F466283
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 583 | 365 | 537 | 316 |
Family's Representative Sequence
| Representative Sequence | 3300026023|Ga0207677_10083188|Ga0207677_100831881 |
| Length | 345 |
| Sequence | LLRRFAPLRKRIAFVAGNDDEPSQATMTASLPAFTDYEPFRPFRADPSQWLPIALDIARSHGLACTEPQIFSTGTNLVVGLDEPLILKIFPPFLRGQFASERASLVQLRGRLAVPIPEIVLEGERDQWPYLVITRVYGQLGSVVWPRLPEDQKERVLFQIGETIADVQRVPLGDLSQIEPRWDQFIQGQIQGCRARHERLGLPQQFLAGLDDLLRDAATLTPLNVNAPPVILTGEFIPENFLLRRELEGWGVSGLIDFGDVMTGRGEYDLLGPSAFMTSGMPRRVQSLFGGFGYSAADITPDLKRRLMALMLLHRASDPVRSICIEGWQQKAADLRELQDLLWPI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 4 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 5 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 6 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 7 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 8 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 9 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 10 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 11 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 12 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 13 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 14 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 15 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 16 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 17 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 18 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 19 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 20 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 21 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 22 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 23 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 24 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 25 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 26 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 27 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 28 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 29 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 30 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 31 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 32 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 33 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 34 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 35 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 36 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 37 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 92 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 93 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 122 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 162 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 163 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 164 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 170 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 177 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 178 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 181 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 183 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 191 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 192 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 193 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 217 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 218 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 219 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 220 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 294 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 295 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 296 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 297 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 298 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 301 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 302 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 303 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 304 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 305 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 306 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 307 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 308 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 309 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 310 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 311 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 312 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 313 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 317 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 318 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 319 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 320 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 323 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 326 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 327 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 328 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 329 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 330 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 331 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 332 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 333 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 334 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 335 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 336 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 337 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 338 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 339 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 341 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 342 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 343 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 344 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 345 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 346 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 347 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 348 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 349 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 350 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 351 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 353 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 354 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 355 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 356 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 357 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 358 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 359 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 360 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 361 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 362 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 363 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 364 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 365 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.75 |
| Metatranscriptomes | 0 |
| Isolates | 7.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.32 |
| Nodule | 6.69 |
| Rhizoplane | 3.6 |
| Rhizosphere | 69.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10005160 | 3300003203 | Bacteria | 6059 |
| 2 | JGI25165J46597_1005485 | 3300003214 | Bacteria | 2433 |
| 3 | JGI25153J46596_10006239 | 3300003215 | Bacteria | 6098 |
| 4 | rootH2_10211234 | 3300003320 | Bacteria | 1214 |
| 5 | Ga0055543_1002478 | 3300004625 | Bacteria | 6089 |
| 6 | Ga0065165_1001304 | 3300005262 | Bacteria | 27869 |
| 7 | Ga0070683_100013043 | 3300005329 | Bacteria | 7236 |
| 8 | Ga0070683_100136917 | 3300005329 | Bacteria | 2319 |
| 9 | Ga0070670_100492120 | 3300005331 | Bacteria | 1090 |
| 10 | Ga0068869_100075431 | 3300005334 | Bacteria | 2505 |
| 11 | Ga0070666_10241275 | 3300005335 | Bacteria | 1278 |
| 12 | Ga0070680_100228694 | 3300005336 | Bacteria | 1570 |
| 13 | Ga0070682_100013158 | 3300005337 | Bacteria | 4753 |
| 14 | Ga0068868_100203215 | 3300005338 | Bacteria | 1652 |
| 15 | Ga0068868_100244205 | 3300005338 | Bacteria | 1509 |
| 16 | Ga0070660_100458038 | 3300005339 | Bacteria | 1059 |
| 17 | Ga0070668_100025353 | 3300005347 | Bacteria | 4495 |
| 18 | Ga0070669_100157071 | 3300005353 | Bacteria | 1765 |
| 19 | Ga0070675_100100975 | 3300005354 | Bacteria | 2430 |
| 20 | Ga0070674_100052706 | 3300005356 | Bacteria | 2807 |
| 21 | Ga0070673_100108350 | 3300005364 | Bacteria | 2300 |
| 22 | Ga0070673_100115687 | 3300005364 | Bacteria | 2230 |
| 23 | Ga0070659_100392737 | 3300005366 | Bacteria | 1170 |
| 24 | Ga0070713_100010942 | 3300005436 | Bacteria | 6579 |
| 25 | Ga0070711_100047715 | 3300005439 | Bacteria | 2925 |
| 26 | Ga0070663_100046798 | 3300005455 | Bacteria | 3062 |
| 27 | Ga0070663_100329788 | 3300005455 | Bacteria | 1230 |
| 28 | Ga0070678_100054525 | 3300005456 | Bacteria | 2914 |
| 29 | Ga0070678_100080739 | 3300005456 | Bacteria | 2463 |
| 30 | Ga0070678_100193576 | 3300005456 | Bacteria | 1673 |
| 31 | Ga0070681_10044998 | 3300005458 | Bacteria | 4418 |
| 32 | Ga0070681_10060331 | 3300005458 | Bacteria | 3770 |
| 33 | Ga0070681_10071598 | 3300005458 | Bacteria | 3431 |
| 34 | Ga0070681_10147501 | 3300005458 | Bacteria | 2281 |
| 35 | Ga0070685_10120529 | 3300005466 | Bacteria | 1628 |
| 36 | Ga0070698_100311443 | 3300005471 | Bacteria | 1505 |
| 37 | Ga0070679_100166533 | 3300005530 | Bacteria | 2177 |
| 38 | Ga0070684_100008609 | 3300005535 | Bacteria | 7991 |
| 39 | Ga0070684_100134255 | 3300005535 | Bacteria | 2234 |
| 40 | Ga0070672_100055714 | 3300005543 | Bacteria | 3098 |
| 41 | Ga0070672_100100938 | 3300005543 | Bacteria | 2341 |
| 42 | Ga0070672_100672694 | 3300005543 | Bacteria | 905 |
| 43 | Ga0070686_100124414 | 3300005544 | Bacteria | 1775 |
| 44 | Ga0070665_100036744 | 3300005548 | Bacteria | 4925 |
| 45 | Ga0070665_100094054 | 3300005548 | Bacteria | 3002 |
| 46 | Ga0070665_100128810 | 3300005548 | Bacteria | 2533 |
| 47 | Ga0068855_100058819 | 3300005563 | Bacteria | 4499 |
| 48 | Ga0068855_100170497 | 3300005563 | Bacteria | 2465 |
| 49 | Ga0068855_100318993 | 3300005563 | Bacteria | 1718 |
| 50 | Ga0068857_100296516 | 3300005577 | Bacteria | 1490 |
| 51 | Ga0068854_100408815 | 3300005578 | Bacteria | 1125 |
| 52 | Ga0068852_100133026 | 3300005616 | Bacteria | 2293 |
