F466276

General Info

Members Datasets Scaffolds Average Seq Length
583 282 1166 263

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10297849|Ga0207646_102978491
Length 302
Sequence MAIPPCGSGGPSPHEFPFLTTLRREAHIGPYHGHPMEAAFFDLDKTIISRSSSLALSRPLYRAGMVSRGQLLRGAYAQLVYLLVGADEQKMERLKEGMLQLTKGWDRDQVERLVQDTILDVIDPYVYQEALDLIALHRSEGRQIYVVSSSPEEVVRPLARHFGTAGVIATRAEVGEDGRYTGTLEFYAYGPQKADAIRELADRVGLDLAGSYAYSDSITDVPMLEVVGHPVAVNADKELRKIAEERGWERRDFRSPVRLRTRIASAVPAPRPSYIAGAFGVVAVVAVLGWVALRSRGRRVRD

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
128 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
129 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
130 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
135 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
139 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
157 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
165 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
166 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
167 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
168 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
188 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
193 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
208 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
215 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
274 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
275 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0
Rhizoplane 6.52
Rhizosphere 91.77
Stem 0
Stem Tuber 0
Unclassified 3.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10297849 3300025922 Bacteria 1457
2 JGI24752J21851_1004800 3300001976 Bacteria 1768
3 JGI24747J21853_1003907 3300001978 Bacteria 1309
4 JGI24751J29686_10000343 3300002459 Bacteria 16725
5 Ga0070683_100021052 3300005329 Bacteria 5816
6 Ga0070690_100262645 3300005330 Unclassified 1225
7 Ga0070670_100008535 3300005331 Bacteria 8739
8 Ga0068869_100026776 3300005334 Bacteria 4015
9 Ga0068869_100157741 3300005334 Bacteria 1764
10 Ga0070680_100079621 3300005336 Bacteria 2701
11 Ga0070682_100075325 3300005337 Bacteria 2170
12 Ga0070660_100191684 3300005339 Bacteria 1656
13 Ga0070689_100041964 3300005340 Bacteria 3512
14 Ga0070689_100232892 3300005340 Bacteria 1515
15 Ga0070691_10021739 3300005341 Bacteria 2970
16 Ga0070687_100065572 3300005343 Bacteria 1932
17 Ga0070687_100343139 3300005343 Unclassified 961
18 Ga0070661_100025479 3300005344 Bacteria 4251
19 Ga0070668_100174096 3300005347 Unclassified 1754
20 Ga0070675_100023129 3300005354 Bacteria 4967
21 Ga0070675_100069876 3300005354 Bacteria 2910
22 Ga0070671_100011011 3300005355 Bacteria 7257
23 Ga0070688_100071152 3300005365 Unclassified 2226
24 Ga0070659_100101583 3300005366 Bacteria 2315
25 Ga0070659_100329914 3300005366 Bacteria 1277
26 Ga0070703_10000038 3300005406 Bacteria 65056
27 Ga0070703_10027016 3300005406 Bacteria 1709
28 Ga0070701_10250266 3300005438 Bacteria 1070
29 Ga0070711_100182698 3300005439 Bacteria 1606
30 Ga0070711_100356906 3300005439 Bacteria 1176
31 Ga0070705_100097504 3300005440 Bacteria 1848
32 Ga0070705_100127782 3300005440 Unclassified 1653
33 Ga0070700_100051571 3300005441 Bacteria 2561
34 Ga0070708_100001328 3300005445 Bacteria 18924
35 Ga0070708_100014679 3300005445 Bacteria 6452
36 Ga0070708_100025784 3300005445 Bacteria 5027
37 Ga0070663_100050693 3300005455 Bacteria 2953
38 Ga0070678_100058767 3300005456 Bacteria 2824
39 Ga0070678_100584013 3300005456 Bacteria 996
40 Ga0068867_100007715 3300005459 Bacteria 7610
41 Ga0068867_100144729 3300005459 Bacteria 1861
42 Ga0068867_100454136 3300005459 Unclassified 1092
43 Ga0070685_10069339 3300005466 Unclassified 2085
44 Ga0070706_100000237 3300005467 Bacteria 67422
45 Ga0070706_100093399 3300005467 Bacteria 2791
46 Ga0070707_100003028 3300005468 Bacteria 15938
47 Ga0070698_100009617 3300005471 Bacteria 10342
48 Ga0070698_100013238 3300005471 Bacteria 8728
49 Ga0070698_100170958 3300005471 Bacteria 2114
50 Ga0070698_100451950 3300005471 Bacteria 1220
51 Ga0070699_100024065 3300005518 Bacteria 5248
52 Ga0070699_100132448 3300005518 Bacteria 2198
53 Ga0070699_100218277 3300005518 Unclassified 1699
54 Ga0070679_100126235 3300005530 Bacteria 2541
55 Ga0070684_100011320 3300005535 Bacteria 7102
56 Ga0070697_100053076 3300005536 Bacteria 3295
57 Ga0070697_100136383 3300005536 Bacteria 2061
58 Ga0070697_100415590 3300005536 Bacteria 1168
59 Ga0068853_100437197 3300005539 Bacteria 1229
60 Ga0070686_100011205 3300005544 Bacteria 5081
61 Ga0070695_100036618 3300005545 Bacteria 3088
62 Ga0070695_100044953 3300005545 Bacteria 2813
63 Ga0070696_100022082 3300005546 Bacteria 4321
64 Ga0070696_100106676 3300005546 Bacteria 2014
65 Ga0070665_100177657 3300005548 Bacteria 2130
66 Ga0070704_100005812 3300005549 Bacteria 7219
67 Ga0070704_100006877 3300005549 Bacteria 6737
68 Ga0070704_100304587 3300005549 Unclassified 1329
69 Ga0070664_100003690 3300005564 Bacteria 12346
70 Ga0068856_100900037 3300005614 Bacteria 904
71 Ga0068859_100606017 3300005617 Bacteria 1188
72 Ga0068864_100068470 3300005618 Bacteria 3084
73 Ga0068861_100063239 3300005719 Bacteria 2845
74 Ga0068851_10116457 3300005834 Bacteria 1432
75 Ga0068870_10001429 3300005840 Bacteria 9653
76 Ga0068870_10172165 3300005840 Bacteria 1293
77 Ga0068863_100005616 3300005841 Bacteria 12327
78 Ga0068862_100022987 3300005844 Bacteria 5220
79 Ga0081455_10001823 3300005937 Bacteria 25652
80 Ga0081455_10003461 3300005937 Bacteria 18147
81 Ga0081455_10004856 3300005937 Bacteria 14918
82 Ga0081455_10069504 3300005937 Bacteria 2928
83 Ga0081455_10365932 3300005937 Bacteria 1012
84 Ga0081539_10011652 3300005985 Bacteria 6918
85 Ga0075365_10160777 3300006038 Bacteria 1565
86 Ga0075364_10060429 3300006051 Bacteria 2485
87 Ga0075364_10254768 3300006051 Bacteria 1193
88 Ga0075432_10005394 3300006058 Bacteria 4359
89 Ga0075432_10017656 3300006058 Bacteria 2432
90 Ga0070716_100222316 3300006173 Bacteria 1269
91 Ga0070712_100062681 3300006175 Bacteria 2630
92 Ga0075367_10107749 3300006178 Bacteria 1708
93 Ga0075427_10003310 3300006194 Bacteria 2213
94 Ga0068871_100045552 3300006358 Bacteria 3530
95 Ga0075428_100059673 3300006844 Bacteria 4177
