3300031507 Ga0307509_10402687 Ga0307509_104026871 316
566 3300033179 Ga0307507_10094791 Ga0307507_100947911 316
567 3300046455 Ga0495603_0025895 Ga0495603_0025895_2060_3028 316
568 3300046512 Ga0495610_0022155 Ga0495610_0022155_1558_2517 316
569 3300046518 Ga0495631_0084020 Ga0495631_0084020_279_1247 316
570 3300046522 Ga0495643_0010324 Ga0495643_0010324_2539_3498 316
571 3300046683 Ga0495658_0149931 Ga0495658_0149931_299_1261 316
572 3300046810 Ga0495660_0041199 Ga0495660_0041199_935_1894 316
573 3300048910 Ga0496107_0208845 Ga0496107_0208845_457_1413 316
574 3300048920 Ga0496117_0010024 Ga0496117_0010024_6784_7755 316
575 3300048921 Ga0496118_0012015 Ga0496118_0012015_4416_5387 316
576 3300048924 Ga0496121_0004993 Ga0496121_0004993_12109_13080 316
577 3300048924 Ga0496121_0101832 Ga0496121_0101832_86_1042 316
578 3300048929 Ga0496126_0284739 Ga0496126_0284739_195_1166 316
579 3300053080 Ga0500635_0024833 Ga0500635_0024833_87_1049 316
580 3300053119 Ga0500595_000199 Ga0500595_000199_14417_15400 316
581 3300053119 Ga0500595_009809 Ga0500595_009809_2643_3659 316
582 3300053148 Ga0500590_014489 Ga0500590_014489_574_1527 316
583 3300053177 Ga0500636_0095356 Ga0500636_0095356_14_973 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

71

295

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iy9-assembly2.cif.gz_B "crystal structure of aminoglycoside 7""-phoshotransferase-ia (aph(7"")-ia/hyg) from streptomyces hygroscopicus complexed with hygromycin b" 0.8056 6 313
6iy9-assembly2.cif.gz_B "crystal structure of aminoglycoside 7""-phoshotransferase-ia (aph(7"")-ia/hyg) from streptomyces hygroscopicus complexed with hygromycin b" 0.7846 6 313
6ctz-assembly1.cif.gz_A "structure of the gdp and kanamycin complex of aph(2"")-iiia" 0.7571 22 282
4ork-assembly4.cif.gz_D crystal structure of the phosphotransferase domain of the bifunctional aminoglycoside resistance enzyme aac(6')-ie-aph(2'')-ia 0.7489 23 282
5iqb-assembly1.cif.gz_A aminoglycoside phosphotransferase (2'')-ia (ctd of aac(6')-ie/aph(2'')-ia) in complex with gmppnp, magnesium, and kanamycin a 0.7464 23 282
ID Description Score Start End Superfamily
af_Q5RI03_13_83_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7987 57 105 3.30.200.20
af_A0A1D6H649_61_130_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7405 57 108 3.30.200.20
af_A0A1D6ERY2_751_840_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.74 42 107 3.30.200.20
af_Q9FHG4_349_441_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.734 57 105 3.30.200.20
af_A0A0N7KJP7_1_60_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7326 57 108 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A1Q5RY61-F1-model_v4 Phosphotransferase 0.9957 2 314 GO:0016301
AF-A0A5P6P4M9-F1-model_v4 Phosphotransferase 0.9941 1 314 GO:0016301
AF-A0A4U6RVR8-F1-model_v4 Phosphotransferase 0.9907 1 314 GO:0016301
AF-A0A0E4BP05-F1-model_v4 Putative phosphotransferase 0.9906 86 314 GO:0016301
AF-A4Z2P8-F1-model_v4 Aminoglycoside phosphotransferase domain-containing protein 0.9888 41 314 GO:0016301

Feature Viewer

pLDDT pTM Quality
94.16 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map