| 53 | Ga0068859_100049556 | 3300005617 | Bacteria | 4217 |
| 54 | Ga0068859_100142923 | 3300005617 | Bacteria | 2466 |
| 55 | Ga0068859_100299379 | 3300005617 | Bacteria | 1702 |
| 56 | Ga0068866_10092684 | 3300005718 | Bacteria | 1649 |
| 57 | Ga0068861_100102320 | 3300005719 | Bacteria | 2280 |
| 58 | Ga0068861_100388774 | 3300005719 | Bacteria | 1235 |
| 59 | Ga0068851_10156803 | 3300005834 | Bacteria | 1248 |
| 60 | Ga0068858_100130009 | 3300005842 | Bacteria | 2360 |
| 61 | Ga0068858_100131853 | 3300005842 | Bacteria | 2344 |
| 62 | Ga0068858_100149708 | 3300005842 | Bacteria | 2193 |
| 63 | Ga0068858_100242242 | 3300005842 | Bacteria | 1711 |
| 64 | Ga0068858_100255051 | 3300005842 | Bacteria | 1666 |
| 65 | Ga0068860_100127031 | 3300005843 | Bacteria | 2444 |
| 66 | Ga0068862_100137380 | 3300005844 | Bacteria | 2167 |
| 67 | Ga0068862_100187288 | 3300005844 | Bacteria | 1860 |
| 68 | Ga0068862_100244330 | 3300005844 | Bacteria | 1633 |
| 69 | Ga0068862_100270199 | 3300005844 | Bacteria | 1555 |
| 70 | Ga0081455_10009565 | 3300005937 | Bacteria | 9956 |
| 71 | Ga0081455_10012089 | 3300005937 | Bacteria | 8629 |
| 72 | Ga0081455_10029339 | 3300005937 | Bacteria | 5016 |
| 73 | Ga0081455_10098580 | 3300005937 | Bacteria | 2352 |
| 74 | Ga0081540_1008529 | 3300005983 | Bacteria | 7152 |
| 75 | Ga0081540_1033224 | 3300005983 | Bacteria | 2805 |
| 76 | Ga0081540_1035801 | 3300005983 | Bacteria | 2657 |
| 77 | Ga0081540_1043625 | 3300005983 | Bacteria | 2298 |
| 78 | Ga0081540_1048902 | 3300005983 | Bacteria | 2114 |
| 79 | Ga0081540_1061582 | 3300005983 | Bacteria | 1788 |
| 80 | Ga0081539_10000466 | 3300005985 | Bacteria | 85716 |
| 81 | Ga0081539_10026236 | 3300005985 | Bacteria | 3724 |
| 82 | Ga0070717_10024804 | 3300006028 | Bacteria | 4765 |
| 83 | Ga0075365_10027308 | 3300006038 | Bacteria | 3631 |
| 84 | Ga0075365_10326779 | 3300006038 | Bacteria | 1080 |
| 85 | Ga0075364_10071250 | 3300006051 | Bacteria | 2289 |
| 86 | Ga0075364_10142413 | 3300006051 | Bacteria | 1613 |
| 87 | Ga0070712_100166135 | 3300006175 | Bacteria | 1708 |
| 88 | Ga0075367_10074239 | 3300006178 | Bacteria | 2050 |
| 89 | Ga0075369_10004356 | 3300006186 | Bacteria | 5221 |
| 90 | Ga0075366_10153299 | 3300006195 | Bacteria | 1396 |
| 91 | Ga0097621_100166720 | 3300006237 | Bacteria | 1896 |
| 92 | Ga0097621_100239366 | 3300006237 | Bacteria | 1586 |
| 93 | Ga0068871_100170998 | 3300006358 | Bacteria | 1863 |
| 94 | Ga0075428_100075420 | 3300006844 | Bacteria | 3683 |
| 95 | Ga0068865_100033411 | 3300006881 | Bacteria | 3445 |
| 96 | Ga0068865_100317964 | 3300006881 | Bacteria | 1251 |
| 97 | Ga0097620_100049556 | 3300006931 | Bacteria | 4217 |
| 98 | Ga0097620_100142927 | 3300006931 | Bacteria | 2466 |
| 99 | Ga0097620_100299394 | 3300006931 | Bacteria | 1702 |
| 100 | Ga0099825_1039555 | 3300006941 | Bacteria | 1441 |
| 101 | Ga0099824_1022782 | 3300006942 | Bacteria | 4041 |
| 102 | Ga0099822_1000191 | 3300006943 | Bacteria | 46107 |
| 103 | Ga0099794_10037604 | 3300007265 | Bacteria | 2292 |
| 104 | Ga0099795_10024414 | 3300007788 | Bacteria | 2016 |
| 105 | Ga0099795_10033740 | 3300007788 | Bacteria | 1779 |
| 106 | Ga0105240_10033191 | 3300009093 | Bacteria | 6672 |
| 107 | Ga0105240_10045940 | 3300009093 | Bacteria | 5537 |
| 108 | Ga0105245_10081624 | 3300009098 | Bacteria | 2956 |
| 109 | Ga0105245_10264772 | 3300009098 | Bacteria | 1674 |
| 110 | Ga0105247_10083129 | 3300009101 | Bacteria | 2022 |
| 111 | Ga0105247_10149989 | 3300009101 | Bacteria | 1535 |
| 112 | Ga0114129_10539134 | 3300009147 | Bacteria | 1519 |
| 113 | Ga0105243_10154464 | 3300009148 | Bacteria | 1972 |
| 114 | Ga0105242_10237294 | 3300009176 | Bacteria | 1637 |
| 115 | Ga0105242_10302228 | 3300009176 | Bacteria | 1461 |
| 116 | Ga0105237_10061212 | 3300009545 | Bacteria | 3765 |
| 117 | Ga0105237_10185795 | 3300009545 | Bacteria | 2078 |
| 118 | Ga0105237_10293073 | 3300009545 | Bacteria | 1630 |
| 119 | Ga0105238_10053408 | 3300009551 | Bacteria | 4061 |
| 120 | Ga0105249_10058920 | 3300009553 | Bacteria | 3521 |
| 121 | Ga0105239_10063442 | 3300010375 | Bacteria | 4057 |
| 122 | Ga0105239_10084776 | 3300010375 | Bacteria | 3491 |
| 123 | Ga0105239_10109735 | 3300010375 | Bacteria | 3058 |
| 124 | Ga0105246_10011436 | 3300011119 | Bacteria | 5508 |
| 125 | Ga0105246_10071182 | 3300011119 | Bacteria | 2448 |
| 126 | Ga0105246_10079941 | 3300011119 | Bacteria | 2326 |
| 127 | Ga0105246_10172349 | 3300011119 | Bacteria | 1658 |
| 128 | Ga0105246_10297981 | 3300011119 | Bacteria | 1300 |
| 129 | Ga0157370_10059659 | 3300013104 | Bacteria | 3625 |
| 130 | Ga0157370_10217308 | 3300013104 | Bacteria | 1771 |
| 131 | Ga0157369_10004320 | 3300013105 | Bacteria | 16785 |
| 132 | Ga0157369_10047026 | 3300013105 | Bacteria | 4686 |
| 133 | Ga0157374_10041150 | 3300013296 | Bacteria | 4257 |
| 134 | Ga0157378_10153466 | 3300013297 | Bacteria | 2147 |
| 135 | Ga0163162_10091495 | 3300013306 | Bacteria | 3125 |
| 136 | Ga0163162_10243381 | 3300013306 | Bacteria | 1930 |
| 137 | Ga0163162_10303167 | 3300013306 | Bacteria | 1730 |
| 138 | Ga0163162_10433832 | 3300013306 | Bacteria | 1446 |
| 139 | Ga0157372_10068595 | 3300013307 | Bacteria | 3987 |
| 140 | Ga0157372_10108343 | 3300013307 | Bacteria | 3179 |
| 141 | Ga0157375_10021897 | 3300013308 | Bacteria | 5874 |
| 142 | Ga0157375_10032188 | 3300013308 | Bacteria | 4971 |
| 143 | Ga0157375_10185864 | 3300013308 | Bacteria | 2231 |
| 144 | Ga0157375_10393938 | 3300013308 | Bacteria | 1552 |
| 145 | Ga0163163_10005029 | 3300014325 | Bacteria | 11395 |
| 146 | Ga0163163_10273801 | 3300014325 | Bacteria | 1739 |
| 147 | Ga0163163_10516576 | 3300014325 | Bacteria | 1257 |
| 148 | Ga0157380_10273041 | 3300014326 | Bacteria | 1542 |
| 149 | Ga0157379_10094307 | 3300014968 | Bacteria | 2685 |
| 150 | Ga0157379_10192298 | 3300014968 | Bacteria | 1844 |
| 151 | Ga0157376_10034273 | 3300014969 | Bacteria | 4098 |
| 152 | Ga0157376_10086467 | 3300014969 | Bacteria | 2703 |
| 153 | Ga0163161_10140385 | 3300017792 | Bacteria | 1829 |
| 154 | Ga0213874_10018972 | 3300021377 | Bacteria | 1867 |
| 155 | Ga0213876_10006031 | 3300021384 | Bacteria | 6623 |
| 156 | Ga0213876_10062484 | 3300021384 | Bacteria | 1966 |
| 157 | Ga0213875_10058191 | 3300021388 | Bacteria | 1809 |
| 158 | Ga0209233_1006575 | 3300025261 | Bacteria | 3737 |
| 159 | Ga0209758_1015431 | 3300025297 | Bacteria | 3955 |
| 160 | Ga0209758_1020677 | 3300025297 | Bacteria | 3101 |
| 161 | Ga0207697_10070847 | 3300025315 | Bacteria | 1461 |
| 162 | Ga0207692_10000547 | 3300025898 | Bacteria | 13349 |
| 163 | Ga0207688_10153378 | 3300025901 | Bacteria | 1362 |
| 164 | Ga0207647_10235185 | 3300025904 | Bacteria | 1053 |
| 165 | Ga0207699_10000386 | 3300025906 | Bacteria | 23177 |
| 166 | Ga0207699_10068446 | 3300025906 | Bacteria | 2162 |
| 167 | Ga0207645_10077204 | 3300025907 | Bacteria | 2134 |
| 168 | Ga0207654_10107316 | 3300025911 | Bacteria | 1731 |
| 169 | Ga0207707_10000816 | 3300025912 | Bacteria | 30547 |
| 170 | Ga0207707_10016028 | 3300025912 | Bacteria | 6536 |
| 171 | Ga0207707_10153825 | 3300025912 | Bacteria | 2011 |
| 172 | Ga0207695_10006231 | 3300025913 | Bacteria | 15536 |
| 173 | Ga0207671_10094023 | 3300025914 | Bacteria | 2262 |
| 174 | Ga0207671_10187330 | 3300025914 | Bacteria | 1612 |
| 175 | Ga0207660_10160335 | 3300025917 | Bacteria | 1735 |
| 176 | Ga0207662_10066293 | 3300025918 | Bacteria | 2175 |
| 177 | Ga0207657_10076677 | 3300025919 | Bacteria | 2819 |
| 178 | Ga0207652_10010669 | 3300025921 | Bacteria | 7399 |
| 179 | Ga0207652_10060900 | 3300025921 | Bacteria | 3258 |
| 180 | Ga0207652_10262764 | 3300025921 | Bacteria | 1557 |
| 181 | Ga0207694_10202133 | 3300025924 | Bacteria | 1617 |
| 182 | Ga0207687_10011663 | 3300025927 | Bacteria | 5746 |
| 183 | Ga0207700_10080287 | 3300025928 | Bacteria | 2543 |
| 184 | Ga0207709_10052935 | 3300025935 | Bacteria | 2496 |
| 185 | Ga0207704_10158833 | 3300025938 | Bacteria | 1606 |
| 186 | Ga0207665_10001425 | 3300025939 | Bacteria | 16086 |
| 187 | Ga0207691_10043846 | 3300025940 | Bacteria | 4120 |
| 188 | Ga0207691_10056812 | 3300025940 | Bacteria | 3564 |
| 189 | Ga0207689_10132535 | 3300025942 | Bacteria | 2051 |
| 190 | Ga0207689_10232134 | 3300025942 | Bacteria | 1525 |
| 191 | Ga0207661_10015027 | 3300025944 | Bacteria | 5686 |
| 192 | Ga0207661_10241050 | 3300025944 | Bacteria | 1604 |
| 193 | Ga0207679_10384057 | 3300025945 | Bacteria | 1232 |
| 194 | Ga0207667_10054494 | 3300025949 | Bacteria | 4206 |
| 195 | Ga0207667_10177915 | 3300025949 | Bacteria | 2185 |
| 196 | Ga0207667_10506228 | 3300025949 | Bacteria | 1224 |
| 197 | Ga0207668_10010779 | 3300025972 | Bacteria | 5535 |
| 198 | Ga0207668_10017444 | 3300025972 | Bacteria | 4498 |
| 199 | Ga0207668_10211583 | 3300025972 | Bacteria | 1551 |
| 200 | Ga0207668_10356067 | 3300025972 | Bacteria | 1225 |
| 201 | Ga0207640_10164248 | 3300025981 | Bacteria | 1647 |
| 202 | Ga0207677_10083188 | 3300026023 | Bacteria | 2303 |
| 203 | Ga0207639_10058388 | 3300026041 | Bacteria | 2968 |
| 204 | Ga0207639_10111932 | 3300026041 | Bacteria | 2226 |
| 205 | Ga0207678_10027066 | 3300026067 | Bacteria | 5001 |
| 206 | Ga0207678_10194728 | 3300026067 | Bacteria | 1732 |
| 207 | Ga0207708_10346341 | 3300026075 | Bacteria | 1218 |
| 208 | Ga0207702_10043472 | 3300026078 | Bacteria | 3772 |
| 209 | Ga0207648_10018779 | 3300026089 | Bacteria | 6251 |
| 210 | Ga0207674_10311608 | 3300026116 | Bacteria | 1523 |
| 211 | Ga0207675_100071021 | 3300026118 | Bacteria | 3255 |
| 212 | Ga0207675_100108650 | 3300026118 | Bacteria | 2616 |
| 213 | Ga0207675_100125592 | 3300026118 | Bacteria | 2430 |
| 214 | Ga0207675_100289114 | 3300026118 | Bacteria | 1594 |
| 215 | Ga0207683_10028790 | 3300026121 | Bacteria | 4806 |
| 216 | Ga0207683_10037875 | 3300026121 | Bacteria | 4201 |
| 217 | Ga0207683_10061169 | 3300026121 | Bacteria | 3314 |
| 218 | Ga0207683_10101869 | 3300026121 | Bacteria | 2564 |
| 219 | Ga0207683_10107730 | 3300026121 | Bacteria | 2493 |
| 220 | Ga0207683_10121783 | 3300026121 | Bacteria | 2343 |
| 221 | Ga0207683_10163379 | 3300026121 | Bacteria | 2014 |
| 222 | Ga0207698_10280814 | 3300026142 | Bacteria | 1540 |
| 223 | Ga0209589_1000055 | 3300027357 | Bacteria | 111890 |
| 224 | Ga0209489_100128 | 3300027361 | Bacteria | 111890 |
| 225 | Ga0209700_100137 | 3300027363 | Bacteria | 111890 |
| 226 | Ga0209179_1005696 | 3300027512 | Bacteria | 1966 |