96 Ga0075430_100099672 3300006846 Bacteria 2426
97 Ga0075430_100309085 3300006846 Bacteria 1307
98 Ga0075431_100034335 3300006847 Bacteria 5225
99 Ga0075431_100340024 3300006847 Bacteria 1510
100 Ga0075431_100466610 3300006847 Bacteria 1257
101 Ga0075433_10000482 3300006852 Bacteria 26002
102 Ga0075433_10002748 3300006852 Bacteria 13462
103 Ga0075434_100006686 3300006871 Bacteria 10589
104 Ga0075434_100092483 3300006871 Bacteria 3027
105 Ga0075434_100151723 3300006871 Bacteria 2337
106 Ga0075434_100187023 3300006871 Bacteria 2091
107 Ga0075434_100245860 3300006871 Bacteria 1809
108 Ga0075429_100008006 3300006880 Bacteria 9179
109 Ga0075429_100089274 3300006880 Bacteria 2687
110 Ga0075429_100092296 3300006880 Bacteria 2641
111 Ga0075429_100131731 3300006880 Bacteria 2187
112 Ga0075429_100410669 3300006880 Bacteria 1186
113 Ga0068865_100020170 3300006881 Bacteria 4322
114 Ga0068865_100037253 3300006881 Bacteria 3283
115 Ga0068865_100497257 3300006881 Bacteria 1016
116 Ga0075436_100009207 3300006914 Bacteria 6757
117 Ga0075436_100257975 3300006914 Bacteria 1243
118 Ga0097620_100606052 3300006931 Bacteria 1188
119 Ga0075435_100000274 3300007076 Bacteria 32020
120 Ga0105251_10025127 3300009011 Bacteria 3051
121 Ga0111539_10036162 3300009094 Bacteria 5973
122 Ga0111539_10083396 3300009094 Bacteria 3759
123 Ga0111539_10219208 3300009094 Bacteria 2216
124 Ga0105245_10138932 3300009098 Bacteria 2286
125 Ga0105245_10184573 3300009098 Bacteria 1995
126 Ga0105245_10656542 3300009098 Bacteria 1079
127 Ga0114129_10003645 3300009147 Bacteria 21669
128 Ga0114129_10020277 3300009147 Bacteria 9461
129 Ga0114129_10028709 3300009147 Bacteria 7882
130 Ga0114129_10072132 3300009147 Bacteria 4815
131 Ga0114129_10296591 3300009147 Bacteria 2156
132 Ga0114129_10558815 3300009147 Bacteria 1487
133 Ga0105243_10003292 3300009148 Bacteria 13124
134 Ga0105243_10004615 3300009148 Bacteria 10861
135 Ga0105243_10011551 3300009148 Bacteria 6682
136 Ga0105243_10012510 3300009148 Bacteria 6418
137 Ga0105243_10174933 3300009148 Unclassified 1862
138 Ga0105242_10003785 3300009176 Bacteria 11757
139 Ga0105242_10022598 3300009176 Bacteria 4949
140 Ga0105242_10235770 3300009176 Bacteria 1642
141 Ga0105248_10104258 3300009177 Bacteria 3197
142 Ga0105248_10129671 3300009177 Unclassified 2845
143 Ga0105248_10741498 3300009177 Bacteria 1108
144 Ga0105249_10078944 3300009553 Bacteria 3055
145 Ga0105249_10125780 3300009553 Bacteria 2441
146 Ga0105249_10634459 3300009553 Unclassified 1125
147 Ga0105246_10018532 3300011119 Bacteria 4439
148 Ga0105246_10188351 3300011119 Bacteria 1595
149 Ga0157374_10539293 3300013296 Bacteria 1174
150 Ga0157378_10001190 3300013297 Bacteria 23613
151 Ga0157378_10004303 3300013297 Bacteria 12538
152 Ga0157378_10017068 3300013297 Bacteria 6364
153 Ga0163162_10313422 3300013306 Unclassified 1701
154 Ga0157375_10018529 3300013308 Bacteria 6315
155 Ga0157375_10115157 3300013308 Bacteria 2791
156 Ga0157375_10444590 3300013308 Bacteria 1462
157 Ga0163163_10883249 3300014325 Bacteria 957
158 Ga0163163_11101399 3300014325 Bacteria 857
159 Ga0157380_10065633 3300014326 Bacteria 2918
160 Ga0157380_10294624 3300014326 Bacteria 1491
161 Ga0157379_10235529 3300014968 Unclassified 1660
162 Ga0157376_10008037 3300014969 Bacteria 7577
163 Ga0207653_10000093 3300025885 Bacteria 65950
164 Ga0207642_10032759 3300025899 Bacteria 2192
165 Ga0207688_10110039 3300025901 Bacteria 1598
166 Ga0207647_10047039 3300025904 Bacteria 2685
167 Ga0207645_10101323 3300025907 Bacteria 1858
168 Ga0207643_10000649 3300025908 Bacteria 21694
169 Ga0207684_10000683 3300025910 Bacteria 40239
170 Ga0207684_10006221 3300025910 Bacteria 10899
171 Ga0207684_10211790 3300025910 Bacteria 1672
172 Ga0207693_10109023 3300025915 Bacteria 2172
173 Ga0207662_10073969 3300025918 Bacteria 2068
174 Ga0207646_10004312 3300025922 Bacteria 15517
175 Ga0207646_10540188 3300025922 Bacteria 1049
176 Ga0207694_10423811 3300025924 Bacteria 1109
177 Ga0207650_10007508 3300025925 Bacteria 7434
178 Ga0207659_10018350 3300025926 Unclassified 4586
179 Ga0207687_10025804 3300025927 Bacteria 3933
180 Ga0207644_10025832 3300025931 Bacteria 4041
181 Ga0207690_10047714 3300025932 Bacteria 2843
182 Ga0207686_10027664 3300025934 Bacteria 3322
183 Ga0207686_10056142 3300025934 Bacteria 2474
184 Ga0207686_10099545 3300025934 Bacteria 1938
185 Ga0207709_10016065 3300025935 Bacteria 4155
186 Ga0207709_10018700 3300025935 Bacteria 3886
187 Ga0207709_10228371 3300025935 Bacteria 1347
188 Ga0207709_10570158 3300025935 Unclassified 893
189 Ga0207670_10135959 3300025936 Unclassified 1807
190 Ga0207669_10179739 3300025937 Bacteria 1515
191 Ga0207665_10245826 3300025939 Bacteria 1320
192 Ga0207711_10007080 3300025941 Bacteria 9399
193 Ga0207661_10051272 3300025944 Bacteria 3292
194 Ga0207668_10124451 3300025972 Unclassified 1958
195 Ga0207658_10688212 3300025986 Bacteria 924
196 Ga0207677_10007629 3300026023 Bacteria 6003
197 Ga0207678_10008462 3300026067 Bacteria 9072
198 Ga0207678_10093814 3300026067 Bacteria 2564
199 Ga0207708_10019400 3300026075 Bacteria 5125
200 Ga0207708_10025172 3300026075 Unclassified 4501
201 Ga0207641_10250273 3300026088 Unclassified 1655
202 Ga0207648_10013941 3300026089 Bacteria 7452
203 Ga0207648_10055060 3300026089 Bacteria 3473
204 Ga0207648_10106171 3300026089 Unclassified 2464
205 Ga0207676_10011958 3300026095 Bacteria 6211
206 Ga0207676_10090323 3300026095 Bacteria 2513
207 Ga0207676_10124714 3300026095 Unclassified 2179
208 Ga0207674_10024089 3300026116 Bacteria 6509
209 Ga0207674_10274782 3300026116 Bacteria 1633
210 Ga0207675_100037759 3300026118 Bacteria 4506
211 Ga0207675_100150629 3300026118 Bacteria 2214
212 Ga0207683_10010315 3300026121 Bacteria 7967
213 Ga0207683_10627171 3300026121 Bacteria 996
214 Ga0207428_10018716 3300027907 Bacteria 5911
215 Ga0207428_10100944 3300027907 Bacteria 2230
216 Ga0268266_10142257 3300028379 Bacteria 2154
217 Ga0268265_10464339 3300028380 Bacteria 1185
218 Ga0265327_10001551 3300031251 Bacteria 28232
219 Ga0316575_10031538 3300031665 Bacteria 2075
220 Ga0316579_10045134 3300031691 Bacteria 2054
221 Ga0316576_10020742 3300031727 Bacteria 4533