| 227 | Ga0209179_1009592 | 3300027512 | Bacteria | 1665 |
| 228 | Ga0209588_1028322 | 3300027671 | Bacteria | 1783 |
| 229 | Ga0268266_10042528 | 3300028379 | Bacteria | 3881 |
| 230 | Ga0268266_10179348 | 3300028379 | Bacteria | 1927 |
| 231 | Ga0268265_10105795 | 3300028380 | Bacteria | 2284 |
| 232 | Ga0268265_10112000 | 3300028380 | Bacteria | 2230 |
| 233 | Ga0268265_10199029 | 3300028380 | Bacteria | 1736 |
| 234 | Ga0268265_10300959 | 3300028380 | Bacteria | 1444 |
| 235 | Ga0265337_1013180 | 3300028556 | Bacteria | 2785 |
| 236 | Ga0265319_1013300 | 3300028563 | Bacteria | 3281 |
| 237 | Ga0265334_10001581 | 3300028573 | Bacteria | 10962 |
| 238 | Ga0265318_10019887 | 3300028577 | Bacteria | 2718 |
| 239 | Ga0265336_10001044 | 3300028666 | Bacteria | 13533 |
| 240 | Ga0265338_10000024 | 3300028800 | Bacteria | 297778 |
| 241 | Ga0265324_10003580 | 3300029957 | Bacteria | 7322 |
| 242 | Ga0265332_10042052 | 3300031238 | Bacteria | 1976 |
| 243 | Ga0265328_10034325 | 3300031239 | Bacteria | 1879 |
| 244 | Ga0265325_10025938 | 3300031241 | Bacteria | 3179 |
| 245 | Ga0265339_10072118 | 3300031249 | Bacteria | 1838 |
| 246 | Ga0265331_10041322 | 3300031250 | Bacteria | 2241 |
| 247 | Ga0307509_10237597 | 3300031507 | Bacteria | 1618 |
| 248 | Ga0307509_10305253 | 3300031507 | Bacteria | 1337 |
| 249 | Ga0307509_10402687 | 3300031507 | Bacteria | 1074 |
| 250 | Ga0265313_10040983 | 3300031595 | Bacteria | 2285 |
| 251 | Ga0307508_10039969 | 3300031616 | Bacteria | 4213 |
| 252 | Ga0265314_10181694 | 3300031711 | Bacteria | 1260 |
| 253 | Ga0307516_10096712 | 3300031730 | Bacteria | 2773 |
| 254 | Ga0307406_10144211 | 3300031901 | Bacteria | 1690 |
| 255 | Ga0307409_100094838 | 3300031995 | Bacteria | 2456 |
| 256 | Ga0307409_100305476 | 3300031995 | Bacteria | 1482 |
| 257 | Ga0307416_100193344 | 3300032002 | Bacteria | 1922 |
| 258 | Ga0307416_100432717 | 3300032002 | Bacteria | 1363 |
| 259 | Ga0307411_10318663 | 3300032005 | Bacteria | 1254 |
| 260 | Ga0307415_100239642 | 3300032126 | Bacteria | 1466 |
| 261 | Ga0307507_10094791 | 3300033179 | Bacteria | 2535 |
| 262 | Ga0307510_10007534 | 3300033180 | Bacteria | 12965 |
| 263 | Ga0307510_10053110 | 3300033180 | Bacteria | 4264 |
| 264 | Ga0315911_1000024 | 3300033442 | Bacteria | 97712 |
| 265 | Ga0373934_0001199 | 3300035086 | Bacteria | 9393 |
| 266 | Ga0373923_0000022 | 3300035111 | Bacteria | 23262 |
| 267 | Ga0373923_0007505 | 3300035111 | Bacteria | 3837 |
| 268 | Ga0373936_0016695 | 3300035113 | Bacteria | 2825 |
| 269 | Ga0373945_0005833 | 3300035116 | Bacteria | 3953 |
| 270 | Ga0373945_0035171 | 3300035116 | Bacteria | 1789 |
| 271 | Ga0373953_0000468 | 3300035117 | Bacteria | 11120 |
| 272 | Ga0373954_0000519 | 3300035118 | Bacteria | 14460 |
| 273 | Ga0373954_0134691 | 3300035118 | Bacteria | 1204 |
| 274 | Ga0373956_0002504 | 3300035119 | Bacteria | 7478 |
| 275 | Ga0373956_0111959 | 3300035119 | Bacteria | 1271 |
| 276 | Ga0373957_0000581 | 3300035120 | Bacteria | 9243 |
| 277 | Ga0373943_0001466 | 3300035170 | Bacteria | 10672 |
| 278 | Ga0373943_0026917 | 3300035170 | Bacteria | 2698 |
| 279 | Ga0373943_0044897 | 3300035170 | Bacteria | 2151 |
| 280 | Ga0373946_0025124 | 3300035171 | Bacteria | 2341 |
| 281 | Ga0373955_0000402 | 3300035172 | Bacteria | 18349 |
| 282 | Ga0373924_0003157 | 3300035410 | Bacteria | 5631 |
| 283 | Ga0373924_0006169 | 3300035410 | Bacteria | 4284 |
| 284 | Ga0373935_0000244 | 3300035692 | Bacteria | 26819 |
| 285 | Ga0373935_0045315 | 3300035692 | Bacteria | 2775 |
| 286 | Ga0373935_0081433 | 3300035692 | Bacteria | 2104 |
| 287 | Ga0373927_0025022 | 3300035695 | Bacteria | 3903 |
| 288 | Ga0373927_0097055 | 3300035695 | Bacteria | 1915 |
| 289 | Ga0373933_0000114 | 3300035724 | Bacteria | 52016 |
| 290 | Ga0373933_0000374 | 3300035724 | Bacteria | 28691 |
| 291 | Ga0373933_0098258 | 3300035724 | Bacteria | 1814 |
| 292 | Ga0373947_0004892 | 3300035725 | Bacteria | 7840 |
| 293 | Ga0373937_0003416 | 3300036401 | Bacteria | 13330 |
| 294 | Ga0373925_0012695 | 3300037068 | Bacteria | 6101 |
| 295 | Ga0373925_0062792 | 3300037068 | Bacteria | 2793 |
| 296 | Ga0395900_0026692 | 3300037418 | Bacteria | 5912 |
| 297 | Ga0395898_0004631 | 3300037466 | Bacteria | 15002 |
| 298 | Ga0395898_0073042 | 3300037466 | Bacteria | 3313 |
| 299 | Ga0436364_0777503 | 3300037853 | Bacteria | 3747 |
| 300 | Ga0395901_0059735 | 3300038443 | Bacteria | 3967 |
| 301 | Ga0436365_1115617 | 3300039437 | Bacteria | 2530 |
| 302 | Ga0436365_1293604 | 3300039437 | Bacteria | 3359 |
| 303 | Ga0436363_1082211 | 3300039450 | Bacteria | 2150 |
| 304 | Ga0436362_0749727 | 3300039453 | Bacteria | 2643 |
| 305 | Ga0466957_0042736 | 3300044842 | Bacteria | 2743 |
| 306 | Ga0466957_0087966 | 3300044842 | Bacteria | 1943 |
| 307 | Ga0466960_0045989 | 3300044901 | Bacteria | 2087 |
| 308 | Ga0466958_0275431 | 3300045836 | Bacteria | 1078 |
| 309 | Ga0495592_0002074 | 3300046454 | Bacteria | 14129 |
| 310 | Ga0495592_0142504 | 3300046454 | Bacteria | 1665 |
| 311 | Ga0495603_0000370 | 3300046455 | Bacteria | 24383 |
| 312 | Ga0495603_0025895 | 3300046455 | Bacteria | 3546 |
| 313 | Ga0495590_0047989 | 3300046457 | Bacteria | 1489 |
| 314 | Ga0495629_0000081 | 3300046459 | Bacteria | 85305 |
| 315 | Ga0495629_0000380 | 3300046459 | Bacteria | 37205 |
| 316 | Ga0495629_0210465 | 3300046459 | Bacteria | 1343 |
| 317 | Ga0495638_0011951 | 3300046460 | Bacteria | 5968 |
| 318 | Ga0495638_0053069 | 3300046460 | Bacteria | 2523 |
| 319 | Ga0495638_0164057 | 3300046460 | Bacteria | 1279 |
| 320 | Ga0495641_0010022 | 3300046461 | Bacteria | 5556 |
| 321 | Ga0495651_0014993 | 3300046462 | Bacteria | 5989 |
| 322 | Ga0495580_0003868 | 3300046472 | Bacteria | 12674 |
| 323 | Ga0495582_0000051 | 3300046473 | Bacteria | 59010 |
| 324 | Ga0495605_0047519 | 3300046474 | Bacteria | 2105 |
| 325 | Ga0495639_0000010 | 3300046475 | Bacteria | 93685 |
| 326 | Ga0495639_0018281 | 3300046475 | Bacteria | 3050 |
| 327 | Ga0495639_0031626 | 3300046475 | Bacteria | 2357 |
| 328 | Ga0495664_0009894 | 3300046477 | Bacteria | 5349 |
| 329 | Ga0495664_0041991 | 3300046477 | Bacteria | 2707 |
| 330 | Ga0495664_0093780 | 3300046477 | Bacteria | 1806 |
| 331 | Ga0495664_0254464 | 3300046477 | Bacteria | 1062 |
| 332 | Ga0495584_0067523 | 3300046491 | Bacteria | 1797 |
| 333 | Ga0495584_0107481 | 3300046491 | Bacteria | 1411 |
| 334 | Ga0495584_0116425 | 3300046491 | Bacteria | 1353 |
| 335 | Ga0495584_0167027 | 3300046491 | Bacteria | 1118 |
| 336 | Ga0495585_0028557 | 3300046492 | Bacteria | 3181 |
| 337 | Ga0495594_0001074 | 3300046499 | Bacteria | 14256 |
| 338 | Ga0495594_0045416 | 3300046499 | Bacteria | 2411 |
| 339 | Ga0495594_0156642 | 3300046499 | Bacteria | 1294 |
| 340 | Ga0495608_0008172 | 3300046511 | Bacteria | 7348 |
| 341 | Ga0495610_0022155 | 3300046512 | Bacteria | 3480 |
| 342 | Ga0495616_0038018 | 3300046513 | Bacteria | 2473 |
| 343 | Ga0495616_0057832 | 3300046513 | Bacteria | 1911 |
| 344 | Ga0495618_0084248 | 3300046514 | Bacteria | 2031 |
| 345 | Ga0495628_0006360 | 3300046516 | Bacteria | 10325 |
| 346 | Ga0495628_0058702 | 3300046516 | Bacteria | 3022 |
| 347 | Ga0495628_0073947 | 3300046516 | Bacteria | 2655 |
| 348 | Ga0495630_0005257 | 3300046517 | Bacteria | 9131 |
| 349 | Ga0495630_0027348 | 3300046517 | Bacteria | 4230 |
| 350 | Ga0495631_0084020 | 3300046518 | Bacteria | 1372 |
| 351 | Ga0495631_0139210 | 3300046518 | Bacteria | 1042 |
| 352 | Ga0495632_0045554 | 3300046519 | Bacteria | 2184 |
| 353 | Ga0495643_0010324 | 3300046522 | Bacteria | 5750 |
| 354 | Ga0495644_0059195 | 3300046523 | Bacteria | 1440 |
| 355 | Ga0495663_0018464 | 3300046525 | Bacteria | 1986 |
| 356 | Ga0495652_0007397 | 3300046529 | Bacteria | 10125 |
| 357 | Ga0495652_0028959 | 3300046529 | Bacteria | 4866 |
| 358 | Ga0495652_0066013 | 3300046529 | Bacteria | 3039 |
| 359 | Ga0495665_0000005 | 3300046531 | Bacteria | 86491 |
| 360 | Ga0495640_0000301 | 3300046533 | Bacteria | 33996 |
| 361 | Ga0495640_0029278 | 3300046533 | Bacteria | 3956 |
| 362 | Ga0495640_0038921 | 3300046533 | Bacteria | 3341 |
| 363 | Ga0495586_0074156 | 3300046535 | Bacteria | 1862 |
| 364 | Ga0495587_0002764 | 3300046536 | Bacteria | 11712 |
| 365 | Ga0495598_0001714 | 3300046537 | Bacteria | 4394 |
| 366 | Ga0495598_0014228 | 3300046537 | Bacteria | 1986 |
| 367 | Ga0495645_0011053 | 3300046543 | Bacteria | 6344 |
| 368 | Ga0495622_0001809 | 3300046557 | Bacteria | 10530 |
| 369 | Ga0495622_0051134 | 3300046557 | Bacteria | 1917 |
| 370 | Ga0495633_0028798 | 3300046558 | Bacteria | 2704 |
| 371 | Ga0495633_0091097 | 3300046558 | Bacteria | 1417 |
| 372 | Ga0495667_0002956 | 3300046559 | Bacteria | 11399 |
| 373 | Ga0495656_0004197 | 3300046615 | Bacteria | 4920 |
| 374 | Ga0495656_0010666 | 3300046615 | Bacteria | 3347 |
| 375 | Ga0495668_0089959 | 3300046616 | Bacteria | 1682 |
| 376 | Ga0495668_0100025 | 3300046616 | Bacteria | 1586 |
| 377 | Ga0495634_0000764 | 3300046642 | Bacteria | 31101 |
| 378 | Ga0495634_0010702 | 3300046642 | Bacteria | 6713 |
| 379 | Ga0495611_0046609 | 3300046648 | Bacteria | 1944 |
| 380 | Ga0495611_0132196 | 3300046648 | Bacteria | 1164 |
| 381 | Ga0495625_0060007 | 3300046660 | Bacteria | 2696 |
| 382 | Ga0495625_0062924 | 3300046660 | Bacteria | 2621 |
| 383 | Ga0495625_0100848 | 3300046660 | Bacteria | 1984 |
| 384 | Ga0495635_0000213 | 3300046663 | Bacteria | 36809 |
| 385 | Ga0495635_0011036 | 3300046663 | Bacteria | 6334 |
| 386 | Ga0495635_0274639 | 3300046663 | Bacteria | 1133 |
| 387 | Ga0495659_0001624 | 3300046664 | Bacteria | 7546 |
| 388 | Ga0495659_0002657 | 3300046664 | Bacteria | 5753 |
| 389 | Ga0495588_0008118 | 3300046674 | Bacteria | 4800 |
| 390 | Ga0495588_0016706 | 3300046674 | Bacteria | 3550 |
| 391 | Ga0495588_0079805 | 3300046674 | Bacteria | 1708 |
| 392 | Ga0495657_0015790 | 3300046675 | Bacteria | 5516 |
| 393 | Ga0495599_0043648 | 3300046678 | Bacteria | 2814 |
| 394 | Ga0495599_0059778 | 3300046678 | Bacteria | 2384 |
| 395 | Ga0495646_0009214 | 3300046680 | Bacteria | 6264 |
| 396 | Ga0495646_0012040 | 3300046680 | Bacteria | 5503 |
| 397 | Ga0495646_0017126 | 3300046680 | Bacteria | 4600 |
| 398 | Ga0495647_0019117 | 3300046681 | Bacteria | 2447 |
| 399 | Ga0495647_0021128 | 3300046681 | Bacteria | 2342 |
| 400 | Ga0495658_0008495 | 3300046683 | Bacteria | 5090 |
| 401 | Ga0495658_0011732 | 3300046683 | Bacteria | 4416 |