222 Ga0316577_10003530 3300031733 Bacteria 7914
223 Ga0316577_10087351 3300031733 Bacteria 1745
224 Ga0307413_10071864 3300031824 Bacteria 2182
225 Ga0307416_100055423 3300032002 Bacteria 3193
226 Ga0307415_100070004 3300032126 Bacteria 2462
227 Ga0316580_10000325 3300032139 Bacteria 10477
228 Ga0373938_0038631 3300034957 Bacteria 1053
229 Ga0373926_0000010 3300035083 Bacteria 32455
230 Ga0373944_0005027 3300035089 Bacteria 3469
231 Ga0373949_0015191 3300035090 Bacteria 1718
232 Ga0373952_0027383 3300035092 Bacteria 1244
233 Ga0373923_0032894 3300035111 Bacteria 2097
234 Ga0373932_0108970 3300035112 Bacteria 910
235 Ga0373936_0000059 3300035113 Bacteria 53059
236 Ga0373939_0005198 3300035114 Bacteria 3093
237 Ga0373941_0030066 3300035115 Bacteria 1607
238 Ga0373945_0000002 3300035116 Bacteria 65469
239 Ga0373943_0000019 3300035170 Bacteria 55052
240 Ga0373946_0000002 3300035171 Bacteria 81733
241 Ga0373962_0046119 3300035242 Bacteria 1243
242 Ga0316574_0000088 3300035398 Bacteria 26209
243 Ga0316574_0008121 3300035398 Bacteria 5807
244 Ga0316574_0048928 3300035398 Bacteria 2627
245 Ga0373924_0002125 3300035410 Bacteria 6622
246 Ga0373931_0076517 3300035691 Bacteria 1838
247 Ga0373931_0157814 3300035691 Bacteria 1327
248 Ga0373935_0000019 3300035692 Bacteria 66395
249 Ga0373927_0005697 3300035695 Bacteria 8551
250 Ga0373947_0000026 3300035725 Bacteria 81539
251 Ga0373947_0003041 3300035725 Bacteria 9977
252 Ga0373937_0100444 3300036401 Bacteria 2685
253 Ga0316582_0049852 3300036647 Bacteria 2650
254 Ga0316582_0120878 3300036647 Bacteria 1752
255 Ga0316582_0254603 3300036647 Bacteria 1203
256 Ga0316584_0034220 3300036712 Bacteria 3766
257 Ga0373925_0000811 3300037068 Bacteria 28827
258 Ga0373925_0124246 3300037068 Bacteria 2006
259 Ga0395899_0035927 3300037312 Bacteria 3719
260 Ga0395899_0071664 3300037312 Bacteria 2536
261 Ga0395900_0039219 3300037418 Bacteria 4880
262 Ga0395900_0216700 3300037418 Bacteria 1931
263 Ga0395900_0377896 3300037418 Bacteria 1385
264 Ga0395898_0336558 3300037466 Bacteria 1439
265 Ga0395898_0363474 3300037466 Bacteria 1380
266 Ga0395898_0376255 3300037466 Bacteria 1354
267 Ga0395905_0017599 3300037471 Bacteria 6783
268 Ga0395905_0027142 3300037471 Bacteria 5400
269 Ga0395905_0033665 3300037471 Bacteria 4812
270 Ga0395905_0200840 3300037471 Unclassified 1869
271 Ga0395905_0218261 3300037471 Bacteria 1785
272 Ga0395901_0168281 3300038443 Bacteria 2300
273 Ga0395901_0197954 3300038443 Bacteria 2106
274 Ga0395901_0201795 3300038443 Bacteria 2084
275 Ga0395901_0285613 3300038443 Bacteria 1713
276 Ga0400485_03114 3300038735 Bacteria 12298
277 Ga0439461_0024768 3300041410 Bacteria 1215
278 Ga0439466_0051404 3300041411 Bacteria 1350
279 Ga0439454_037878 3300042011 Bacteria 780
280 Ga0450910_006508 3300042147 Bacteria 1614
281 Ga0439434_0035630 3300042435 Bacteria 1521
282 Ga0439460_0073178 3300042461 Bacteria 1065
283 Ga0439460_0073829 3300042461 Bacteria 1061
284 Ga0451577_0547733 3300042876 Bacteria 1050
285 Ga0466961_0165614 3300044693 Bacteria 1376
286 Ga0466958_0266031 3300045836 Bacteria 1098
287 Ga0495603_0002028 3300046455 Bacteria 11918
288 Ga0495603_0007006 3300046455 Bacteria 6767
289 Ga0495603_0011131 3300046455 Bacteria 5452
290 Ga0495603_0013625 3300046455 Bacteria 4920
291 Ga0495603_0082794 3300046455 Bacteria 1879
292 Ga0495629_0000227 3300046459 Bacteria 50313
293 Ga0495629_0008676 3300046459 Bacteria 7485
294 Ga0495641_0002240 3300046461 Bacteria 15430
295 Ga0495641_0079199 3300046461 Bacteria 1472
296 Ga0495641_0090097 3300046461 Bacteria 1370
297 Ga0495580_0005700 3300046472 Bacteria 10245
298 Ga0495580_0096693 3300046472 Bacteria 2054
299 Ga0495582_0000080 3300046473 Bacteria 48724
300 Ga0495582_0000800 3300046473 Bacteria 17465
301 Ga0495639_0003130 3300046475 Bacteria 7190
302 Ga0495639_0044977 3300046475 Bacteria 1997
303 Ga0495639_0078260 3300046475 Bacteria 1536
304 Ga0495662_0006031 3300046476 Bacteria 6055
305 Ga0495662_0026969 3300046476 Bacteria 2775
306 Ga0495584_0047877 3300046491 Bacteria 2156
307 Ga0495585_0038183 3300046492 Bacteria 2703
308 Ga0495585_0067061 3300046492 Bacteria 1964
309 Ga0495585_0070083 3300046492 Bacteria 1913
310 Ga0495594_0094326 3300046499 Bacteria 1679
311 Ga0495594_0184231 3300046499 Bacteria 1189
312 Ga0495596_0034952 3300046500 Bacteria 1994
313 Ga0495618_0129080 3300046514 Bacteria 1618
314 Ga0495630_0000537 3300046517 Bacteria 27782
315 Ga0495630_0203119 3300046517 Bacteria 1512
316 Ga0495644_0003097 3300046523 Bacteria 6587
317 Ga0495644_0030365 3300046523 Bacteria 2041
318 Ga0495644_0083247 3300046523 Bacteria 1206
319 Ga0495644_0123068 3300046523 Bacteria 987
320 Ga0495666_0000155 3300046526 Bacteria 28960
321 Ga0495666_0142327 3300046526 Bacteria 1117
322 Ga0495665_0000052 3300046531 Bacteria 46537
323 Ga0495665_0004710 3300046531 Bacteria 7362
324 Ga0495640_0001949 3300046533 Bacteria 16459
325 Ga0495586_0001341 3300046535 Bacteria 13668
326 Ga0495598_0013600 3300046537 Bacteria 2021
327 Ga0495609_0029622 3300046538 Bacteria 2492
328 Ga0495621_0099995 3300046539 Bacteria 1103
329 Ga0495622_0125085 3300046557 Bacteria 1173
330 Ga0495633_0039123 3300046558 Bacteria 2264
331 Ga0495633_0154032 3300046558 Bacteria 1061
332 Ga0495656_0012498 3300046615 Bacteria 3134
333 Ga0495656_0021278 3300046615 Bacteria 2523
334 Ga0495656_0055666 3300046615 Bacteria 1707
335 Ga0495656_0094133 3300046615 Bacteria 1375
336 Ga0495656_0104436 3300046615 Bacteria 1315
337 Ga0495634_0000174 3300046642 Bacteria 59456
338 Ga0495635_0000329 3300046663 Bacteria 30331
339 Ga0495659_0002864 3300046664 Bacteria 5540
340 Ga0495659_0114720 3300046664 Bacteria 1055
341 Ga0495661_0213224 3300046665 Bacteria 1004
342 Ga0495588_0000334 3300046674 Bacteria 30913
343 Ga0495588_0013760 3300046674 Bacteria 3860
344 Ga0495647_0000633 3300046681 Bacteria 10381
345 Ga0495647_0066400 3300046681 Bacteria 1435
346 Ga0495647_0105959 3300046681 Bacteria 1168
347 Ga0495658_0000872 3300046683 Bacteria 16201
348 Ga0495658_0020308 3300046683 Bacteria 3483
349 Ga0495613_0001098 3300046689 Bacteria 20663
350 Ga0495613_0002112 3300046689 Bacteria 15090
351 Ga0495613_0399740 3300046689 Bacteria 937