| 402 | Ga0495658_0149931 | 3300046683 | Bacteria | 1432 |
| 403 | Ga0495669_0025017 | 3300046684 | Bacteria | 2602 |
| 404 | Ga0495669_0069057 | 3300046684 | Bacteria | 1608 |
| 405 | Ga0495613_0007909 | 3300046689 | Bacteria | 7909 |
| 406 | Ga0495613_0041536 | 3300046689 | Bacteria | 3406 |
| 407 | Ga0495624_0000094 | 3300046690 | Bacteria | 59911 |
| 408 | Ga0495649_0031715 | 3300046694 | Bacteria | 2913 |
| 409 | Ga0495589_0087310 | 3300046794 | Bacteria | 1515 |
| 410 | Ga0495589_0099858 | 3300046794 | Bacteria | 1405 |
| 411 | Ga0495600_0001029 | 3300046809 | Bacteria | 15081 |
| 412 | Ga0495660_0041199 | 3300046810 | Bacteria | 2559 |
| 413 | Ga0495581_0001146 | 3300047315 | Bacteria | 14489 |
| 414 | Ga0495581_0227254 | 3300047315 | Bacteria | 1092 |
| 415 | Ga0495604_0005951 | 3300047317 | Bacteria | 9677 |
| 416 | Ga0495604_0181886 | 3300047317 | Bacteria | 1470 |
| 417 | Ga0495636_0034558 | 3300047318 | Bacteria | 2081 |
| 418 | Ga0495674_0000134 | 3300047319 | Bacteria | 56618 |
| 419 | Ga0495674_0013244 | 3300047319 | Bacteria | 7754 |
| 420 | Ga0495672_0016185 | 3300047320 | Bacteria | 5039 |
| 421 | Ga0495672_0041142 | 3300047320 | Bacteria | 2797 |
| 422 | Ga0495672_0099378 | 3300047320 | Bacteria | 1582 |
| 423 | Ga0495676_0111796 | 3300047321 | Bacteria | 2003 |
| 424 | Ga0495680_0002637 | 3300047322 | Bacteria | 18206 |
| 425 | Ga0495683_0086940 | 3300047323 | Bacteria | 1519 |
| 426 | Ga0495675_0000756 | 3300047444 | Bacteria | 20233 |
| 427 | Ga0495677_0039017 | 3300047445 | Bacteria | 1736 |
| 428 | Ga0495677_0052584 | 3300047445 | Bacteria | 1501 |
| 429 | Ga0495684_0000052 | 3300047471 | Bacteria | 85125 |
| 430 | Ga0495684_0005982 | 3300047471 | Bacteria | 9452 |
| 431 | Ga0495684_0007719 | 3300047471 | Bacteria | 8329 |
| 432 | Ga0495593_0000084 | 3300047673 | Bacteria | 41155 |
| 433 | Ga0495593_0000518 | 3300047673 | Bacteria | 21864 |
| 434 | Ga0495593_0030563 | 3300047673 | Bacteria | 2947 |
| 435 | Ga0495614_0056293 | 3300048089 | Bacteria | 1688 |
| 436 | Ga0495615_0013052 | 3300048090 | Bacteria | 1728 |
| 437 | Ga0495626_0039608 | 3300048091 | Bacteria | 2230 |
| 438 | Ga0496100_0013812 | 3300048903 | Bacteria | 4671 |
| 439 | Ga0496102_0005804 | 3300048905 | Bacteria | 10496 |
| 440 | Ga0496103_0023140 | 3300048906 | Bacteria | 3746 |
| 441 | Ga0496104_0039927 | 3300048907 | Bacteria | 4396 |
| 442 | Ga0496106_0247514 | 3300048909 | Bacteria | 1425 |
| 443 | Ga0496106_0347380 | 3300048909 | Bacteria | 1192 |
| 444 | Ga0496107_0016390 | 3300048910 | Bacteria | 5202 |
| 445 | Ga0496107_0208845 | 3300048910 | Bacteria | 1452 |
| 446 | Ga0496108_0012856 | 3300048911 | Bacteria | 6818 |
| 447 | Ga0496109_0016364 | 3300048912 | Bacteria | 6482 |
| 448 | Ga0496110_0100507 | 3300048913 | Bacteria | 2592 |
| 449 | Ga0496111_0025250 | 3300048914 | Bacteria | 4192 |
| 450 | Ga0496112_0069765 | 3300048915 | Bacteria | 3471 |
| 451 | Ga0496112_0413543 | 3300048915 | Bacteria | 1288 |
| 452 | Ga0496113_0020850 | 3300048916 | Bacteria | 4615 |
| 453 | Ga0496113_0416570 | 3300048916 | Bacteria | 1079 |
| 454 | Ga0496114_0016833 | 3300048917 | Bacteria | 5896 |
| 455 | Ga0496114_0178261 | 3300048917 | Bacteria | 1855 |
| 456 | Ga0496115_0001776 | 3300048918 | Bacteria | 15451 |
| 457 | Ga0496115_0391744 | 3300048918 | Bacteria | 1128 |
| 458 | Ga0496117_0010024 | 3300048920 | Bacteria | 8707 |
| 459 | Ga0496118_0012015 | 3300048921 | Bacteria | 8367 |
| 460 | Ga0496118_0124129 | 3300048921 | Bacteria | 1676 |
| 461 | Ga0496118_0135871 | 3300048921 | Bacteria | 1569 |
| 462 | Ga0496120_0052513 | 3300048923 | Bacteria | 2321 |
| 463 | Ga0496121_0002340 | 3300048924 | Bacteria | 29257 |
| 464 | Ga0496121_0004993 | 3300048924 | Bacteria | 17367 |
| 465 | Ga0496121_0060700 | 3300048924 | Bacteria | 3108 |
| 466 | Ga0496121_0101832 | 3300048924 | Bacteria | 2214 |
| 467 | Ga0496121_0184619 | 3300048924 | Bacteria | 1501 |
| 468 | Ga0496121_0230402 | 3300048924 | Bacteria | 1298 |
| 469 | Ga0496121_0248698 | 3300048924 | Bacteria | 1234 |
| 470 | Ga0496124_0223048 | 3300048927 | Bacteria | 1416 |
| 471 | Ga0496125_0157408 | 3300048928 | Bacteria | 1549 |
| 472 | Ga0496126_0089405 | 3300048929 | Bacteria | 2711 |
| 473 | Ga0496126_0119677 | 3300048929 | Bacteria | 2285 |
| 474 | Ga0496126_0199212 | 3300048929 | Bacteria | 1692 |
| 475 | Ga0496126_0284739 | 3300048929 | Bacteria | 1368 |
| 476 | Ga0496126_0286454 | 3300048929 | Bacteria | 1363 |
| 477 | Ga0496126_0373232 | 3300048929 | Bacteria | 1163 |
| 478 | Ga0501047_0046968 | 3300049581 | Bacteria | 4172 |
| 479 | Ga0501067_0066626 | 3300049583 | Bacteria | 1993 |
| 480 | Ga0501070_0064188 | 3300049586 | Bacteria | 3041 |
| 481 | nmdc:mga00v17_121556_c1 | 3300050491 | Bacteria | 1663 |
| 482 | nmdc:mga0yw44_246584_c1 | 3300050492 | Bacteria | 1188 |
| 483 | nmdc:mga0yw44_77243_c1 | 3300050492 | Bacteria | 2080 |
| 484 | nmdc:mga0k408_196813_c1 | 3300050493 | Bacteria | 1203 |
| 485 | nmdc:mga0sz30_13283_c1 | 3300050516 | Bacteria | 3222 |
| 486 | Ga0495601_0032539 | 3300053077 | Bacteria | 3247 |
| 487 | Ga0495601_0215782 | 3300053077 | Bacteria | 1253 |
| 488 | Ga0495612_0147994 | 3300053078 | Bacteria | 1021 |
| 489 | Ga0500635_0013807 | 3300053080 | Bacteria | 2354 |
| 490 | Ga0500635_0018312 | 3300053080 | Bacteria | 2111 |
| 491 | Ga0500635_0024833 | 3300053080 | Bacteria | 1884 |
| 492 | Ga0495595_0000279 | 3300053084 | Bacteria | 20119 |
| 493 | Ga0495619_0091211 | 3300053085 | Bacteria | 2063 |
| 494 | Ga0500578_0140548 | 3300053086 | Bacteria | 1510 |
| 495 | Ga0500643_000091 | 3300053087 | Bacteria | 93825 |
| 496 | Ga0500651_0001238 | 3300053093 | Bacteria | 12692 |
| 497 | Ga0500566_0000762 | 3300053094 | Bacteria | 18172 |
| 498 | Ga0500640_104185 | 3300053095 | Bacteria | 1167 |
| 499 | Ga0500641_0028991 | 3300053096 | Bacteria | 2166 |
| 500 | Ga0500641_0032707 | 3300053096 | Bacteria | 2059 |
| 501 | Ga0500554_002407 | 3300053102 | Bacteria | 3676 |
| 502 | Ga0500554_006683 | 3300053102 | Bacteria | 2605 |
| 503 | Ga0500555_001359 | 3300053103 | Bacteria | 7623 |
| 504 | Ga0500556_0010118 | 3300053104 | Bacteria | 2759 |
| 505 | Ga0500562_005656 | 3300053108 | Bacteria | 3145 |
| 506 | Ga0500562_029053 | 3300053108 | Bacteria | 1454 |
| 507 | Ga0500595_000199 | 3300053119 | Bacteria | 40993 |
| 508 | Ga0500595_002625 | 3300053119 | Bacteria | 8752 |
| 509 | Ga0500595_009809 | 3300053119 | Bacteria | 3846 |
| 510 | Ga0500595_028833 | 3300053119 | Bacteria | 1889 |
| 511 | Ga0500595_039188 | 3300053119 | Bacteria | 1535 |
| 512 | Ga0500614_044558 | 3300053123 | Bacteria | 1141 |
| 513 | Ga0500618_000261 | 3300053125 | Bacteria | 41070 |
| 514 | Ga0500642_0001930 | 3300053130 | Bacteria | 6007 |
| 515 | Ga0500642_0031781 | 3300053130 | Bacteria | 2209 |
| 516 | Ga0500658_0003734 | 3300053134 | Bacteria | 5735 |
| 517 | Ga0500561_0051472 | 3300053137 | Bacteria | 1125 |
| 518 | Ga0500568_0080002 | 3300053139 | Bacteria | 1241 |
| 519 | Ga0500568_0095530 | 3300053139 | Bacteria | 1118 |
| 520 | Ga0500588_0037424 | 3300053146 | Bacteria | 1441 |
| 521 | Ga0500590_014489 | 3300053148 | Bacteria | 4066 |
| 522 | Ga0500603_007126 | 3300053150 | Bacteria | 2449 |
| 523 | Ga0500622_0025248 | 3300053156 | Bacteria | 3140 |
| 524 | Ga0500622_0035703 | 3300053156 | Bacteria | 2601 |
| 525 | Ga0500630_055180 | 3300053159 | Bacteria | 1910 |
| 526 | Ga0500633_0044065 | 3300053160 | Bacteria | 1513 |
| 527 | Ga0500634_0131051 | 3300053161 | Bacteria | 1204 |
| 528 | Ga0500638_017623 | 3300053162 | Bacteria | 3318 |
| 529 | Ga0500639_002046 | 3300053163 | Bacteria | 10075 |
| 530 | Ga0500636_0095356 | 3300053177 | Bacteria | 1698 |
| 531 | Ga0500636_0099606 | 3300053177 | Bacteria | 1654 |
| 532 | Ga0500637_0000155 | 3300053178 | Bacteria | 25033 |
| 533 | Ga0500637_0000757 | 3300053178 | Bacteria | 12952 |
| 534 | Ga0500637_0078433 | 3300053178 | Bacteria | 1906 |
| 535 | Ga0500596_001525 | 3300053735 | Bacteria | 4691 |
| 536 | Ga0500599_000697 | 3300053736 | Bacteria | 3628 |
| 537 | Ga0500661_000885 | 3300055283 | Bacteria | 5610 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048921 | Ga0496118_0135871 | Ga0496118_0135871_762_1559 | 260 |
| 2 | 3300005339 | Ga0070660_100458038 | Ga0070660_1004580381 | 266 |
| 3 | 3300025981 | Ga0207640_10164248 | Ga0207640_101642483 | 270 |
| 4 | 3300005578 | Ga0068854_100408815 | Ga0068854_1004088151 | 272 |
| 5 | 3300047445 | Ga0495677_0039017 | Ga0495677_0039017_418_1242 | 272 |
| 6 | 3300053146 | Ga0500588_0037424 | Ga0500588_0037424_11_835 | 273 |
| 7 | iso_pu_bacteria | 8019659431 | 8019667412 | 275 |
| 8 | 3300005543 | Ga0070672_100672694 | Ga0070672_1006726942 | 276 |
| 9 | 3300026121 | Ga0207683_10061169 | Ga0207683_100611693 | 276 |
| 10 | 3300025942 | Ga0207689_10132535 | Ga0207689_101325351 | 277 |
| 11 | 3300046477 | Ga0495664_0254464 | Ga0495664_0254464_190_1032 | 280 |
| 12 | 3300046529 | Ga0495652_0028959 | Ga0495652_0028959_3233_4090 | 284 |
| 13 | 3300005548 | Ga0070665_100036744 | Ga0070665_1000367444 | 285 |
| 14 | 3300028379 | Ga0268266_10042528 | Ga0268266_100425284 | 285 |
| 15 | 3300048923 | Ga0496120_0052513 | Ga0496120_0052513_1025_2002 | 285 |
| 16 | 3300053087 | Ga0500643_000091 | Ga0500643_000091_82784_83764 | 286 |
| 17 | 3300053104 | Ga0500556_0010118 | Ga0500556_0010118_1031_2011 | 286 |
| 18 | iso_pu_bacteria | 8019555841 | 8019563233 | 289 |
| 19 | 3300011119 | Ga0105246_10297981 | Ga0105246_102979812 | 291 |
| 20 | 3300031711 | Ga0265314_10181694 | Ga0265314_101816941 | 292 |
| 21 | 3300037466 | Ga0395898_0073042 | Ga0395898_0073042_15_896 | 293 |
| 22 | 3300005458 | Ga0070681_10071598 | Ga0070681_100715982 | 301 |
| 23 | 3300025912 | Ga0207707_10016028 | Ga0207707_100160284 | 301 |
| 24 | 3300053177 | Ga0500636_0099606 | Ga0500636_0099606_480_1430 | 303 |
| 25 | 3300003214 | JGI25165J46597_1005485 | JGI25165J46597_10054852 | 305 |
| 26 | 3300025261 | Ga0209233_1006575 | Ga0209233_10065752 | 305 |
| 27 | 3300005548 | Ga0070665_100128810 | Ga0070665_1001288102 | 307 |
| 28 | 3300033180 | Ga0307510_10053110 | Ga0307510_100531102 | 307 |
| 29 | 3300046460 | Ga0495638_0053069 | Ga0495638_0053069_1484_2440 | 307 |
| 30 | 3300035111 | Ga0373923_0007505 | Ga0373923_0007505_28_957 | 309 |
| 31 | 3300035116 | Ga0373945_0005833 | Ga0373945_0005833_1446_2375 | 309 |
| 32 | 3300035170 | Ga0373943_0026917 | Ga0373943_0026917_1609_2538 | 309 |
| 33 | 3300037068 | Ga0373925_0062792 | Ga0373925_0062792_443_1372 | 309 |