352 Ga0495624_0001591 3300046690 Bacteria 17449
353 Ga0495624_0082187 3300046690 Bacteria 1994
354 Ga0495670_0069368 3300046691 Bacteria 1782
355 Ga0495589_0120949 3300046794 Bacteria 1261
356 Ga0495581_0000778 3300047315 Bacteria 16945
357 Ga0495581_0225748 3300047315 Bacteria 1096
358 Ga0495581_0234057 3300047315 Bacteria 1074
359 Ga0495636_0150065 3300047318 Bacteria 1045
360 Ga0495636_0151009 3300047318 Bacteria 1043
361 Ga0495674_0000159 3300047319 Bacteria 52192
362 Ga0495674_0118014 3300047319 Bacteria 2244
363 Ga0495676_0001234 3300047321 Bacteria 21929
364 Ga0495676_0025520 3300047321 Bacteria 5101
365 Ga0495676_0061041 3300047321 Bacteria 2951
366 Ga0495676_0141352 3300047321 Bacteria 1725
367 Ga0495680_0003747 3300047322 Bacteria 14816
368 Ga0495677_0078349 3300047445 Bacteria 1237
369 Ga0495677_0102588 3300047445 Bacteria 1084
370 Ga0495677_0104649 3300047445 Bacteria 1073
371 Ga0495677_0161024 3300047445 Bacteria 866
372 Ga0495685_069784 3300047447 Bacteria 1178
373 Ga0495593_0003209 3300047673 Bacteria 9811
374 Ga0495614_0001444 3300048089 Bacteria 10267
375 Ga0496100_0295908 3300048903 Bacteria 1210
376 Ga0496101_0026009 3300048904 Bacteria 4065
377 Ga0496101_0236753 3300048904 Bacteria 1420
378 Ga0496101_0295110 3300048904 Bacteria 1269
379 Ga0496102_0011777 3300048905 Bacteria 7547
380 Ga0496102_0034189 3300048905 Bacteria 4571
381 Ga0496102_0148114 3300048905 Bacteria 2204
382 Ga0496103_0005454 3300048906 Bacteria 7605
383 Ga0496103_0117175 3300048906 Bacteria 1695
384 Ga0496104_0054101 3300048907 Bacteria 3794
385 Ga0496104_0515324 3300048907 Bacteria 1107
386 Ga0496106_0002292 3300048909 Bacteria 14273
387 Ga0496106_0097242 3300048909 Bacteria 2279
388 Ga0496106_0179227 3300048909 Bacteria 1682
389 Ga0496107_0002071 3300048910 Bacteria 12825
390 Ga0496107_0002724 3300048910 Bacteria 11597
391 Ga0496108_0005633 3300048911 Bacteria 10138
392 Ga0496108_0031890 3300048911 Bacteria 4374
393 Ga0496108_0064747 3300048911 Bacteria 3080
394 Ga0496109_0046718 3300048912 Bacteria 3933
395 Ga0496109_0052189 3300048912 Bacteria 3726
396 Ga0496109_0126772 3300048912 Bacteria 2380
397 Ga0496109_0134573 3300048912 Bacteria 2309
398 Ga0496109_0657479 3300048912 Bacteria 985
399 Ga0496110_0003360 3300048913 Bacteria 12217
400 Ga0496110_0176195 3300048913 Bacteria 1941
401 Ga0496111_0003121 3300048914 Bacteria 10194
402 Ga0496111_0079519 3300048914 Bacteria 2392
403 Ga0496112_0023862 3300048915 Bacteria 5851
404 Ga0496112_0024829 3300048915 Bacteria 5749
405 Ga0496113_0027666 3300048916 Bacteria 4068
406 Ga0496113_0045640 3300048916 Bacteria 3251
407 Ga0496114_0019260 3300048917 Bacteria 5529
408 Ga0496114_0407488 3300048917 Bacteria 1204
409 Ga0496114_0484909 3300048917 Bacteria 1094
410 Ga0496115_0091505 3300048918 Bacteria 2486
411 Ga0496115_0211151 3300048918 Bacteria 1603
412 Ga0496115_0400740 3300048918 Bacteria 1113
413 Ga0501031_0001621 3300049568 Bacteria 14074
414 Ga0501031_0024492 3300049568 Bacteria 3934
415 Ga0501031_0044839 3300049568 Bacteria 2886
416 Ga0501031_0156453 3300049568 Bacteria 1490
417 Ga0501031_0237131 3300049568 Bacteria 1186
418 Ga0501032_0026393 3300049569 Bacteria 3994
419 Ga0501032_0169011 3300049569 Bacteria 1434
420 Ga0501033_0007486 3300049570 Bacteria 8499
421 Ga0501033_0082382 3300049570 Bacteria 2359
422 Ga0501034_0016355 3300049571 Bacteria 7614
423 Ga0501034_0091993 3300049571 Bacteria 3031
424 Ga0501036_0026141 3300049572 Bacteria 4927
425 Ga0501036_0028534 3300049572 Bacteria 4716
426 Ga0501036_0045869 3300049572 Bacteria 3701
427 Ga0501036_0351528 3300049572 Bacteria 1231
428 Ga0501037_0005073 3300049573 Bacteria 9582
429 Ga0501037_0007241 3300049573 Bacteria 8106
430 Ga0501038_0001735 3300049574 Bacteria 20278
431 Ga0501038_0128767 3300049574 Bacteria 2080
432 Ga0501038_0161833 3300049574 Bacteria 1818
433 Ga0501038_0457780 3300049574 Bacteria 980
434 Ga0501038_0460809 3300049574 Bacteria 976
435 Ga0501039_0000702 3300049575 Bacteria 24073
436 Ga0501039_0007925 3300049575 Bacteria 8092
437 Ga0501039_0039518 3300049575 Bacteria 3643
438 Ga0501040_0000326 3300049576 Bacteria 27922
439 Ga0501040_0007081 3300049576 Bacteria 7269
440 Ga0501040_0009652 3300049576 Bacteria 6301
441 Ga0501040_0019809 3300049576 Bacteria 4476
442 Ga0501040_0095246 3300049576 Bacteria 2072
443 Ga0501040_0229246 3300049576 Bacteria 1322
444 Ga0501041_0000923 3300049577 Bacteria 15900
445 Ga0501041_0032341 3300049577 Bacteria 3161
446 Ga0501041_0033179 3300049577 Bacteria 3122
447 Ga0501041_0256081 3300049577 Bacteria 1100
448 Ga0501041_0384110 3300049577 Bacteria 889
449 Ga0501042_0000230 3300049578 Bacteria 26959
450 Ga0501042_0020462 3300049578 Bacteria 4605
451 Ga0501042_0245586 3300049578 Bacteria 1292
452 Ga0501043_0024529 3300049579 Bacteria 4732
453 Ga0501043_0062013 3300049579 Bacteria 2936
454 Ga0501046_0004207 3300049580 Bacteria 13111
455 Ga0501046_0018338 3300049580 Bacteria 5825
456 Ga0501046_0023755 3300049580 Bacteria 5038
457 Ga0501046_0203901 3300049580 Bacteria 1470
458 Ga0501048_0001903 3300049582 Bacteria 15850
459 Ga0501048_0002234 3300049582 Bacteria 14754
460 Ga0501048_0042325 3300049582 Bacteria 3261
461 Ga0501048_0051323 3300049582 Bacteria 2936
462 Ga0501067_0023030 3300049583 Bacteria 3450
463 Ga0501067_0193787 3300049583 Bacteria 1132
464 Ga0501068_0002447 3300049584 Bacteria 9854
465 Ga0501068_0005856 3300049584 Bacteria 6744
466 Ga0501068_0231592 3300049584 Bacteria 1175
467 Ga0501069_0003879 3300049585 Bacteria 7703
468 Ga0501069_0007029 3300049585 Bacteria 5892
469 Ga0501069_0053459 3300049585 Bacteria 2249
470 Ga0501070_0016951 3300049586 Bacteria 6113
471 Ga0501071_0000517 3300049587 Bacteria 19663
472 Ga0501071_0002807 3300049587 Bacteria 10718
473 Ga0501071_0020009 3300049587 Bacteria 4650
474 Ga0501071_0192660 3300049587 Bacteria 1529
475 Ga0501071_0591840 3300049587 Bacteria 853
476 Ga0501072_0000334 3300049588 Bacteria 33538
477 Ga0501072_0001029 3300049588 Bacteria 20677
478 Ga0501072_0008491 3300049588 Bacteria 7793
479 Ga0501072_0101740 3300049588 Bacteria 2284
480 Ga0501072_0390345 3300049588 Bacteria 1104
481 Ga0501073_0004587 3300049589 Bacteria 10386
482 Ga0501073_0119836 3300049589 Bacteria 1824