| 34 | 3300044842 | Ga0466957_0042736 | Ga0466957_0042736_25_954 | 309 |
| 35 | 3300046475 | Ga0495639_0018281 | Ga0495639_0018281_1840_2769 | 309 |
| 36 | 3300046477 | Ga0495664_0041991 | Ga0495664_0041991_1452_2381 | 309 |
| 37 | 3300046514 | Ga0495618_0084248 | Ga0495618_0084248_1082_2011 | 309 |
| 38 | 3300046516 | Ga0495628_0058702 | Ga0495628_0058702_1475_2404 | 309 |
| 39 | 3300046517 | Ga0495630_0027348 | Ga0495630_0027348_1785_2714 | 309 |
| 40 | 3300046529 | Ga0495652_0066013 | Ga0495652_0066013_1501_2430 | 309 |
| 41 | 3300046533 | Ga0495640_0038921 | Ga0495640_0038921_1247_2176 | 309 |
| 42 | 3300046663 | Ga0495635_0274639 | Ga0495635_0274639_138_1067 | 309 |
| 43 | 3300046680 | Ga0495646_0012040 | Ga0495646_0012040_166_1095 | 309 |
| 44 | 3300046683 | Ga0495658_0008495 | Ga0495658_0008495_1619_2548 | 309 |
| 45 | 3300046689 | Ga0495613_0041536 | Ga0495613_0041536_1168_2097 | 309 |
| 46 | 3300047471 | Ga0495684_0005982 | Ga0495684_0005982_1546_2475 | 309 |
| 47 | 3300047673 | Ga0495593_0030563 | Ga0495593_0030563_1702_2631 | 309 |
| 48 | 3300048924 | Ga0496121_0184619 | Ga0496121_0184619_172_1125 | 309 |
| 49 | 3300004625 | Ga0055543_1002478 | Ga0055543_10024785 | 311 |
| 50 | 3300005262 | Ga0065165_1001304 | Ga0065165_100130417 | 311 |
| 51 | 3300033180 | Ga0307510_10007534 | Ga0307510_100075344 | 311 |
| 52 | 3300035692 | Ga0373935_0045315 | Ga0373935_0045315_878_1849 | 311 |
| 53 | 3300044901 | Ga0466960_0045989 | Ga0466960_0045989_800_1747 | 311 |
| 54 | 3300046460 | Ga0495638_0011951 | Ga0495638_0011951_1056_2036 | 311 |
| 55 | 3300046694 | Ga0495649_0031715 | Ga0495649_0031715_1760_2740 | 311 |
| 56 | 3300053103 | Ga0500555_001359 | Ga0500555_001359_1038_2018 | 311 |
| 57 | 3300053108 | Ga0500562_005656 | Ga0500562_005656_459_1439 | 311 |
| 58 | 3300053130 | Ga0500642_0031781 | Ga0500642_0031781_162_1142 | 311 |
| 59 | 3300053134 | Ga0500658_0003734 | Ga0500658_0003734_3074_4054 | 311 |
| 60 | 3300053156 | Ga0500622_0025248 | Ga0500622_0025248_470_1450 | 311 |
| 61 | 3300053736 | Ga0500599_000697 | Ga0500599_000697_2058_3038 | 311 |
| 62 | iso_pu_bacteria | 2511231028 | 2511400233 | 311 |
| 63 | iso_pu_bacteria | 2513237096 | 2513656478 | 311 |
| 64 | iso_pu_bacteria | 2513237098 | 2513673004 | 311 |
| 65 | iso_pu_bacteria | 2513237137 | 2513858948 | 311 |
| 66 | iso_pu_bacteria | 2513237145 | 2513917343 | 311 |
| 67 | iso_pu_bacteria | 2517572143 | 2517889566 | 311 |
| 68 | iso_pu_bacteria | 2791355197 | 2793073653 | 311 |
| 69 | iso_pu_bacteria | 2903748898 | 2903754119 | 311 |
| 70 | iso_pu_bacteria | 2904690495 | 2904692132 | 311 |
| 71 | iso_pu_bacteria | 2908756301 | 2908757414 | 311 |
| 72 | iso_pu_bacteria | 2935630451 | 2935635065 | 311 |
| 73 | iso_pu_bacteria | 2941507105 | 2941511656 | 311 |
| 74 | iso_pu_bacteria | 2941515067 | 2941519361 | 311 |
| 75 | iso_pu_bacteria | 2941523033 | 2941527515 | 311 |
| 76 | iso_pu_bacteria | 8019565922 | 8019573312 | 311 |
| 77 | 3300035170 | Ga0373943_0044897 | Ga0373943_0044897_622_1629 | 312 |
| 78 | iso_pu_bacteria | 2524023228 | 2524539558 | 312 |
| 79 | iso_pu_bacteria | 2908739725 | 2908748066 | 312 |
| 80 | iso_pu_bacteria | 2922361189 | 2922363302 | 312 |
| 81 | iso_pu_bacteria | 2922425934 | 2922433526 | 312 |
| 82 | iso_pu_bacteria | 8006994254 | 8007000276 | 312 |
| 83 | iso_pu_bacteria | 8056689827 | 8056692778 | 312 |
| 84 | 3300025906 | Ga0207699_10068446 | Ga0207699_100684462 | 313 |
| 85 | 3300026089 | Ga0207648_10018779 | Ga0207648_100187793 | 313 |
| 86 | 3300048929 | Ga0496126_0089405 | Ga0496126_0089405_1539_2483 | 313 |
| 87 | iso_pu_bacteria | 2513237101 | 2513694895 | 313 |
| 88 | iso_pu_bacteria | 2667528175 | 2671121244 | 313 |
| 89 | iso_pu_bacteria | 2721755755 | 2723842052 | 313 |
| 90 | iso_pu_bacteria | 2791355199 | 2793077398 | 313 |
| 91 | iso_pu_bacteria | 2841911363 | 2841913566 | 313 |
| 92 | iso_pu_bacteria | 2841917233 | 2841919313 | 313 |
| 93 | iso_pu_bacteria | 2874604998 | 2874610330 | 313 |
| 94 | iso_pu_bacteria | 2876808645 | 2876812807 | 313 |
| 95 | iso_pu_bacteria | 2879110137 | 2879111651 | 313 |
| 96 | iso_pu_bacteria | 2885374607 | 2885375072 | 313 |
| 97 | iso_pu_bacteria | 2889033259 | 2889035042 | 313 |
| 98 | iso_pu_bacteria | 2903768456 | 2903772297 | 313 |
| 99 | iso_pu_bacteria | 2904699407 | 2904709388 | 313 |
| 100 | iso_pu_bacteria | 2906610324 | 2906613054 | 313 |
| 101 | iso_pu_bacteria | 2922386360 | 2922388585 | 313 |
| 102 | iso_pu_bacteria | 8006933436 | 8006935577 | 313 |
| 103 | iso_pu_bacteria | 8006984368 | 8006985902 | 313 |
| 104 | iso_pu_bacteria | 8056673599 | 8056677757 | 313 |
| 105 | 3300005331 | Ga0070670_100492120 | Ga0070670_1004921201 | 314 |
| 106 | 3300005334 | Ga0068869_100075431 | Ga0068869_1000754312 | 314 |
| 107 | 3300005347 | Ga0070668_100025353 | Ga0070668_1000253532 | 314 |
| 108 | 3300005436 | Ga0070713_100010942 | Ga0070713_1000109421 | 314 |
| 109 | 3300005455 | Ga0070663_100046798 | Ga0070663_1000467982 | 314 |
| 110 | 3300005456 | Ga0070678_100080739 | Ga0070678_1000807392 | 314 |
| 111 | 3300005458 | Ga0070681_10147501 | Ga0070681_101475012 | 314 |
| 112 | 3300005563 | Ga0068855_100170497 | Ga0068855_1001704972 | 314 |
| 113 | 3300005577 | Ga0068857_100296516 | Ga0068857_1002965162 | 314 |
| 114 | 3300005617 | Ga0068859_100049556 | Ga0068859_1000495562 | 314 |
| 115 | 3300005719 | Ga0068861_100102320 | Ga0068861_1001023202 | 314 |
| 116 | 3300005842 | Ga0068858_100130009 | Ga0068858_1001300092 | 314 |
| 117 | 3300005843 | Ga0068860_100127031 | Ga0068860_1001270312 | 314 |
| 118 | 3300005844 | Ga0068862_100187288 | Ga0068862_1001872882 | 314 |
| 119 | 3300005983 | Ga0081540_1033224 | Ga0081540_10332242 | 314 |
| 120 | 3300006051 | Ga0075364_10071250 | Ga0075364_100712502 | 314 |
| 121 | 3300006175 | Ga0070712_100166135 | Ga0070712_1001661353 | 314 |
| 122 | 3300006237 | Ga0097621_100166720 | Ga0097621_1001667202 | 314 |
| 123 | 3300006358 | Ga0068871_100170998 | Ga0068871_1001709982 | 314 |
| 124 | 3300006931 | Ga0097620_100049556 | Ga0097620_1000495562 | 314 |
| 125 | 3300009098 | Ga0105245_10081624 | Ga0105245_100816242 | 314 |
| 126 | 3300009101 | Ga0105247_10083129 | Ga0105247_100831291 | 314 |
| 127 | 3300009545 | Ga0105237_10061212 | Ga0105237_100612122 | 314 |
| 128 | 3300010375 | Ga0105239_10109735 | Ga0105239_101097353 | 314 |
| 129 | 3300011119 | Ga0105246_10071182 | Ga0105246_100711822 | 314 |
| 130 | 3300013297 | Ga0157378_10153466 | Ga0157378_101534662 | 314 |
| 131 | 3300013306 | Ga0163162_10433832 | Ga0163162_104338321 | 314 |
| 132 | 3300013308 | Ga0157375_10393938 | Ga0157375_103939382 | 314 |
| 133 | 3300014968 | Ga0157379_10192298 | Ga0157379_101922982 | 314 |
| 134 | 3300014969 | Ga0157376_10034273 | Ga0157376_100342734 | 314 |
| 135 | 3300025315 | Ga0207697_10070847 | Ga0207697_100708472 | 314 |
| 136 | 3300025901 | Ga0207688_10153378 | Ga0207688_101533782 | 314 |
| 137 | 3300025904 | Ga0207647_10235185 | Ga0207647_102351851 | 314 |
| 138 | 3300025911 | Ga0207654_10107316 | Ga0207654_101073162 | 314 |
| 139 | 3300025912 | Ga0207707_10153825 | Ga0207707_101538253 | 314 |
| 140 | 3300025914 | Ga0207671_10094023 | Ga0207671_100940232 | 314 |
| 141 | 3300025921 | Ga0207652_10010669 | Ga0207652_100106693 | 314 |
| 142 | 3300025924 | Ga0207694_10202133 | Ga0207694_102021331 | 314 |
| 143 | 3300025927 | Ga0207687_10011663 | Ga0207687_100116634 | 314 |
| 144 | 3300025928 | Ga0207700_10080287 | Ga0207700_100802872 | 314 |
| 145 | 3300025949 | Ga0207667_10177915 | Ga0207667_101779152 | 314 |
| 146 | 3300025972 | Ga0207668_10010779 | Ga0207668_100107794 | 314 |
| 147 | 3300026116 | Ga0207674_10311608 | Ga0207674_103116081 | 314 |
| 148 | 3300026118 | Ga0207675_100071021 | Ga0207675_1000710212 | 314 |
| 149 | 3300026118 | Ga0207675_100108650 | Ga0207675_1001086502 | 314 |
| 150 | 3300026121 | Ga0207683_10121783 | Ga0207683_101217832 | 314 |
| 151 | 3300028380 | Ga0268265_10112000 | Ga0268265_101120002 | 314 |
| 152 | 3300031901 | Ga0307406_10144211 | Ga0307406_101442112 | 314 |
| 153 | 3300044842 | Ga0466957_0087966 | Ga0466957_0087966_865_1809 | 314 |
| 154 | 3300045836 | Ga0466958_0275431 | Ga0466958_0275431_122_1066 | 314 |
| 155 | 3300046513 | Ga0495616_0038018 | Ga0495616_0038018_935_1882 | 314 |
| 156 | 3300046519 | Ga0495632_0045554 | Ga0495632_0045554_852_1799 | 314 |
| 157 | 3300046660 | Ga0495625_0060007 | Ga0495625_0060007_1416_2363 | 314 |
| 158 | 3300047320 | Ga0495672_0041142 | Ga0495672_0041142_418_1368 | 314 |
| 159 | 3300048091 | Ga0495626_0039608 | Ga0495626_0039608_222_1169 | 314 |
| 160 | 3300048916 | Ga0496113_0416570 | Ga0496113_0416570_78_1028 | 314 |
| 161 | 3300048929 | Ga0496126_0119677 | Ga0496126_0119677_1246_2193 | 314 |
| 162 | 3300048929 | Ga0496126_0286454 | Ga0496126_0286454_13_960 | 314 |
| 163 | 3300048929 | Ga0496126_0373232 | Ga0496126_0373232_59_1009 | 314 |
| 164 | 3300050491 | nmdc:mga00v17_121556_c1 | nmdc:mga00v17_121556_c1_605_1555 | 314 |
| 165 | 3300053096 | Ga0500641_0028991 | Ga0500641_0028991_296_1246 | 314 |
| 166 | 3300053125 | Ga0500618_000261 | Ga0500618_000261_6081_7034 | 314 |
| 167 | 3300053160 | Ga0500633_0044065 | Ga0500633_0044065_533_1483 | 314 |
| 168 | 3300003215 | JGI25153J46596_10006239 | JGI25153J46596_100062395 | 315 |
| 169 | 3300003320 | rootH2_10211234 | rootH2_102112341 | 315 |
| 170 | 3300005329 | Ga0070683_100013043 | Ga0070683_1000130433 | 315 |
| 171 | 3300005329 | Ga0070683_100136917 | Ga0070683_1001369172 | 315 |
| 172 | 3300005335 | Ga0070666_10241275 | Ga0070666_102412751 | 315 |
| 173 | 3300005336 | Ga0070680_100228694 | Ga0070680_1002286942 | 315 |
| 174 | 3300005337 | Ga0070682_100013158 | Ga0070682_1000131581 | 315 |
| 175 | 3300005338 | Ga0068868_100203215 | Ga0068868_1002032152 | 315 |
| 176 | 3300005338 | Ga0068868_100244205 | Ga0068868_1002442052 | 315 |
| 177 | 3300005353 | Ga0070669_100157071 | Ga0070669_1001570711 | 315 |
| 178 | 3300005354 | Ga0070675_100100975 | Ga0070675_1001009752 | 315 |
| 179 | 3300005356 | Ga0070674_100052706 | Ga0070674_1000527062 | 315 |
| 180 | 3300005364 | Ga0070673_100108350 | Ga0070673_1001083502 | 315 |
| 181 | 3300005364 | Ga0070673_100115687 | Ga0070673_1001156871 | 315 |
| 182 | 3300005366 | Ga0070659_100392737 | Ga0070659_1003927371 | 315 |
| 183 | 3300005439 | Ga0070711_100047715 | Ga0070711_1000477152 | 315 |
| 184 | 3300005455 | Ga0070663_100329788 | Ga0070663_1003297881 | 315 |
| 185 | 3300005456 | Ga0070678_100054525 | Ga0070678_1000545253 | 315 |
| 186 | 3300005456 | Ga0070678_100193576 | Ga0070678_1001935762 | 315 |
| 187 | 3300005458 | Ga0070681_10044998 | Ga0070681_100449982 | 315 |
| 188 | 3300005458 | Ga0070681_10060331 | Ga0070681_100603313 | 315 |
| 189 | 3300005466 | Ga0070685_10120529 | Ga0070685_101205292 | 315 |
| 190 | 3300005471 | Ga0070698_100311443 | Ga0070698_1003114431 | 315 |
| 191 | 3300005530 | Ga0070679_100166533 | Ga0070679_1001665332 | 315 |
| 192 | 3300005535 | Ga0070684_100008609 | Ga0070684_1000086095 | 315 |
| 193 | 3300005535 | Ga0070684_100134255 | Ga0070684_1001342552 | 315 |
| 194 | 3300005543 | Ga0070672_100055714 | Ga0070672_1000557142 | 315 |
| 195 | 3300005543 | Ga0070672_100100938 | Ga0070672_1001009382 | 315 |
| 196 | 3300005544 | Ga0070686_100124414 | Ga0070686_1001244142 | 315 |
| 197 | 3300005548 | Ga0070665_100094054 | Ga0070665_1000940542 | 315 |
| 198 | 3300005563 | Ga0068855_100058819 | Ga0068855_1000588191 | 315 |
| 199 | 3300005563 | Ga0068855_100318993 | Ga0068855_1003189932 | 315 |
| 200 | 3300005616 | Ga0068852_100133026 | Ga0068852_1001330261 | 315 |
| 201 | 3300005617 | Ga0068859_100142923 | Ga0068859_1001429232 | 315 |
| 202 | 3300005617 | Ga0068859_100299379 | Ga0068859_1002993792 | 315 |
| 203 | 3300005718 | Ga0068866_10092684 | Ga0068866_100926841 | 315 |
| 204 | 3300005719 | Ga0068861_100388774 | Ga0068861_1003887741 | 315 |
| 205 | 3300005834 | Ga0068851_10156803 | Ga0068851_101568031 | 315 |
| 206 | 3300005842 | Ga0068858_100131853 | Ga0068858_1001318531 | 315 |
| 207 | 3300005842 | Ga0068858_100149708 | Ga0068858_1001497082 | 315 |
| 208 | 3300005842 | Ga0068858_100242242 | Ga0068858_1002422421 | 315 |
| 209 | 3300005842 | Ga0068858_100255051 | Ga0068858_1002550512 | 315 |
| 210 | 3300005844 | Ga0068862_100137380 | Ga0068862_1001373801 | 315 |
| 211 | 3300005844 | Ga0068862_100244330 | Ga0068862_1002443302 | 315 |
| 212 | 3300005844 | Ga0068862_100270199 | Ga0068862_1002701991 | 315 |
| 213 | 3300005937 | Ga0081455_10009565 | Ga0081455_100095657 | 315 |
| 214 | 3300005937 | Ga0081455_10029339 | Ga0081455_100293394 | 315 |
| 215 | 3300005937 | Ga0081455_10098580 | Ga0081455_100985802 | 315 |
| 216 | 3300005983 | Ga0081540_1008529 | Ga0081540_10085292 | 315 |
| 217 | 3300005983 | Ga0081540_1043625 | Ga0081540_10436252 | 315 |
| 218 | 3300005983 | Ga0081540_1048902 | Ga0081540_10489022 | 315 |
| 219 | 3300005983 | Ga0081540_1061582 | Ga0081540_10615822 | 315 |
| 220 | 3300006028 | Ga0070717_10024804 | Ga0070717_100248044 | 315 |
| 221 | 3300006038 | Ga0075365_10027308 | Ga0075365_100273082 | 315 |
| 222 | 3300006038 | Ga0075365_10326779 | Ga0075365_103267791 | 315 |
| 223 | 3300006051 | Ga0075364_10142413 | Ga0075364_101424131 | 315 |
| 224 | 3300006178 | Ga0075367_10074239 | Ga0075367_100742392 | 315 |
| 225 | 3300006186 | Ga0075369_10004356 | Ga0075369_100043564 | 315 |
| 226 | 3300006195 | Ga0075366_10153299 | Ga0075366_101532992 | 315 |
| 227 | 3300006237 | Ga0097621_100239366 | Ga0097621_1002393662 | 315 |
| 228 | 3300006844 | Ga0075428_100075420 | Ga0075428_1000754202 | 315 |
| 229 | 3300006881 | Ga0068865_100033411 | Ga0068865_1000334111 | 315 |
| 230 | 3300006881 | Ga0068865_100317964 | Ga0068865_1003179641 | 315 |
| 231 | 3300006931 | Ga0097620_100142927 | Ga0097620_1001429272 | 315 |
| 232 | 3300006931 | Ga0097620_100299394 | Ga0097620_1002993942 | 315 |
| 233 | 3300006941 | Ga0099825_1039555 | Ga0099825_10395552 | 315 |
| 234 | 3300006942 | Ga0099824_1022782 | Ga0099824_10227822 | 315 |
| 235 | 3300006943 | Ga0099822_1000191 | Ga0099822_10001912 | 315 |
| 236 | 3300007265 | Ga0099794_10037604 | Ga0099794_100376042 | 315 |
| 237 | 3300007788 | Ga0099795_10024414 | Ga0099795_100244142 | 315 |
| 238 | 3300007788 | Ga0099795_10033740 | Ga0099795_100337402 | 315 |
| 239 | 3300009093 | Ga0105240_10033191 | Ga0105240_100331915 | 315 |
| 240 | 3300009093 | Ga0105240_10045940 | Ga0105240_100459402 | 315 |
| 241 | 3300009098 | Ga0105245_10264772 | Ga0105245_102647722 | 315 |
| 242 | 3300009101 | Ga0105247_10149989 | Ga0105247_101499892 | 315 |
| 243 | 3300009147 | Ga0114129_10539134 | Ga0114129_105391342 | 315 |
| 244 | 3300009148 | Ga0105243_10154464 | Ga0105243_101544642 | 315 |
| 245 | 3300009176 | Ga0105242_10237294 | Ga0105242_102372942 | 315 |
| 246 | 3300009176 | Ga0105242_10302228 | Ga0105242_103022282 | 315 |
| 247 | 3300009545 | Ga0105237_10185795 | Ga0105237_101857952 | 315 |
| 248 | 3300009545 | Ga0105237_10293073 | Ga0105237_102930732 | 315 |
| 249 | 3300009551 | Ga0105238_10053408 | Ga0105238_100534083 | 315 |
| 250 | 3300009553 | Ga0105249_10058920 | Ga0105249_100589203 | 315 |
| 251 | 3300010375 | Ga0105239_10063442 | Ga0105239_100634422 | 315 |
| 252 | 3300010375 | Ga0105239_10084776 | Ga0105239_100847763 | 315 |
| 253 | 3300011119 | Ga0105246_10011436 | Ga0105246_100114364 | 315 |
| 254 | 3300011119 | Ga0105246_10079941 | Ga0105246_100799412 | 315 |
| 255 | 3300011119 | Ga0105246_10172349 | Ga0105246_101723491 | 315 |
| 256 | 3300013104 | Ga0157370_10059659 | Ga0157370_100596592 | 315 |
| 257 | 3300013104 | Ga0157370_10217308 | Ga0157370_102173082 | 315 |
| 258 | 3300013105 | Ga0157369_10004320 | Ga0157369_1000432012 | 315 |
| 259 | 3300013105 | Ga0157369_10047026 | Ga0157369_100470264 | 315 |
| 260 | 3300013296 | Ga0157374_10041150 | Ga0157374_100411504 | 315 |
| 261 | 3300013306 | Ga0163162_10091495 | Ga0163162_100914952 | 315 |
| 262 | 3300013306 | Ga0163162_10243381 | Ga0163162_102433812 | 315 |
| 263 | 3300013306 | Ga0163162_10303167 | Ga0163162_103031672 | 315 |
| 264 | 3300013307 | Ga0157372_10068595 | Ga0157372_100685953 | 315 |
| 265 | 3300013307 | Ga0157372_10108343 | Ga0157372_101083432 | 315 |
| 266 | 3300013308 | Ga0157375_10021897 | Ga0157375_100218973 | 315 |
| 267 | 3300013308 | Ga0157375_10032188 | Ga0157375_100321884 | 315 |
| 268 | 3300013308 | Ga0157375_10185864 | Ga0157375_101858642 | 315 |
| 269 | 3300014325 | Ga0163163_10005029 | Ga0163163_100050299 | 315 |
| 270 | 3300014325 | Ga0163163_10273801 | Ga0163163_102738012 | 315 |
| 271 | 3300014325 | Ga0163163_10516576 | Ga0163163_105165761 | 315 |
| 272 | 3300014326 | Ga0157380_10273041 | Ga0157380_102730411 | 315 |
| 273 | 3300014968 | Ga0157379_10094307 | Ga0157379_100943072 | 315 |
| 274 | 3300014969 | Ga0157376_10086467 | Ga0157376_100864672 | 315 |
| 275 | 3300017792 | Ga0163161_10140385 | Ga0163161_101403852 | 315 |
| 276 | 3300021377 | Ga0213874_10018972 | Ga0213874_100189723 | 315 |
| 277 | 3300021384 | Ga0213876_10006031 | Ga0213876_100060314 | 315 |
| 278 | 3300021384 | Ga0213876_10062484 | Ga0213876_100624843 | 315 |
| 279 | 3300021388 | Ga0213875_10058191 | Ga0213875_100581912 | 315 |
| 280 | 3300025297 | Ga0209758_1015431 | Ga0209758_10154312 | 315 |
| 281 | 3300025297 | Ga0209758_1020677 | Ga0209758_10206772 | 315 |
| 282 | 3300025898 | Ga0207692_10000547 | Ga0207692_100005475 | 315 |
| 283 | 3300025906 | Ga0207699_10000386 | Ga0207699_100003867 | 315 |
| 284 | 3300025907 | Ga0207645_10077204 | Ga0207645_100772042 | 315 |
| 285 | 3300025912 | Ga0207707_10000816 | Ga0207707_1000081629 | 315 |
| 286 | 3300025913 | Ga0207695_10006231 | Ga0207695_1000623110 | 315 |
| 287 | 3300025914 | Ga0207671_10187330 | Ga0207671_101873302 | 315 |
| 288 | 3300025917 | Ga0207660_10160335 | Ga0207660_101603352 | 315 |
| 289 | 3300025918 | Ga0207662_10066293 | Ga0207662_100662932 | 315 |
| 290 | 3300025919 | Ga0207657_10076677 | Ga0207657_100766771 | 315 |
| 291 | 3300025921 | Ga0207652_10060900 | Ga0207652_100609003 | 315 |
| 292 | 3300025921 | Ga0207652_10262764 | Ga0207652_102627642 | 315 |
| 293 | 3300025935 | Ga0207709_10052935 | Ga0207709_100529352 | 315 |
| 294 | 3300025938 | Ga0207704_10158833 | Ga0207704_101588332 | 315 |
| 295 | 3300025939 | Ga0207665_10001425 | Ga0207665_1000142511 | 315 |
| 296 | 3300025940 | Ga0207691_10043846 | Ga0207691_100438462 | 315 |
| 297 | 3300025940 | Ga0207691_10056812 | Ga0207691_100568121 | 315 |
| 298 | 3300025942 | Ga0207689_10232134 | Ga0207689_102321341 | 315 |
| 299 | 3300025944 | Ga0207661_10015027 | Ga0207661_100150274 | 315 |
| 300 | 3300025944 | Ga0207661_10241050 | Ga0207661_102410502 | 315 |
| 301 | 3300025945 | Ga0207679_10384057 | Ga0207679_103840572 | 315 |
| 302 | 3300025949 | Ga0207667_10054494 | Ga0207667_100544944 | 315 |
| 303 | 3300025949 | Ga0207667_10506228 | Ga0207667_105062281 | 315 |
| 304 | 3300025972 | Ga0207668_10017444 | Ga0207668_100174444 | 315 |
| 305 | 3300025972 | Ga0207668_10211583 | Ga0207668_102115831 | 315 |
| 306 | 3300025972 | Ga0207668_10356067 | Ga0207668_103560671 | 315 |
| 307 | 3300026023 | Ga0207677_10083188 | Ga0207677_100831881 | 315 |
| 308 | 3300026041 | Ga0207639_10058388 | Ga0207639_100583882 | 315 |
| 309 | 3300026041 | Ga0207639_10111932 | Ga0207639_101119322 | 315 |
| 310 | 3300026067 | Ga0207678_10027066 | Ga0207678_100270663 | 315 |
| 311 | 3300026067 | Ga0207678_10194728 | Ga0207678_101947281 | 315 |
| 312 | 3300026075 | Ga0207708_10346341 | Ga0207708_103463412 | 315 |
| 313 | 3300026078 | Ga0207702_10043472 | Ga0207702_100434723 | 315 |
| 314 | 3300026118 | Ga0207675_100125592 | Ga0207675_1001255922 | 315 |
| 315 | 3300026118 | Ga0207675_100289114 | Ga0207675_1002891141 | 315 |
| 316 | 3300026121 | Ga0207683_10028790 | Ga0207683_100287904 | 315 |
| 317 | 3300026121 | Ga0207683_10037875 | Ga0207683_100378753 | 315 |
| 318 | 3300026121 | Ga0207683_10107730 | Ga0207683_101077302 | 315 |
| 319 | 3300026121 | Ga0207683_10163379 | Ga0207683_101633792 | 315 |
| 320 | 3300026142 | Ga0207698_10280814 | Ga0207698_102808141 | 315 |
| 321 | 3300027357 | Ga0209589_1000055 | Ga0209589_10000552 | 315 |
| 322 | 3300027361 | Ga0209489_100128 | Ga0209489_1001282 | 315 |
| 323 | 3300027363 | Ga0209700_100137 | Ga0209700_1001372 | 315 |
| 324 | 3300027512 | Ga0209179_1005696 | Ga0209179_10056962 | 315 |
| 325 | 3300027512 | Ga0209179_1009592 | Ga0209179_10095922 | 315 |
| 326 | 3300027671 | Ga0209588_1028322 | Ga0209588_10283222 | 315 |
| 327 | 3300028379 | Ga0268266_10179348 | Ga0268266_101793481 | 315 |
| 328 | 3300028380 | Ga0268265_10105795 | Ga0268265_101057951 | 315 |
| 329 | 3300028380 | Ga0268265_10199029 | Ga0268265_101990292 | 315 |
| 330 | 3300028380 | Ga0268265_10300959 | Ga0268265_103009592 | 315 |
| 331 | 3300028556 | Ga0265337_1013180 | Ga0265337_10131801 | 315 |
| 332 | 3300028563 | Ga0265319_1013300 | Ga0265319_10133003 | 315 |
| 333 | 3300028573 | Ga0265334_10001581 | Ga0265334_1000158111 | 315 |
| 334 | 3300028577 | Ga0265318_10019887 | Ga0265318_100198872 | 315 |