483 Ga0501074_0001853 3300049590 Bacteria 14514
484 Ga0501074_0019531 3300049590 Bacteria 4919
485 Ga0501074_0092668 3300049590 Bacteria 2163
486 Ga0501074_0491720 3300049590 Bacteria 869
487 Ga0501075_0005054 3300049591 Bacteria 9010
488 Ga0501075_0027248 3300049591 Bacteria 4210
489 Ga0501075_0033329 3300049591 Bacteria 3832
490 Ga0501075_0067736 3300049591 Bacteria 2695
491 Ga0501075_0071317 3300049591 Bacteria 2626
492 Ga0501075_0088173 3300049591 Bacteria 2352
493 Ga0501075_0719018 3300049591 Bacteria 760
494 Ga0501076_0000263 3300049592 Bacteria 32456
495 Ga0501076_0000560 3300049592 Bacteria 23710
496 Ga0501076_0188018 3300049592 Bacteria 1685
497 Ga0501076_0389033 3300049592 Bacteria 1146
498 Ga0501077_0003268 3300049593 Bacteria 9762
499 Ga0501077_0003574 3300049593 Bacteria 9346
500 Ga0501077_0004835 3300049593 Bacteria 8183
501 Ga0501077_0067247 3300049593 Bacteria 2273
502 Ga0501079_0001964 3300049741 Bacteria 14741
503 Ga0501079_0020039 3300049741 Bacteria 5109
504 Ga0501079_0070619 3300049741 Bacteria 2697
505 Ga0501079_0103619 3300049741 Bacteria 2207
506 Ga0501079_0116124 3300049741 Bacteria 2080
507 Ga0501079_0191542 3300049741 Bacteria 1596
508 Ga0501080_0000672 3300049742 Bacteria 27233
509 Ga0501080_0026472 3300049742 Bacteria 5388
510 Ga0501080_0133879 3300049742 Bacteria 2294
511 Ga0501080_0234201 3300049742 Bacteria 1678
512 Ga0501081_0001547 3300049743 Bacteria 14154
513 Ga0501081_0008048 3300049743 Bacteria 6840
514 Ga0501081_0063875 3300049743 Bacteria 2556
515 Ga0501081_0081039 3300049743 Bacteria 2273
516 Ga0501081_0181937 3300049743 Bacteria 1520
517 Ga0501081_0349286 3300049743 Bacteria 1090
518 Ga0501081_0439939 3300049743 Bacteria 968
519 Ga0501081_0496629 3300049743 Bacteria 909
520 Ga0501083_0011119 3300049744 Bacteria 6318
521 Ga0501083_0109479 3300049744 Bacteria 1817
522 Ga0501035_0026886 3300049822 Bacteria 5260
523 Ga0501035_0082802 3300049822 Bacteria 2831
524 Ga0501044_0010076 3300049823 Bacteria 10272
525 Ga0501045_0013012 3300049824 Bacteria 5866
526 Ga0501045_0019195 3300049824 Bacteria 4870
527 Ga0501045_0041199 3300049824 Bacteria 3361
528 nmdc:mga0yw44_19811_c1 3300050492 Bacteria 3718
529 nmdc:mga0yw44_50066_c2 3300050492 Bacteria 1710
530 nmdc:mga06z11_63923_c1 3300050494 Bacteria 1927
531 nmdc:mga05p37_149226_c1 3300050507 Bacteria 2861
532 nmdc:mga05p37_260662_c1 3300050507 Bacteria 2075
533 nmdc:mga05p37_261059_c1 3300050507 Bacteria 2073
534 nmdc:mga05p37_34643_c1 3300050507 Bacteria 6186
535 nmdc:mga05p37_45033_c1 3300050507 Bacteria 5428
536 nmdc:mga05p37_62619_c1 3300050507 Bacteria 4578
537 nmdc:mga05p37_9461_c1 3300050507 Bacteria 11536
538 nmdc:mga09592_31989_c1 3300050508 Bacteria 4385
539 nmdc:mga09592_380685_c1 3300050508 Bacteria 1220
540 nmdc:mga09592_42705_c1 3300050508 Bacteria 3814
541 nmdc:mga0qj67_1631_c1 3300050509 Bacteria 15769
542 nmdc:mga0qj67_185547_c1 3300050509 Bacteria 1690
543 nmdc:mga0qj67_492743_c1 3300050509 Bacteria 985
544 nmdc:mga06r32_103410_c1 3300050510 Bacteria 2797
545 nmdc:mga06r32_126470_c1 3300050510 Bacteria 2525
546 nmdc:mga06r32_484246_c1 3300050510 Bacteria 1215
547 nmdc:mga06r32_662621_c1 3300050510 Bacteria 1011
548 nmdc:mga08y16_166189_c1 3300050511 Bacteria 2292
549 nmdc:mga08y16_169693_c1 3300050511 Bacteria 2266
550 nmdc:mga08y16_288607_c1 3300050511 Bacteria 1692
551 nmdc:mga08y16_33786_c1 3300050511 Bacteria 5372
552 nmdc:mga0n895_47259_c1 3300050512 Bacteria 4208
553 nmdc:mga0n895_987_c1 3300050512 Bacteria 20606
554 nmdc:mga0rr50_14453_c1 3300050513 Bacteria 5180
555 nmdc:mga0rr50_27657_c1 3300050513 Bacteria 3975
556 nmdc:mga0rr50_410782_c1 3300050513 Bacteria 1144
557 nmdc:mga08x19_162270_c1 3300050514 Bacteria 1518
558 nmdc:mga08x19_9201_c1 3300050514 Bacteria 5898
559 nmdc:mga0a205_146000_c1 3300050515 Bacteria 2266
560 nmdc:mga0a205_27634_c1 3300050515 Bacteria 5419
561 nmdc:mga0a205_9081_c1 3300050515 Bacteria 9070
562 Ga0495601_0094824 3300053077 Bacteria 1924
563 Ga0495619_0000062 3300053085 Bacteria 86221
564 Ga0495619_0267487 3300053085 Bacteria 1185
565 Ga0500566_0100213 3300053094 Bacteria 1589
566 Ga0500566_0147592 3300053094 Bacteria 1241
567 Ga0501084_0000629 3300054114 Bacteria 26903
568 Ga0501084_0006390 3300054114 Bacteria 9684
569 Ga0501084_0047780 3300054114 Bacteria 3584
570 Ga0501084_0169384 3300054114 Bacteria 1843
571 Ga0501084_0208133 3300054114 Bacteria 1650
572 Ga0501084_0305324 3300054114 Bacteria 1344
573 Ga0501084_0498846 3300054114 Bacteria 1029
574 Ga0501084_0521549 3300054114 Bacteria 1004
575 Ga0590074_025778 3300059423 Bacteria 1026
576 Ga0501082_0001091 3300060353 Bacteria 24037
577 Ga0501082_0025847 3300060353 Bacteria 5061
578 Ga0501082_0150060 3300060353 Bacteria 2024
579 Ga0530510_0000448 3300061734 Bacteria 26668
580 Ga0530510_0009345 3300061734 Bacteria 6876
581 Ga0530510_0018948 3300061734 Bacteria 4881
582 Ga0530510_0336195 3300061734 Bacteria 1133
583 Ga0530510_0389839 3300061734 Bacteria 1049
584 Ga0207646_10297849
585 JGI24752J21851_1004800
586 JGI24747J21853_1003907
587 JGI24751J29686_10000343
588 Ga0070683_100021052
589 Ga0070690_100262645
590 Ga0070670_100008535
591 Ga0068869_100026776
592 Ga0068869_100157741
593 Ga0070680_100079621
594 Ga0070682_100075325
595 Ga0070660_100191684
596 Ga0070689_100041964
597 Ga0070689_100232892
598 Ga0070691_10021739
599 Ga0070687_100065572
600 Ga0070687_100343139
601 Ga0070661_100025479
602 Ga0070668_100174096
603 Ga0070675_100023129
604 Ga0070675_100069876
605 Ga0070671_100011011
606 Ga0070688_100071152
607 Ga0070659_100101583
608 Ga0070659_100329914
609 Ga0070703_10000038
610 Ga0070703_10027016
611 Ga0070701_10250266
612 Ga0070711_100182698
613 Ga0070711_100356906
614 Ga0070705_100097504
615 Ga0070705_100127782
616 Ga0070700_100051571
617 Ga0070708_100001328
618 Ga0070708_100014679
619 Ga0070708_100025784
620 Ga0070663_100050693
621 Ga0070678_100058767
622 Ga0070678_100584013
623 Ga0068867_100007715
624 Ga0068867_100144729
625 Ga0068867_100454136
626 Ga0070685_10069339
627 Ga0070706_100000237
628 Ga0070706_100093399
629 Ga0070707_100003028
630 Ga0070698_100009617
631 Ga0070698_100013238
632 Ga0070698_100170958
633 Ga0070698_100451950
634 Ga0070699_100024065
635 Ga0070699_100132448
636 Ga0070699_100218277
637 Ga0070679_100126235
638 Ga0070684_100011320
639 Ga0070697_100053076
640 Ga0070697_100136383
641 Ga0070697_100415590
642 Ga0068853_100437197
643 Ga0070686_100011205
644 Ga0070695_100036618
645 Ga0070695_100044953
646 Ga0070696_100022082
647 Ga0070696_100106676
648 Ga0070665_100177657
649 Ga0070704_100005812
650 Ga0070704_100006877
651 Ga0070704_100304587
652 Ga0070664_100003690
653 Ga0068856_100900037
654 Ga0068859_100606017
655 Ga0068864_100068470
656 Ga0068861_100063239
657 Ga0068851_10116457
658 Ga0068870_10001429
659 Ga0068870_10172165
660 Ga0068863_100005616
661 Ga0068862_100022987
662 Ga0081455_10001823
663 Ga0081455_10003461
664 Ga0081455_10004856
665 Ga0081455_10069504
666 Ga0081455_10365932
667 Ga0081539_10011652
668 Ga0075365_10160777
669 Ga0075364_10060429
670 Ga0075364_10254768
671 Ga0075432_10005394
672 Ga0075432_10017656
673 Ga0070716_100222316
674 Ga0070712_100062681
675 Ga0075367_10107749
676 Ga0075427_10003310
677 Ga0068871_100045552
678 Ga0075428_100059673
679 Ga0075430_100099672
680 Ga0075430_100309085
681 Ga0075431_100034335
682 Ga0075431_100340024
683 Ga0075431_100466610
684 Ga0075433_10000482
685 Ga0075433_10002748
686 Ga0075434_100006686
687 Ga0075434_100092483
688 Ga0075434_100151723
689 Ga0075434_100187023
690 Ga0075434_100245860
691 Ga0075429_100008006
692 Ga0075429_100089274
693 Ga0075429_100092296
694 Ga0075429_100131731
695 Ga0075429_100410669
696 Ga0068865_100020170
697 Ga0068865_100037253
698 Ga0068865_100497257
699 Ga0075436_100009207
700 Ga0075436_100257975
701 Ga0097620_100606052
702 Ga0075435_100000274
703 Ga0105251_10025127
704 Ga0111539_10036162
705 Ga0111539_10083396
706 Ga0111539_10219208
707 Ga0105245_10138932
708 Ga0105245_10184573
709 Ga0105245_10656542
710 Ga0114129_10003645
711 Ga0114129_10020277
712 Ga0114129_10028709
713 Ga0114129_10072132
714 Ga0114129_10296591
715 Ga0114129_10558815
716 Ga0105243_10003292
717 Ga0105243_10004615
718 Ga0105243_10011551
719 Ga0105243_10012510
720 Ga0105243_10174933
721 Ga0105242_10003785
722 Ga0105242_10022598
723 Ga0105242_10235770
724 Ga0105248_10104258
725 Ga0105248_10129671
726 Ga0105248_10741498
727 Ga0105249_10078944
728 Ga0105249_10125780
729 Ga0105249_10634459
730 Ga0105246_10018532
731 Ga0105246_10188351
732 Ga0157374_10539293
733 Ga0157378_10001190
734 Ga0157378_10004303
735 Ga0157378_10017068
736 Ga0163162_10313422
737 Ga0157375_10018529
738 Ga0157375_10115157
739 Ga0157375_10444590
740 Ga0163163_10883249
741 Ga0163163_11101399
742 Ga0157380_10065633
743 Ga0157380_10294624
744 Ga0157379_10235529
745 Ga0157376_10008037
746 Ga0207653_10000093
747 Ga0207642_10032759
748 Ga0207688_10110039
749 Ga0207647_10047039
750 Ga0207645_10101323
751 Ga0207643_10000649
752 Ga0207684_10000683
753 Ga0207684_10006221
754 Ga0207684_10211790
755 Ga0207693_10109023
756 Ga0207662_10073969
757 Ga0207646_10004312
758 Ga0207646_10540188
759 Ga0207694_10423811
760 Ga0207650_10007508
761 Ga0207659_10018350
762 Ga0207687_10025804
763 Ga0207644_10025832
764 Ga0207690_10047714
765 Ga0207686_10027664
766 Ga0207686_10056142
767 Ga0207686_10099545
768 Ga0207709_10016065
769 Ga0207709_10018700
770 Ga0207709_10228371
771 Ga0207709_10570158
772 Ga0207670_10135959
773 Ga0207669_10179739
774 Ga0207665_10245826
775 Ga0207711_10007080
776 Ga0207661_10051272
777 Ga0207668_10124451
778 Ga0207658_10688212
779 Ga0207677_10007629
780 Ga0207678_10008462
781 Ga0207678_10093814
782 Ga0207708_10019400
783 Ga0207708_10025172
784 Ga0207641_10250273
785 Ga0207648_10013941
786 Ga0207648_10055060
787 Ga0207648_10106171
788 Ga0207676_10011958
789 Ga0207676_10090323
790 Ga0207676_10124714
791 Ga0207674_10024089
792 Ga0207674_10274782
793 Ga0207675_100037759
794 Ga0207675_100150629
795 Ga0207683_10010315
796 Ga0207683_10627171
797 Ga0207428_10018716
798 Ga0207428_10100944
799 Ga0268266_10142257
800 Ga0268265_10464339
801 Ga0265327_10001551
802 Ga0316575_10031538
803 Ga0316579_10045134
804 Ga0316576_10020742
805 Ga0316577_10003530
806 Ga0316577_10087351
807 Ga0307413_10071864
808 Ga0307416_100055423
809 Ga0307415_100070004
810 Ga0316580_10000325
811 Ga0373938_0038631
812 Ga0373926_0000010
813 Ga0373944_0005027
814 Ga0373949_0015191
815 Ga0373952_0027383
816 Ga0373923_0032894
817 Ga0373932_0108970
818 Ga0373936_0000059
819 Ga0373939_0005198
820 Ga0373941_0030066
821 Ga0373945_0000002
822 Ga0373943_0000019
823 Ga0373946_0000002
824 Ga0373962_0046119
825 Ga0316574_0000088
826 Ga0316574_0008121
827 Ga0316574_0048928
828 Ga0373924_0002125
829 Ga0373931_0076517
830 Ga0373931_0157814
831 Ga0373935_0000019
832 Ga0373927_0005697
833 Ga0373947_0000026
834 Ga0373947_0003041
835 Ga0373937_0100444
836 Ga0316582_0049852
837 Ga0316582_0120878
838 Ga0316582_0254603
839 Ga0316584_0034220
840 Ga0373925_0000811
841 Ga0373925_0124246
842 Ga0395899_0035927
843 Ga0395899_0071664
844 Ga0395900_0039219
845 Ga0395900_0216700
846 Ga0395900_0377896
847 Ga0395898_0336558
848 Ga0395898_0363474
849 Ga0395898_0376255
850 Ga0395905_0017599
851 Ga0395905_0027142
852 Ga0395905_0033665
853 Ga0395905_0200840
854 Ga0395905_0218261
855 Ga0395901_0168281
856 Ga0395901_0197954
857 Ga0395901_0201795
858 Ga0395901_0285613
859 Ga0400485_03114
860 Ga0439461_0024768
861 Ga0439466_0051404
862 Ga0439454_037878
863 Ga0450910_006508
864 Ga0439434_0035630
865 Ga0439460_0073178
866 Ga0439460_0073829
867 Ga0451577_0547733
868 Ga0466961_0165614
869 Ga0466958_0266031
870 Ga0495603_0002028
871 Ga0495603_0007006
872 Ga0495603_0011131
873 Ga0495603_0013625
874 Ga0495603_0082794
875 Ga0495629_0000227
876 Ga0495629_0008676
877 Ga0495641_0002240
878 Ga0495641_0079199
879 Ga0495641_0090097
880 Ga0495580_0005700
881 Ga0495580_0096693
882 Ga0495582_0000080
883 Ga0495582_0000800
884 Ga0495639_0003130
885 Ga0495639_0044977
886 Ga0495639_0078260
887 Ga0495662_0006031
888 Ga0495662_0026969
889 Ga0495584_0047877
890 Ga0495585_0038183
891 Ga0495585_0067061
892 Ga0495585_0070083
893 Ga0495594_0094326
894 Ga0495594_0184231
895 Ga0495596_0034952
896 Ga0495618_0129080
897 Ga0495630_0000537
898 Ga0495630_0203119
899 Ga0495644_0003097
900 Ga0495644_0030365
901 Ga0495644_0083247
902 Ga0495644_0123068
903 Ga0495666_0000155
904 Ga0495666_0142327
905 Ga0495665_0000052
906 Ga0495665_0004710
907 Ga0495640_0001949
908 Ga0495586_0001341
909 Ga0495598_0013600
910 Ga0495609_0029622
911 Ga0495621_0099995
912 Ga0495622_0125085
913 Ga0495633_0039123
914 Ga0495633_0154032
915 Ga0495656_0012498
916 Ga0495656_0021278
917 Ga0495656_0055666
918 Ga0495656_0094133
919 Ga0495656_0104436
920 Ga0495634_0000174
921 Ga0495635_0000329
922 Ga0495659_0002864
923 Ga0495659_0114720
924 Ga0495661_0213224
925 Ga0495588_0000334
926 Ga0495588_0013760
927 Ga0495647_0000633
928 Ga0495647_0066400
929 Ga0495647_0105959
930 Ga0495658_0000872
931 Ga0495658_0020308
932 Ga0495613_0001098
933 Ga0495613_0002112
934 Ga0495613_0399740
935 Ga0495624_0001591
936 Ga0495624_0082187
937 Ga0495670_0069368
938 Ga0495589_0120949
939 Ga0495581_0000778
940 Ga0495581_0225748
941 Ga0495581_0234057
942 Ga0495636_0150065
943 Ga0495636_0151009
944 Ga0495674_0000159
945 Ga0495674_0118014
946 Ga0495676_0001234
947 Ga0495676_0025520
948 Ga0495676_0061041
949 Ga0495676_0141352
950 Ga0495680_0003747
951 Ga0495677_0078349
952 Ga0495677_0102588
953 Ga0495677_0104649
954 Ga0495677_0161024
955 Ga0495685_069784
956 Ga0495593_0003209
957 Ga0495614_0001444
958 Ga0496100_0295908
959 Ga0496101_0026009
960 Ga0496101_0236753
961 Ga0496101_0295110
962 Ga0496102_0011777
963 Ga0496102_0034189
964 Ga0496102_0148114
965 Ga0496103_0005454
966 Ga0496103_0117175
967 Ga0496104_0054101
968 Ga0496104_0515324
969 Ga0496106_0002292
970 Ga0496106_0097242
971 Ga0496106_0179227
972 Ga0496107_0002071
973 Ga0496107_0002724
974 Ga0496108_0005633
975 Ga0496108_0031890
976 Ga0496108_0064747
977 Ga0496109_0046718
978 Ga0496109_0052189
979 Ga0496109_0126772
980 Ga0496109_0134573
981 Ga0496109_0657479
982 Ga0496110_0003360
983 Ga0496110_0176195
984 Ga0496111_0003121
985 Ga0496111_0079519
986 Ga0496112_0023862
987 Ga0496112_0024829
988 Ga0496113_0027666
989 Ga0496113_0045640
990 Ga0496114_0019260
991 Ga0496114_0407488
992 Ga0496114_0484909
993 Ga0496115_0091505
994 Ga0496115_0211151
995 Ga0496115_0400740
996 Ga0501031_0001621
997 Ga0501031_0024492
998 Ga0501031_0044839
999 Ga0501031_0156453
1000 Ga0501031_0237131
1001 Ga0501032_0026393
1002 Ga0501032_0169011
1003 Ga0501033_0007486
1004 Ga0501033_0082382
1005 Ga0501034_0016355
1006 Ga0501034_0091993
1007 Ga0501036_0026141
1008 Ga0501036_0028534
1009 Ga0501036_0045869
1010 Ga0501036_0351528
1011 Ga0501037_0005073
1012 Ga0501037_0007241
1013 Ga0501038_0001735
1014 Ga0501038_0128767
1015 Ga0501038_0161833
1016 Ga0501038_0457780
1017 Ga0501038_0460809
1018 Ga0501039_0000702
1019 Ga0501039_0007925
1020 Ga0501039_0039518
1021 Ga0501040_0000326
1022 Ga0501040_0007081
1023 Ga0501040_0009652
1024 Ga0501040_0019809
1025 Ga0501040_0095246
1026 Ga0501040_0229246
1027 Ga0501041_0000923
1028 Ga0501041_0032341
1029 Ga0501041_0033179
1030 Ga0501041_0256081
1031 Ga0501041_0384110
1032 Ga0501042_0000230
1033 Ga0501042_0020462
1034 Ga0501042_0245586
1035 Ga0501043_0024529
1036 Ga0501043_0062013
1037 Ga0501046_0004207
1038 Ga0501046_0018338
1039 Ga0501046_0023755
1040 Ga0501046_0203901
1041 Ga0501048_0001903
1042 Ga0501048_0002234
1043 Ga0501048_0042325
1044 Ga0501048_0051323
1045 Ga0501067_0023030
1046 Ga0501067_0193787
1047 Ga0501068_0002447
1048 Ga0501068_0005856
1049 Ga0501068_0231592
1050 Ga0501069_0003879
1051 Ga0501069_0007029
1052 Ga0501069_0053459
1053 Ga0501070_0016951
1054 Ga0501071_0000517
1055 Ga0501071_0002807
1056 Ga0501071_0020009
1057 Ga0501071_0192660
1058 Ga0501071_0591840
1059 Ga0501072_0000334
1060 Ga0501072_0001029
1061 Ga0501072_0008491
1062 Ga0501072_0101740
1063 Ga0501072_0390345
1064 Ga0501073_0004587
1065 Ga0501073_0119836
1066 Ga0501074_0001853
1067 Ga0501074_0019531
1068 Ga0501074_0092668
1069 Ga0501074_0491720
1070 Ga0501075_0005054
1071 Ga0501075_0027248
1072 Ga0501075_0033329
1073 Ga0501075_0067736
1074 Ga0501075_0071317
1075 Ga0501075_0088173
1076 Ga0501075_0719018
1077 Ga0501076_0000263
1078 Ga0501076_0000560
1079 Ga0501076_0188018
1080 Ga0501076_0389033
1081 Ga0501077_0003268
1082 Ga0501077_0003574
1083 Ga0501077_0004835
1084 Ga0501077_0067247
1085 Ga0501079_0001964
1086 Ga0501079_0020039
1087 Ga0501079_0070619
1088 Ga0501079_0103619
1089 Ga0501079_0116124
1090 Ga0501079_0191542
1091 Ga0501080_0000672
1092 Ga0501080_0026472
1093 Ga0501080_0133879
1094 Ga0501080_0234201
1095 Ga0501081_0001547
1096 Ga0501081_0008048
1097 Ga0501081_0063875
1098 Ga0501081_0081039
1099 Ga0501081_0181937
1100 Ga0501081_0349286
1101 Ga0501081_0439939
1102 Ga0501081_0496629
1103 Ga0501083_0011119
1104 Ga0501083_0109479
1105 Ga0501035_0026886
1106 Ga0501035_0082802
1107 Ga0501044_0010076
1108 Ga0501045_0013012
1109 Ga0501045_0019195
1110 Ga0501045_0041199
1111 nmdc:mga0yw44_19811_c1
1112 nmdc:mga0yw44_50066_c2
1113 nmdc:mga06z11_63923_c1
1114 nmdc:mga05p37_149226_c1
1115 nmdc:mga05p37_260662_c1
1116 nmdc:mga05p37_261059_c1
1117 nmdc:mga05p37_34643_c1
1118 nmdc:mga05p37_45033_c1
1119 nmdc:mga05p37_62619_c1
1120 nmdc:mga05p37_9461_c1
1121 nmdc:mga09592_31989_c1
1122 nmdc:mga09592_380685_c1
1123 nmdc:mga09592_42705_c1
1124 nmdc:mga0qj67_1631_c1
1125 nmdc:mga0qj67_185547_c1
1126 nmdc:mga0qj67_492743_c1
1127 nmdc:mga06r32_103410_c1
1128 nmdc:mga06r32_126470_c1
1129 nmdc:mga06r32_484246_c1
1130 nmdc:mga06r32_662621_c1
1131 nmdc:mga08y16_166189_c1
1132 nmdc:mga08y16_169693_c1
1133 nmdc:mga08y16_288607_c1
1134 nmdc:mga08y16_33786_c1
1135 nmdc:mga0n895_47259_c1
1136 nmdc:mga0n895_987_c1
1137 nmdc:mga0rr50_14453_c1
1138 nmdc:mga0rr50_27657_c1
1139 nmdc:mga0rr50_410782_c1
1140 nmdc:mga08x19_162270_c1
1141 nmdc:mga08x19_9201_c1
1142 nmdc:mga0a205_146000_c1
1143 nmdc:mga0a205_27634_c1
1144 nmdc:mga0a205_9081_c1
1145 Ga0495601_0094824
1146 Ga0495619_0000062
1147 Ga0495619_0267487
1148 Ga0500566_0100213
1149 Ga0500566_0147592
1150 Ga0501084_0000629
1151 Ga0501084_0006390
1152 Ga0501084_0047780
1153 Ga0501084_0169384
1154 Ga0501084_0208133
1155 Ga0501084_0305324
1156 Ga0501084_0498846
1157 Ga0501084_0521549
1158 Ga0590074_025778
1159 Ga0501082_0001091
1160 Ga0501082_0025847
1161 Ga0501082_0150060
1162 Ga0530510_0000448
1163 Ga0530510_0009345
1164 Ga0530510_0018948
1165 Ga0530510_0336195
1166 Ga0530510_0389839

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

176

246

0.94

PF12710

HAD

haloacid dehalogenase-like hydrolase

39

225

0.88

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

36

228

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hgr-assembly1.cif.gz_D crystal structure of e56a/k67a mutant of 2-keto-3-deoxy-d-glycero-d-galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron 0.8319 92 208
3e81-assembly1.cif.gz_A structure-function analysis of 2-keto-3-deoxy-d-glycero-d-galacto-nononate-9-phosphate (kdn) phosphatase defines a new clad within the type c0 had subfamily 0.8278 92 208
4hgq-assembly2.cif.gz_G crystal structure of e56a mutant of 2-keto-3-deoxy-d-glycero-d-galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron 0.8271 92 208
3dao-assembly1.cif.gz_A crystal structure of a putative phosphate (eubrec_1417) from eubacterium rectale at 1.80 a resolution 0.8205 160 220
1nrw-assembly1.cif.gz_A the structure of a haloacid dehalogenase-like hydrolase from b. subtilis 0.8194 160 220
ID Description Score Start End Superfamily
3fvvB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.926 96 219 3.40.50.1000
af_A0A0N7KQR1_13_96_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9089 160 199 3.40.50.1000
af_A0A0P0XL78_11_123_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8978 160 199 3.40.50.1000
af_P46891_5_260_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.873 160 220 1.25.40.10
af_A4I3L5_9_277_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8667 160 220 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7W1J3E0-F1-model_v4 Haloacid dehalogenase-like hydrolase 0.9979 156 221 GO:0016787
AF-A0A6B3IBL5-F1-model_v4 HAD hydrolase family protein 0.9808 152 217 GO:0016787
AF-A0A3C1L486-F1-model_v4 HAD-IB family hydrolase 0.9457 105 222 GO:0016787
AF-A0A6J7RWA5-F1-model_v4 Unannotated protein 0.9395 115 219 GO:0003841
GO:0006654
AF-A0A6B3IBL5-F1-model_v4 HAD hydrolase family protein 0.9389 152 217 GO:0016787

Map