| 335 | 3300028666 | Ga0265336_10001044 | Ga0265336_100010441 | 315 |
| 336 | 3300028800 | Ga0265338_10000024 | Ga0265338_10000024116 | 315 |
| 337 | 3300029957 | Ga0265324_10003580 | Ga0265324_100035802 | 315 |
| 338 | 3300031238 | Ga0265332_10042052 | Ga0265332_100420522 | 315 |
| 339 | 3300031239 | Ga0265328_10034325 | Ga0265328_100343252 | 315 |
| 340 | 3300031241 | Ga0265325_10025938 | Ga0265325_100259382 | 315 |
| 341 | 3300031249 | Ga0265339_10072118 | Ga0265339_100721181 | 315 |
| 342 | 3300031250 | Ga0265331_10041322 | Ga0265331_100413222 | 315 |
| 343 | 3300031507 | Ga0307509_10305253 | Ga0307509_103052531 | 315 |
| 344 | 3300031595 | Ga0265313_10040983 | Ga0265313_100409832 | 315 |
| 345 | 3300031616 | Ga0307508_10039969 | Ga0307508_100399692 | 315 |
| 346 | 3300031730 | Ga0307516_10096712 | Ga0307516_100967122 | 315 |
| 347 | 3300031995 | Ga0307409_100094838 | Ga0307409_1000948382 | 315 |
| 348 | 3300031995 | Ga0307409_100305476 | Ga0307409_1003054762 | 315 |
| 349 | 3300032002 | Ga0307416_100193344 | Ga0307416_1001933442 | 315 |
| 350 | 3300032002 | Ga0307416_100432717 | Ga0307416_1004327171 | 315 |
| 351 | 3300032005 | Ga0307411_10318663 | Ga0307411_103186631 | 315 |
| 352 | 3300032126 | Ga0307415_100239642 | Ga0307415_1002396422 | 315 |
| 353 | 3300033442 | Ga0315911_1000024 | Ga0315911_100002446 | 315 |
| 354 | 3300035086 | Ga0373934_0001199 | Ga0373934_0001199_5910_6860 | 315 |
| 355 | 3300035111 | Ga0373923_0000022 | Ga0373923_0000022_7114_8064 | 315 |
| 356 | 3300035113 | Ga0373936_0016695 | Ga0373936_0016695_862_1812 | 315 |
| 357 | 3300035116 | Ga0373945_0035171 | Ga0373945_0035171_582_1532 | 315 |
| 358 | 3300035117 | Ga0373953_0000468 | Ga0373953_0000468_6279_7229 | 315 |
| 359 | 3300035118 | Ga0373954_0000519 | Ga0373954_0000519_4391_5341 | 315 |
| 360 | 3300035118 | Ga0373954_0134691 | Ga0373954_0134691_39_992 | 315 |
| 361 | 3300035119 | Ga0373956_0002504 | Ga0373956_0002504_101_1051 | 315 |
| 362 | 3300035119 | Ga0373956_0111959 | Ga0373956_0111959_200_1153 | 315 |
| 363 | 3300035120 | Ga0373957_0000581 | Ga0373957_0000581_1852_2802 | 315 |
| 364 | 3300035170 | Ga0373943_0001466 | Ga0373943_0001466_1151_2101 | 315 |
| 365 | 3300035171 | Ga0373946_0025124 | Ga0373946_0025124_1178_2128 | 315 |
| 366 | 3300035172 | Ga0373955_0000402 | Ga0373955_0000402_9958_10908 | 315 |
| 367 | 3300035410 | Ga0373924_0003157 | Ga0373924_0003157_1840_2790 | 315 |
| 368 | 3300035410 | Ga0373924_0006169 | Ga0373924_0006169_1428_2378 | 315 |
| 369 | 3300035692 | Ga0373935_0000244 | Ga0373935_0000244_19312_20262 | 315 |
| 370 | 3300035692 | Ga0373935_0081433 | Ga0373935_0081433_10_963 | 315 |
| 371 | 3300035695 | Ga0373927_0025022 | Ga0373927_0025022_2063_3016 | 315 |
| 372 | 3300035695 | Ga0373927_0097055 | Ga0373927_0097055_32_985 | 315 |
| 373 | 3300035724 | Ga0373933_0000114 | Ga0373933_0000114_44483_45433 | 315 |
| 374 | 3300035724 | Ga0373933_0000374 | Ga0373933_0000374_15507_16457 | 315 |
| 375 | 3300035724 | Ga0373933_0098258 | Ga0373933_0098258_696_1646 | 315 |
| 376 | 3300035725 | Ga0373947_0004892 | Ga0373947_0004892_1041_1991 | 315 |
| 377 | 3300036401 | Ga0373937_0003416 | Ga0373937_0003416_3857_4807 | 315 |
| 378 | 3300037068 | Ga0373925_0012695 | Ga0373925_0012695_782_1732 | 315 |
| 379 | 3300037418 | Ga0395900_0026692 | Ga0395900_0026692_2415_3365 | 315 |
| 380 | 3300037466 | Ga0395898_0004631 | Ga0395898_0004631_11848_12798 | 315 |
| 381 | 3300037853 | Ga0436364_0777503 | Ga0436364_0777503_1400_2395 | 315 |
| 382 | 3300038443 | Ga0395901_0059735 | Ga0395901_0059735_493_1443 | 315 |
| 383 | 3300039437 | Ga0436365_1115617 | Ga0436365_1115617_928_1878 | 315 |
| 384 | 3300039437 | Ga0436365_1293604 | Ga0436365_1293604_545_1498 | 315 |
| 385 | 3300039450 | Ga0436363_1082211 | Ga0436363_1082211_202_1155 | 315 |
| 386 | 3300039453 | Ga0436362_0749727 | Ga0436362_0749727_564_1514 | 315 |
| 387 | 3300046454 | Ga0495592_0002074 | Ga0495592_0002074_5079_6029 | 315 |
| 388 | 3300046454 | Ga0495592_0142504 | Ga0495592_0142504_695_1645 | 315 |
| 389 | 3300046455 | Ga0495603_0000370 | Ga0495603_0000370_14388_15338 | 315 |
| 390 | 3300046457 | Ga0495590_0047989 | Ga0495590_0047989_245_1198 | 315 |
| 391 | 3300046459 | Ga0495629_0000081 | Ga0495629_0000081_10701_11651 | 315 |
| 392 | 3300046459 | Ga0495629_0000380 | Ga0495629_0000380_23206_24156 | 315 |
| 393 | 3300046459 | Ga0495629_0210465 | Ga0495629_0210465_313_1281 | 315 |
| 394 | 3300046460 | Ga0495638_0164057 | Ga0495638_0164057_286_1239 | 315 |
| 395 | 3300046461 | Ga0495641_0010022 | Ga0495641_0010022_4240_5190 | 315 |
| 396 | 3300046462 | Ga0495651_0014993 | Ga0495651_0014993_265_1215 | 315 |
| 397 | 3300046472 | Ga0495580_0003868 | Ga0495580_0003868_10153_11103 | 315 |
| 398 | 3300046473 | Ga0495582_0000051 | Ga0495582_0000051_34150_35100 | 315 |
| 399 | 3300046474 | Ga0495605_0047519 | Ga0495605_0047519_356_1309 | 315 |
| 400 | 3300046475 | Ga0495639_0000010 | Ga0495639_0000010_65337_66287 | 315 |
| 401 | 3300046475 | Ga0495639_0031626 | Ga0495639_0031626_60_1013 | 315 |
| 402 | 3300046477 | Ga0495664_0009894 | Ga0495664_0009894_3199_4149 | 315 |
| 403 | 3300046477 | Ga0495664_0093780 | Ga0495664_0093780_708_1661 | 315 |
| 404 | 3300046491 | Ga0495584_0067523 | Ga0495584_0067523_117_1070 | 315 |
| 405 | 3300046491 | Ga0495584_0107481 | Ga0495584_0107481_22_978 | 315 |
| 406 | 3300046491 | Ga0495584_0116425 | Ga0495584_0116425_175_1128 | 315 |
| 407 | 3300046491 | Ga0495584_0167027 | Ga0495584_0167027_10_963 | 315 |
| 408 | 3300046492 | Ga0495585_0028557 | Ga0495585_0028557_2009_2962 | 315 |
| 409 | 3300046499 | Ga0495594_0001074 | Ga0495594_0001074_9056_10006 | 315 |
| 410 | 3300046499 | Ga0495594_0045416 | Ga0495594_0045416_261_1214 | 315 |
| 411 | 3300046499 | Ga0495594_0156642 | Ga0495594_0156642_295_1251 | 315 |
| 412 | 3300046511 | Ga0495608_0008172 | Ga0495608_0008172_1448_2398 | 315 |
| 413 | 3300046513 | Ga0495616_0057832 | Ga0495616_0057832_517_1470 | 315 |
| 414 | 3300046516 | Ga0495628_0006360 | Ga0495628_0006360_1410_2360 | 315 |
| 415 | 3300046516 | Ga0495628_0073947 | Ga0495628_0073947_830_1780 | 315 |
| 416 | 3300046517 | Ga0495630_0005257 | Ga0495630_0005257_1033_1983 | 315 |
| 417 | 3300046518 | Ga0495631_0139210 | Ga0495631_0139210_35_988 | 315 |
| 418 | 3300046523 | Ga0495644_0059195 | Ga0495644_0059195_373_1326 | 315 |
| 419 | 3300046525 | Ga0495663_0018464 | Ga0495663_0018464_560_1513 | 315 |
| 420 | 3300046529 | Ga0495652_0007397 | Ga0495652_0007397_652_1602 | 315 |
| 421 | 3300046531 | Ga0495665_0000005 | Ga0495665_0000005_52464_53414 | 315 |
| 422 | 3300046533 | Ga0495640_0000301 | Ga0495640_0000301_28927_29877 | 315 |
| 423 | 3300046533 | Ga0495640_0029278 | Ga0495640_0029278_1003_1953 | 315 |
| 424 | 3300046535 | Ga0495586_0074156 | Ga0495586_0074156_229_1179 | 315 |
| 425 | 3300046536 | Ga0495587_0002764 | Ga0495587_0002764_9315_10265 | 315 |
| 426 | 3300046537 | Ga0495598_0001714 | Ga0495598_0001714_1269_2222 | 315 |
| 427 | 3300046537 | Ga0495598_0014228 | Ga0495598_0014228_111_1064 | 315 |
| 428 | 3300046543 | Ga0495645_0011053 | Ga0495645_0011053_1002_1952 | 315 |
| 429 | 3300046557 | Ga0495622_0001809 | Ga0495622_0001809_8610_9560 | 315 |
| 430 | 3300046557 | Ga0495622_0051134 | Ga0495622_0051134_500_1453 | 315 |
| 431 | 3300046558 | Ga0495633_0028798 | Ga0495633_0028798_289_1242 | 315 |
| 432 | 3300046558 | Ga0495633_0091097 | Ga0495633_0091097_167_1120 | 315 |
| 433 | 3300046559 | Ga0495667_0002956 | Ga0495667_0002956_3857_4807 | 315 |
| 434 | 3300046615 | Ga0495656_0004197 | Ga0495656_0004197_1506_2459 | 315 |
| 435 | 3300046615 | Ga0495656_0010666 | Ga0495656_0010666_2175_3128 | 315 |
| 436 | 3300046616 | Ga0495668_0089959 | Ga0495668_0089959_624_1577 | 315 |
| 437 | 3300046616 | Ga0495668_0100025 | Ga0495668_0100025_356_1309 | 315 |
| 438 | 3300046642 | Ga0495634_0000764 | Ga0495634_0000764_10919_11869 | 315 |
| 439 | 3300046642 | Ga0495634_0010702 | Ga0495634_0010702_4905_5855 | 315 |
| 440 | 3300046648 | Ga0495611_0046609 | Ga0495611_0046609_807_1760 | 315 |
| 441 | 3300046648 | Ga0495611_0132196 | Ga0495611_0132196_22_975 | 315 |
| 442 | 3300046660 | Ga0495625_0062924 | Ga0495625_0062924_262_1215 | 315 |
| 443 | 3300046660 | Ga0495625_0100848 | Ga0495625_0100848_936_1892 | 315 |
| 444 | 3300046663 | Ga0495635_0000213 | Ga0495635_0000213_9509_10459 | 315 |
| 445 | 3300046663 | Ga0495635_0011036 | Ga0495635_0011036_232_1182 | 315 |
| 446 | 3300046664 | Ga0495659_0001624 | Ga0495659_0001624_2188_3141 | 315 |
| 447 | 3300046664 | Ga0495659_0002657 | Ga0495659_0002657_1695_2648 | 315 |
| 448 | 3300046674 | Ga0495588_0008118 | Ga0495588_0008118_153_1106 | 315 |
| 449 | 3300046674 | Ga0495588_0016706 | Ga0495588_0016706_1864_2814 | 315 |
| 450 | 3300046674 | Ga0495588_0079805 | Ga0495588_0079805_319_1275 | 315 |
| 451 | 3300046675 | Ga0495657_0015790 | Ga0495657_0015790_1448_2398 | 315 |
| 452 | 3300046678 | Ga0495599_0043648 | Ga0495599_0043648_1651_2601 | 315 |
| 453 | 3300046678 | Ga0495599_0059778 | Ga0495599_0059778_328_1281 | 315 |
| 454 | 3300046680 | Ga0495646_0009214 | Ga0495646_0009214_189_1139 | 315 |
| 455 | 3300046680 | Ga0495646_0017126 | Ga0495646_0017126_706_1656 | 315 |
| 456 | 3300046681 | Ga0495647_0019117 | Ga0495647_0019117_633_1583 | 315 |
| 457 | 3300046681 | Ga0495647_0021128 | Ga0495647_0021128_827_1780 | 315 |
| 458 | 3300046683 | Ga0495658_0011732 | Ga0495658_0011732_2892_3842 | 315 |
| 459 | 3300046684 | Ga0495669_0025017 | Ga0495669_0025017_1628_2584 | 315 |
| 460 | 3300046684 | Ga0495669_0069057 | Ga0495669_0069057_559_1512 | 315 |
| 461 | 3300046689 | Ga0495613_0007909 | Ga0495613_0007909_1003_1953 | 315 |
| 462 | 3300046690 | Ga0495624_0000094 | Ga0495624_0000094_30094_31044 | 315 |
| 463 | 3300046794 | Ga0495589_0087310 | Ga0495589_0087310_148_1104 | 315 |
| 464 | 3300046794 | Ga0495589_0099858 | Ga0495589_0099858_92_1045 | 315 |
| 465 | 3300046809 | Ga0495600_0001029 | Ga0495600_0001029_7152_8102 | 315 |
| 466 | 3300047315 | Ga0495581_0001146 | Ga0495581_0001146_4483_5433 | 315 |
| 467 | 3300047315 | Ga0495581_0227254 | Ga0495581_0227254_79_1029 | 315 |
| 468 | 3300047317 | Ga0495604_0005951 | Ga0495604_0005951_1576_2526 | 315 |
| 469 | 3300047317 | Ga0495604_0181886 | Ga0495604_0181886_61_1014 | 315 |
| 470 | 3300047318 | Ga0495636_0034558 | Ga0495636_0034558_670_1623 | 315 |
| 471 | 3300047319 | Ga0495674_0000134 | Ga0495674_0000134_54099_55049 | 315 |
| 472 | 3300047319 | Ga0495674_0013244 | Ga0495674_0013244_6276_7226 | 315 |
| 473 | 3300047320 | Ga0495672_0016185 | Ga0495672_0016185_503_1456 | 315 |
| 474 | 3300047320 | Ga0495672_0099378 | Ga0495672_0099378_517_1470 | 315 |
| 475 | 3300047321 | Ga0495676_0111796 | Ga0495676_0111796_997_1950 | 315 |
| 476 | 3300047322 | Ga0495680_0002637 | Ga0495680_0002637_4775_5725 | 315 |
| 477 | 3300047323 | Ga0495683_0086940 | Ga0495683_0086940_173_1126 | 315 |
| 478 | 3300047444 | Ga0495675_0000756 | Ga0495675_0000756_9325_10275 | 315 |
| 479 | 3300047445 | Ga0495677_0052584 | Ga0495677_0052584_380_1333 | 315 |
| 480 | 3300047471 | Ga0495684_0000052 | Ga0495684_0000052_53364_54314 | 315 |
| 481 | 3300047471 | Ga0495684_0007719 | Ga0495684_0007719_6008_6958 | 315 |
| 482 | 3300047673 | Ga0495593_0000084 | Ga0495593_0000084_10829_11779 | 315 |
| 483 | 3300047673 | Ga0495593_0000518 | Ga0495593_0000518_6371_7321 | 315 |
| 484 | 3300048089 | Ga0495614_0056293 | Ga0495614_0056293_540_1490 | 315 |
| 485 | 3300048090 | Ga0495615_0013052 | Ga0495615_0013052_373_1326 | 315 |
| 486 | 3300048903 | Ga0496100_0013812 | Ga0496100_0013812_388_1341 | 315 |
| 487 | 3300048905 | Ga0496102_0005804 | Ga0496102_0005804_4287_5240 | 315 |
| 488 | 3300048906 | Ga0496103_0023140 | Ga0496103_0023140_520_1473 | 315 |
| 489 | 3300048907 | Ga0496104_0039927 | Ga0496104_0039927_3121_4074 | 315 |
| 490 | 3300048909 | Ga0496106_0247514 | Ga0496106_0247514_158_1114 | 315 |
| 491 | 3300048909 | Ga0496106_0347380 | Ga0496106_0347380_173_1126 | 315 |
| 492 | 3300048910 | Ga0496107_0016390 | Ga0496107_0016390_196_1149 | 315 |
| 493 | 3300048911 | Ga0496108_0012856 | Ga0496108_0012856_4636_5589 | 315 |
| 494 | 3300048912 | Ga0496109_0016364 | Ga0496109_0016364_3088_4041 | 315 |
| 495 | 3300048913 | Ga0496110_0100507 | Ga0496110_0100507_1217_2170 | 315 |
| 496 | 3300048914 | Ga0496111_0025250 | Ga0496111_0025250_476_1429 | 315 |
| 497 | 3300048915 | Ga0496112_0069765 | Ga0496112_0069765_2442_3395 | 315 |
| 498 | 3300048915 | Ga0496112_0413543 | Ga0496112_0413543_257_1207 | 315 |
| 499 | 3300048916 | Ga0496113_0020850 | Ga0496113_0020850_2734_3684 | 315 |
| 500 | 3300048917 | Ga0496114_0016833 | Ga0496114_0016833_3959_4912 | 315 |
| 501 | 3300048917 | Ga0496114_0178261 | Ga0496114_0178261_61_1017 | 315 |
| 502 | 3300048918 | Ga0496115_0001776 | Ga0496115_0001776_11506_12459 | 315 |
| 503 | 3300048918 | Ga0496115_0391744 | Ga0496115_0391744_28_978 | 315 |
| 504 | 3300048921 | Ga0496118_0124129 | Ga0496118_0124129_220_1218 | 315 |
| 505 | 3300048924 | Ga0496121_0002340 | Ga0496121_0002340_12777_13730 | 315 |
| 506 | 3300048924 | Ga0496121_0060700 | Ga0496121_0060700_502_1494 | 315 |
| 507 | 3300048924 | Ga0496121_0230402 | Ga0496121_0230402_317_1270 | 315 |
| 508 | 3300048924 | Ga0496121_0248698 | Ga0496121_0248698_139_1101 | 315 |
| 509 | 3300048927 | Ga0496124_0223048 | Ga0496124_0223048_183_1139 | 315 |
| 510 | 3300048928 | Ga0496125_0157408 | Ga0496125_0157408_520_1470 | 315 |
| 511 | 3300048929 | Ga0496126_0199212 | Ga0496126_0199212_640_1590 | 315 |
| 512 | 3300049581 | Ga0501047_0046968 | Ga0501047_0046968_2898_3860 | 315 |
| 513 | 3300049583 | Ga0501067_0066626 | Ga0501067_0066626_19_972 | 315 |
| 514 | 3300049586 | Ga0501070_0064188 | Ga0501070_0064188_1900_2862 | 315 |
| 515 | 3300050492 | nmdc:mga0yw44_246584_c1 | nmdc:mga0yw44_246584_c1_29_1039 | 315 |
| 516 | 3300050492 | nmdc:mga0yw44_77243_c1 | nmdc:mga0yw44_77243_c1_1116_2069 | 315 |
| 517 | 3300050493 | nmdc:mga0k408_196813_c1 | nmdc:mga0k408_196813_c1_188_1156 | 315 |
| 518 | 3300050516 | nmdc:mga0sz30_13283_c1 | nmdc:mga0sz30_13283_c1_1925_2893 | 315 |
| 519 | 3300053077 | Ga0495601_0032539 | Ga0495601_0032539_1945_2895 | 315 |
| 520 | 3300053077 | Ga0495601_0215782 | Ga0495601_0215782_242_1195 | 315 |
| 521 | 3300053078 | Ga0495612_0147994 | Ga0495612_0147994_11_961 | 315 |
| 522 | 3300053080 | Ga0500635_0013807 | Ga0500635_0013807_672_1622 | 315 |
| 523 | 3300053080 | Ga0500635_0018312 | Ga0500635_0018312_201_1154 | 315 |
| 524 | 3300053084 | Ga0495595_0000279 | Ga0495595_0000279_6172_7122 | 315 |
| 525 | 3300053085 | Ga0495619_0091211 | Ga0495619_0091211_329_1279 | 315 |
| 526 | 3300053086 | Ga0500578_0140548 | Ga0500578_0140548_41_988 | 315 |
| 527 | 3300053093 | Ga0500651_0001238 | Ga0500651_0001238_3206_4153 | 315 |
| 528 | 3300053094 | Ga0500566_0000762 | Ga0500566_0000762_10857_11810 | 315 |
| 529 | 3300053095 | Ga0500640_104185 | Ga0500640_104185_60_1013 | 315 |
| 530 | 3300053096 | Ga0500641_0032707 | Ga0500641_0032707_443_1399 | 315 |
| 531 | 3300053102 | Ga0500554_002407 | Ga0500554_002407_2095_3045 | 315 |
| 532 | 3300053102 | Ga0500554_006683 | Ga0500554_006683_165_1115 | 315 |
| 533 | 3300053108 | Ga0500562_029053 | Ga0500562_029053_377_1330 | 315 |
| 534 | 3300053119 | Ga0500595_002625 | Ga0500595_002625_6831_7781 | 315 |
| 535 | 3300053119 | Ga0500595_028833 | Ga0500595_028833_864_1817 | 315 |
| 536 | 3300053119 | Ga0500595_039188 | Ga0500595_039188_351_1304 | 315 |
| 537 | 3300053123 | Ga0500614_044558 | Ga0500614_044558_49_1002 | 315 |
| 538 | 3300053130 | Ga0500642_0001930 | Ga0500642_0001930_3926_4873 | 315 |
| 539 | 3300053137 | Ga0500561_0051472 | Ga0500561_0051472_63_1016 | 315 |
| 540 | 3300053139 | Ga0500568_0080002 | Ga0500568_0080002_270_1223 | 315 |
| 541 | 3300053139 | Ga0500568_0095530 | Ga0500568_0095530_27_980 | 315 |
| 542 | 3300053150 | Ga0500603_007126 | Ga0500603_007126_635_1585 | 315 |
| 543 | 3300053156 | Ga0500622_0035703 | Ga0500622_0035703_112_1059 | 315 |
| 544 | 3300053159 | Ga0500630_055180 | Ga0500630_055180_350_1303 | 315 |
| 545 | 3300053161 | Ga0500634_0131051 | Ga0500634_0131051_37_990 | 315 |
| 546 | 3300053162 | Ga0500638_017623 | Ga0500638_017623_1240_2190 | 315 |
| 547 | 3300053163 | Ga0500639_002046 | Ga0500639_002046_61_1014 | 315 |
| 548 | 3300053178 | Ga0500637_0000155 | Ga0500637_0000155_196_1146 | 315 |
| 549 | 3300053178 | Ga0500637_0000757 | Ga0500637_0000757_5930_6880 | 315 |
| 550 | 3300053178 | Ga0500637_0078433 | Ga0500637_0078433_71_1024 | 315 |
| 551 | 3300053735 | Ga0500596_001525 | Ga0500596_001525_3216_4169 | 315 |
| 552 | 3300055283 | Ga0500661_000885 | Ga0500661_000885_3815_4765 | 315 |
| 553 | iso_pu_bacteria | 2906635258 | 2906641159 | 315 |
| 554 | iso_pu_bacteria | 2906660503 | 2906665715 | 315 |
| 555 | iso_pu_bacteria | 3005474847 | 3005483203 | 315 |
| 556 | iso_pu_bacteria | 8006964411 | 8006968343 | 315 |
| 557 | iso_pu_bacteria | 8056681323 | 8056688434 | 315 |
| 558 | 3300003203 | JGI25406J46586_10005160 | JGI25406J46586_100051604 | 316 |
| 559 | 3300005937 | Ga0081455_10012089 | Ga0081455_100120895 | 316 |
| 560 | 3300005983 | Ga0081540_1035801 | Ga0081540_10358012 | 316 |
| 561 | 3300005985 | Ga0081539_10000466 | Ga0081539_1000046621 | 316 |
| 562 | 3300005985 | Ga0081539_10026236 | Ga0081539_100262363 | 316 |
| 563 | 3300026121 | Ga0207683_10101869 | Ga0207683_101018692 | 316 |
| 564 | 3300031507 | Ga0307509_10237597 | Ga0307509_102375971 | 316 |
| 565 | 3300031507 | Ga0307509_10402687 | Ga0307509_104026871 | 316 |
| 566 | 3300033179 | Ga0307507_10094791 | Ga0307507_100947911 | 316 |
| 567 | 3300046455 | Ga0495603_0025895 | Ga0495603_0025895_2060_3028 | 316 |
| 568 | 3300046512 | Ga0495610_0022155 | Ga0495610_0022155_1558_2517 | 316 |
| 569 | 3300046518 | Ga0495631_0084020 | Ga0495631_0084020_279_1247 | 316 |
| 570 | 3300046522 | Ga0495643_0010324 | Ga0495643_0010324_2539_3498 | 316 |
| 571 | 3300046683 | Ga0495658_0149931 | Ga0495658_0149931_299_1261 | 316 |
| 572 | 3300046810 | Ga0495660_0041199 | Ga0495660_0041199_935_1894 | 316 |
| 573 | 3300048910 | Ga0496107_0208845 | Ga0496107_0208845_457_1413 | 316 |
| 574 | 3300048920 | Ga0496117_0010024 | Ga0496117_0010024_6784_7755 | 316 |
| 575 | 3300048921 | Ga0496118_0012015 | Ga0496118_0012015_4416_5387 | 316 |
| 576 | 3300048924 | Ga0496121_0004993 | Ga0496121_0004993_12109_13080 | 316 |
| 577 | 3300048924 | Ga0496121_0101832 | Ga0496121_0101832_86_1042 | 316 |
| 578 | 3300048929 | Ga0496126_0284739 | Ga0496126_0284739_195_1166 | 316 |
| 579 | 3300053080 | Ga0500635_0024833 | Ga0500635_0024833_87_1049 | 316 |
| 580 | 3300053119 | Ga0500595_000199 | Ga0500595_000199_14417_15400 | 316 |
| 581 | 3300053119 | Ga0500595_009809 | Ga0500595_009809_2643_3659 | 316 |
| 582 | 3300053148 | Ga0500590_014489 | Ga0500590_014489_574_1527 | 316 |
| 583 | 3300053177 | Ga0500636_0095356 | Ga0500636_0095356_14_973 | 316 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6iy9-assembly2.cif.gz_B | "crystal structure of aminoglycoside 7""-phoshotransferase-ia (aph(7"")-ia/hyg) from streptomyces hygroscopicus complexed with hygromycin b" | 0.8056 | 6 | 313 |
| 6iy9-assembly2.cif.gz_B | "crystal structure of aminoglycoside 7""-phoshotransferase-ia (aph(7"")-ia/hyg) from streptomyces hygroscopicus complexed with hygromycin b" | 0.7846 | 6 | 313 |
| 6ctz-assembly1.cif.gz_A | "structure of the gdp and kanamycin complex of aph(2"")-iiia" | 0.7571 | 22 | 282 |
| 4ork-assembly4.cif.gz_D | crystal structure of the phosphotransferase domain of the bifunctional aminoglycoside resistance enzyme aac(6')-ie-aph(2'')-ia | 0.7489 | 23 | 282 |
| 5iqb-assembly1.cif.gz_A | aminoglycoside phosphotransferase (2'')-ia (ctd of aac(6')-ie/aph(2'')-ia) in complex with gmppnp, magnesium, and kanamycin a | 0.7464 | 23 | 282 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5RI03_13_83_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.7987 | 57 | 105 | 3.30.200.20 |
| af_A0A1D6H649_61_130_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.7405 | 57 | 108 | 3.30.200.20 |
| af_A0A1D6ERY2_751_840_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.74 | 42 | 107 | 3.30.200.20 |
| af_Q9FHG4_349_441_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.734 | 57 | 105 | 3.30.200.20 |
| af_A0A0N7KJP7_1_60_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.7326 | 57 | 108 | 3.30.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q5RY61-F1-model_v4 | Phosphotransferase | 0.9957 | 2 | 314 |
GO:0016301
|
| AF-A0A5P6P4M9-F1-model_v4 | Phosphotransferase | 0.9941 | 1 | 314 |
GO:0016301
|
| AF-A0A4U6RVR8-F1-model_v4 | Phosphotransferase | 0.9907 | 1 | 314 |
GO:0016301
|
| AF-A0A0E4BP05-F1-model_v4 | Putative phosphotransferase | 0.9906 | 86 | 314 |
GO:0016301
|
| AF-A4Z2P8-F1-model_v4 | Aminoglycoside phosphotransferase domain-containing protein | 0.9888 | 41 | 314 |
GO:0016301
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar