F466244

General Info

Members Datasets Scaffolds Average Seq Length
583 232 583 166

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100059225|Ga0070660_1000592255
Length 179
Sequence MTASAPMLPEPRYPAKIAGAGTSLARIAALPRPLVFTNGVFDLLHRGHVTYLEQARGLGASLVVAVNTDASVRRLGKGTERPLNAQDDRMAVLAALACVDLVVPFDEDTPHGLIVACAPDVLVKGGDYDATTTVGAREVIAAGGRFVAIPFRYRRSTSALVARIRGAGAAQAATSSKAP

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
196 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.12
Rhizosphere 95.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1002390 3300001976 Bacteria 2497
2 JGI24743J22301_10004644 3300001991 Bacteria 2248
3 JGI24749J21850_1005128 3300002076 Bacteria 1835
4 JGI24035J26624_1002883 3300002126 Bacteria 1607
5 Ga0065712_10091630 3300005290 Bacteria 2365
6 Ga0065715_10140802 3300005293 Bacteria 1857
7 Ga0070658_10003752 3300005327 Bacteria 12431
8 Ga0070658_10138820 3300005327 Bacteria 2029
9 Ga0070658_10214452 3300005327 Bacteria 1627
10 Ga0070683_100013983 3300005329 Bacteria 7010
11 Ga0070683_100190181 3300005329 Bacteria 1949
12 Ga0070683_100231789 3300005329 Bacteria 1755
13 Ga0070683_100369848 3300005329 Bacteria 1366
14 Ga0070683_101222202 3300005329 Bacteria 722
15 Ga0070690_100015636 3300005330 Bacteria 4533
16 Ga0070690_100023121 3300005330 Bacteria 3810
17 Ga0070670_100042370 3300005331 Bacteria 3913
18 Ga0070670_100066203 3300005331 Bacteria 3100
19 Ga0070670_100119753 3300005331 Bacteria 2270
20 Ga0070670_100222608 3300005331 Bacteria 1642
21 Ga0070677_10022140 3300005333 Bacteria 2337
22 Ga0068869_100003831 3300005334 Bacteria 9277
23 Ga0068869_100039952 3300005334 Bacteria 3352
24 Ga0068869_100839054 3300005334 Bacteria 792
25 Ga0070666_10002948 3300005335 Bacteria 10303
26 Ga0070666_10019763 3300005335 Bacteria 4351
27 Ga0070666_10207090 3300005335 Bacteria 1381
28 Ga0070666_10251540 3300005335 Bacteria 1251
29 Ga0070680_100027835 3300005336 Bacteria 4529
30 Ga0070682_100903059 3300005337 Bacteria 726
31 Ga0068868_100003299 3300005338 Bacteria 11226
32 Ga0068868_100146109 3300005338 Bacteria 1944
33 Ga0068868_100459050 3300005338 Bacteria 1109
34 Ga0070660_100013791 3300005339 Bacteria 5813
35 Ga0070660_100053089 3300005339 Bacteria 3125
36 Ga0070660_100059225 3300005339 Bacteria 2969
37 Ga0070660_100114916 3300005339 Bacteria 2145
38 Ga0070660_100161784 3300005339 Bacteria 1804
39 Ga0070660_100309531 3300005339 Bacteria 1296
40 Ga0070660_100777524 3300005339 Bacteria 805
41 Ga0070689_100002823 3300005340 Bacteria 11423
42 Ga0070691_10245292 3300005341 Bacteria 958
43 Ga0070661_100001471 3300005344 Bacteria 16352
44 Ga0070661_100033740 3300005344 Bacteria 3710
45 Ga0070661_100058684 3300005344 Bacteria 2820
46 Ga0070661_100069378 3300005344 Bacteria 2591
47 Ga0070661_100117706 3300005344 Bacteria 1988
48 Ga0070661_100180123 3300005344 Bacteria 1607
49 Ga0070668_100001131 3300005347 Bacteria 18735
50 Ga0070669_100005744 3300005353 Bacteria 8944
51 Ga0070669_100107964 3300005353 Bacteria 2109
52 Ga0070669_100625899 3300005353 Bacteria 903
53 Ga0070675_100012131 3300005354 Bacteria 6757
54 Ga0070675_100222891 3300005354 Bacteria 1643
55 Ga0070675_100292175 3300005354 Bacteria 1434
56 Ga0070671_100004532 3300005355 Bacteria 11002
57 Ga0070671_100007222 3300005355 Bacteria 8881
58 Ga0070671_100010513 3300005355 Bacteria 7428
59 Ga0070671_100179292 3300005355 Bacteria 1793
60 Ga0070671_100401577 3300005355 Bacteria 1172
61 Ga0070674_100003089 3300005356 Bacteria 9267
62 Ga0070674_100009506 3300005356 Bacteria 5822
63 Ga0070674_100028420 3300005356 Bacteria 3673
64 Ga0070673_100024376 3300005364 Bacteria 4436
65 Ga0070673_100137778 3300005364 Bacteria 2056
66 Ga0070673_100238090 3300005364 Bacteria 1581
67 Ga0070673_100970421 3300005364 Bacteria 790
68 Ga0070673_101607106 3300005364 Bacteria 614
69 Ga0070688_100001955 3300005365 Bacteria 10357
70 Ga0070688_100029185 3300005365 Bacteria 3301
71 Ga0070659_100004569 3300005366 Bacteria 9897
72 Ga0070659_100019993 3300005366 Bacteria 5083
73 Ga0070659_100036791 3300005366 Bacteria 3816
74 Ga0070659_100043306 3300005366 Bacteria 3521
75 Ga0070659_100106858 3300005366 Bacteria 2256
76 Ga0070659_100115990 3300005366 Bacteria 2165
77 Ga0070659_100146686 3300005366 Bacteria 1923
78 Ga0070659_100147610 3300005366 Bacteria 1917
79 Ga0070659_100517925 3300005366 Bacteria 1018
80 Ga0070667_100031601 3300005367 Bacteria 4414
81 Ga0070667_100047276 3300005367 Bacteria 3620
82 Ga0070667_100171093 3300005367 Bacteria 1918
83 Ga0070709_10060146 3300005434 Bacteria 2414
84 Ga0070709_10065128 3300005434 Bacteria 2332
85 Ga0070709_10393969 3300005434 Bacteria 1033
86 Ga0070714_100014951 3300005435 Bacteria 6239
87 Ga0070714_100019491 3300005435 Bacteria 5529
88 Ga0070714_100508328 3300005435 Bacteria 1150
89 Ga0070714_100535891 3300005435 Bacteria 1119
90 Ga0070710_10036685 3300005437 Bacteria 2681
91 Ga0070711_100082826 3300005439 Bacteria 2290
92 Ga0070711_100214405 3300005439 Bacteria 1493
93 Ga0070700_100008699 3300005441 Bacteria 5538
94 Ga0070708_100000731 3300005445 Bacteria 24915
95 Ga0070663_100034726 3300005455 Bacteria 3494
96 Ga0070663_100276822 3300005455 Bacteria 1336
97 Ga0070678_100000550 3300005456 Bacteria 18321
98 Ga0070678_100005330 3300005456 Bacteria 7419
99 Ga0070662_100003464 3300005457 Bacteria 9838
100 Ga0070662_100080518 3300005457 Bacteria 2425
101 Ga0070662_100777455 3300005457 Bacteria 813
102 Ga0070681_10007825 3300005458 Bacteria 10453
103 Ga0070681_10160094 3300005458 Bacteria 2175
104 Ga0070681_10234749 3300005458 Bacteria 1748
105 Ga0070681_10555821 3300005458 Bacteria 1062
106 Ga0070681_10711777 3300005458 Bacteria 920
107 Ga0070681_10871204 3300005458 Bacteria 819
108 Ga0068867_100001145 3300005459 Bacteria 18123
109 Ga0068867_100341082 3300005459 Bacteria 1247
110 Ga0070685_10007504 3300005466 Bacteria 5582
111 Ga0070685_10017469 3300005466 Bacteria 3841
112 Ga0070699_100034428 3300005518 Bacteria 4377
113 Ga0070699_100622173 3300005518 Bacteria 985
114 Ga0070679_100031289 3300005530 Bacteria 5256
115 Ga0070679_100038137 3300005530 Bacteria 4777
116 Ga0070679_100040034 3300005530 Bacteria 4661
117 Ga0070679_100044282 3300005530 Bacteria 4434
118 Ga0070679_100179248 3300005530 Bacteria 2091
119 Ga0070679_100466004 3300005530 Bacteria 1208
120 Ga0070684_100072246 3300005535 Bacteria 3037
121 Ga0070684_100608165 3300005535 Bacteria 1016
122 Ga0068853_100013226 3300005539 Bacteria 6735
123 Ga0068853_100020039 3300005539 Bacteria 5558
124 Ga0068853_100029634 3300005539 Bacteria 4616
125 Ga0068853_100127208 3300005539 Bacteria 2277
126 Ga0070672_100001458 3300005543 Bacteria 14657
127 Ga0070672_100006692 3300005543 Bacteria 7768
128 Ga0070672_100031429 3300005543 Bacteria 3996
129 Ga0070672_100189319 3300005543 Bacteria 1717
130 Ga0070686_100102045 3300005544 Bacteria 1940
131 Ga0070696_100021047 3300005546 Bacteria 4420
132 Ga0070693_100084621 3300005547 Bacteria 1899
133 Ga0070665_100001395 3300005548 Bacteria 28413
134 Ga0070665_100064945 3300005548 Bacteria 3661
135 Ga0070665_100083004 3300005548 Bacteria 3209
136 Ga0068855_100017552 3300005563 Bacteria 8606
137 Ga0068855_100069548 3300005563 Bacteria 4097
138 Ga0068855_100125811 3300005563 Bacteria 2931
139 Ga0068855_100173260 3300005563 Bacteria 2443
140 Ga0068855_100472479 3300005563 Bacteria 1366
141 Ga0068855_101122397 3300005563 Bacteria 821
142 Ga0068855_101252395 3300005563 Bacteria 769
143 Ga0070664_100022377 3300005564 Bacteria 5211
144 Ga0070664_100033744 3300005564 Bacteria 4289
145 Ga0070664_100057956 3300005564 Bacteria 3294
146 Ga0070664_100104149 3300005564 Bacteria 2470
147 Ga0070664_100117485 3300005564 Bacteria 2326
148 Ga0070664_100245765 3300005564 Bacteria 1607
149 Ga0070664_100330583 3300005564 Bacteria 1383
150 Ga0070664_100641342 3300005564 Bacteria 987
151 Ga0070664_100798204 3300005564 Bacteria 882
152 Ga0068857_100000465 3300005577 Bacteria 28816
153 Ga0068857_100035965 3300005577 Bacteria 4387
154 Ga0068857_100156898 3300005577 Bacteria 2064
155 Ga0068857_100160303 3300005577 Bacteria 2041
156 Ga0068857_100316065 3300005577 Bacteria 1442
157 Ga0068854_100028699 3300005578 Bacteria 3847
158 Ga0068854_100416884 3300005578 Bacteria 1115
159 Ga0068854_100726874 3300005578 Bacteria 859
160 Ga0068854_101063692 3300005578 Bacteria 719
161 Ga0068856_100000125 3300005614 Bacteria 77301
162 Ga0068856_100060384 3300005614 Bacteria 3745
163 Ga0068856_100105927 3300005614 Bacteria 2806
164 Ga0070702_100338405 3300005615 Bacteria 1055
165 Ga0068852_100016442 3300005616 Bacteria 5770
166 Ga0068852_100036370 3300005616 Bacteria 4118
167 Ga0068852_100039892 3300005616 Bacteria 3957
168 Ga0068852_100177535 3300005616 Bacteria 2001
169 Ga0068852_100247367 3300005616 Bacteria 1707
170 Ga0068852_100325817 3300005616 Bacteria 1493
171 Ga0068852_100336827 3300005616 Bacteria 1469
172 Ga0068852_100842660 3300005616 Bacteria 932
173 Ga0068852_100877272 3300005616 Bacteria 914
174 Ga0068859_100005307 3300005617 Bacteria 13103
175 Ga0068859_100279055 3300005617 Bacteria 1763
176 Ga0068864_100007610 3300005618 Bacteria 8919
177 Ga0068864_100021513 3300005618 Bacteria 5402
178 Ga0068864_101388788 3300005618 Bacteria 704
179 Ga0068866_10128591 3300005718 Bacteria 1437
180 Ga0068866_10359268 3300005718 Bacteria 928
181 Ga0068861_100027250 3300005719 Bacteria 4160
182 Ga0068861_100240334 3300005719 Bacteria 1540
183 Ga0068851_10001567 3300005834 Bacteria 10036
184 Ga0068851_10004364 3300005834 Bacteria 6368
185 Ga0068851_10018654 3300005834 Bacteria 3344
186 Ga0068851_10030813 3300005834 Bacteria 2662
187 Ga0068851_10041195 3300005834 Bacteria 2322
188 Ga0068851_10236518 3300005834 Bacteria 1031
189 Ga0068870_10060990 3300005840 Bacteria 2026
190 Ga0068870_10178316 3300005840 Bacteria 1273
191 Ga0068858_100005787 3300005842 Bacteria 12077
192 Ga0068858_100116074 3300005842 Bacteria 2502
193 Ga0068860_100010721 3300005843 Bacteria 9049
194 Ga0068862_100024936 3300005844 Bacteria 5019
195 Ga0068862_100796358 3300005844 Bacteria 923
196 Ga0070716_100038139 3300006173 Bacteria 2659
197 Ga0070712_100265969 3300006175 Bacteria 1376
198 Ga0097621_100002227 3300006237 Bacteria 13288
199 Ga0097621_100044991 3300006237 Bacteria 3564
200 Ga0097621_100251433 3300006237 Bacteria 1548
201 Ga0097621_101039698 3300006237 Bacteria 767
202 Ga0097621_101113892 3300006237 Bacteria 741
203 Ga0068871_100011822 3300006358 Bacteria 6417
204 Ga0068871_100020681 3300006358 Bacteria 5046
205 Ga0068871_100117896 3300006358 Bacteria 2239
206 Ga0075433_10740576 3300006852 Bacteria 860
207 Ga0075434_100140265 3300006871 Unclassified 2436
208 Ga0075434_100669387 3300006871 Bacteria 1056
209 Ga0068865_100003988 3300006881 Bacteria 8856
210 Ga0097620_100005307 3300006931 Bacteria 13103
211 Ga0097620_100279082 3300006931 Bacteria 1763
212 Ga0105240_10014137 3300009093 Bacteria 10906
213 Ga0105240_10032172 3300009093 Bacteria 6793
214 Ga0105240_10308528 3300009093 Bacteria 1808
215 Ga0111539_10002947 3300009094 Bacteria 22580
216 Ga0111539_10485242 3300009094 Bacteria 1439
217 Ga0105245_10063107 3300009098 Bacteria 3345
218 Ga0105243_10183833 3300009148 Bacteria 1820
219 Ga0105241_10061671 3300009174 Bacteria 2888
220 Ga0105241_10146102 3300009174 Bacteria 1930
221 Ga0105241_10364282 3300009174 Bacteria 1259
222 Ga0105241_10397221 3300009174 Bacteria 1208
223 Ga0105248_10001562 3300009177 Bacteria 25458
224 Ga0105248_10017740 3300009177 Bacteria 7850
225 Ga0105248_10789439 3300009177 Bacteria 1072
226 Ga0105237_10044821 3300009545 Bacteria 4453
227 Ga0105237_10134500 3300009545 Bacteria 2467
228 Ga0105237_10174282 3300009545 Bacteria 2151
229 Ga0105237_10340953 3300009545 Bacteria 1503
230 Ga0105237_11883096 3300009545 Bacteria 606
231 Ga0105238_10000495 3300009551 Bacteria 41322
232 Ga0105238_10719657 3300009551 Bacteria 1011
233 Ga0105249_10094719 3300009553 Bacteria 2799
234 Ga0105249_10175316 3300009553 Bacteria 2082
235 Ga0105239_10195414 3300010375 Bacteria 2266
236 Ga0105239_10301609 3300010375 Bacteria 1804
237 Ga0105239_10433722 3300010375 Bacteria 1489
238 Ga0105239_10571229 3300010375 Bacteria 1289
239 Ga0105246_11304431 3300011119 Bacteria 673
240 Ga0157373_10001602 3300013100 Bacteria 17274
241 Ga0157373_10003939 3300013100 Bacteria 11212
242 Ga0157373_10113744 3300013100 Bacteria 1902
243 Ga0157373_10476285 3300013100 Bacteria 900
244 Ga0157371_10001964 3300013102 Bacteria 20390
245 Ga0157371_10069943 3300013102 Bacteria 2485
246 Ga0157371_10330864 3300013102 Bacteria 1107
247 Ga0157370_10025794 3300013104 Bacteria 5814
248 Ga0157370_10113544 3300013104 Bacteria 2531
249 Ga0157370_10127528 3300013104 Bacteria 2375
250 Ga0157369_10028044 3300013105 Bacteria 6235
251 Ga0157369_10169453 3300013105 Bacteria 2301
252 Ga0157369_10430712 3300013105 Bacteria 1367
253 Ga0157369_10665000 3300013105 Bacteria 1074
254 Ga0157369_11323092 3300013105 Bacteria 734
255 Ga0157374_10005777 3300013296 Bacteria 10445
256 Ga0157374_10093490 3300013296 Bacteria 2871
257 Ga0157374_10169054 3300013296 Bacteria 2132
258 Ga0157374_10292891 3300013296 Bacteria 1609
259 Ga0157378_10670215 3300013297 Bacteria 1054
260 Ga0163162_10008638 3300013306 Bacteria 9923
261 Ga0163162_10389067 3300013306 Bacteria 1527
262 Ga0163162_10596167 3300013306 Bacteria 1231
263 Ga0157372_10003272 3300013307 Bacteria 17507
264 Ga0157372_10008814 3300013307 Bacteria 10714
265 Ga0157372_10026178 3300013307 Bacteria 6347
266 Ga0157372_10046744 3300013307 Bacteria 4806
267 Ga0157372_10073874 3300013307 Bacteria 3844
268 Ga0157372_10179304 3300013307 Bacteria 2452
269 Ga0157372_10180439 3300013307 Bacteria 2444
270 Ga0157372_10186020 3300013307 Bacteria 2405
271 Ga0157372_10888989 3300013307 Bacteria 1034
272 Ga0157372_10974071 3300013307 Bacteria 983
273 Ga0157375_10017367 3300013308 Bacteria 6491
274 Ga0157375_10223311 3300013308 Bacteria 2043
275 Ga0157375_10516061 3300013308 Bacteria 1358
276 Ga0157375_12114494 3300013308 Bacteria 670
277 Ga0157380_10003087 3300014326 Bacteria 11360
278 Ga0157380_10552358 3300014326 Bacteria 1130
279 Ga0182008_10062675 3300014497 Bacteria 1832
280 Ga0182008_10263546 3300014497 Bacteria 892
281 Ga0157377_10006265 3300014745 Bacteria 5663
282 Ga0157379_10006361 3300014968 Bacteria 10169
283 Ga0157379_10403709 3300014968 Bacteria 1256
284 Ga0157376_10019347 3300014969 Bacteria 5246
285 Ga0157376_10164878 3300014969 Bacteria 2012
286 Ga0157376_12519627 3300014969 Bacteria 554
287 Ga0163161_10033638 3300017792 Bacteria 3663
288 Ga0163161_10072192 3300017792 Bacteria 2527
289 Ga0206354_10077192 3300020081 Bacteria 2315
290 Ga0206353_10609133 3300020082 Bacteria 3210
291 Ga0207697_10000331 3300025315 Bacteria 26425
292 Ga0207656_10003424 3300025321 Bacteria 5453
293 Ga0207656_10044679 3300025321 Bacteria 1893
294 Ga0207656_10056830 3300025321 Bacteria 1706
295 Ga0207656_10076382 3300025321 Bacteria 1498
296 Ga0207656_10123975 3300025321 Bacteria 1205
297 Ga0207656_10134965 3300025321 Bacteria 1159
298 Ga0207656_10141812 3300025321 Bacteria 1133
299 Ga0207682_10000010 3300025893 Bacteria 85697
300 Ga0207692_10357021 3300025898 Bacteria 902
301 Ga0207642_10045549 3300025899 Bacteria 1948
302 Ga0207642_10246592 3300025899 Bacteria 1011
303 Ga0207688_10009140 3300025901 Bacteria 5397
304 Ga0207680_10004083 3300025903 Bacteria 6899
305 Ga0207680_10040734 3300025903 Bacteria 2705
306 Ga0207680_10466514 3300025903 Bacteria 897
307 Ga0207680_11142325 3300025903 Bacteria 556
308 Ga0207647_10023273 3300025904 Bacteria 4099
309 Ga0207699_10112110 3300025906 Bacteria 1750
310 Ga0207645_10001212 3300025907 Bacteria 21289
311 Ga0207645_10001222 3300025907 Bacteria 21187
312 Ga0207645_10104954 3300025907 Bacteria 1825
313 Ga0207643_10000339 3300025908 Bacteria 31901
314 Ga0207643_10010876 3300025908 Bacteria 4907
315 Ga0207643_10233186 3300025908 Bacteria 1129
316 Ga0207705_10088193 3300025909 Bacteria 2269
317 Ga0207705_10603742 3300025909 Bacteria 853
318 Ga0207705_10626443 3300025909 Bacteria 836
319 Ga0207684_10809514 3300025910 Bacteria 792
320 Ga0207654_10106864 3300025911 Bacteria 1734
321 Ga0207654_10180220 3300025911 Bacteria 1378
322 Ga0207654_10230642 3300025911 Bacteria 1233
323 Ga0207707_10011174 3300025912 Bacteria 7811
324 Ga0207707_10026818 3300025912 Bacteria 5035
325 Ga0207707_10154012 3300025912 Bacteria 2010
326 Ga0207707_10170450 3300025912 Bacteria 1902
327 Ga0207707_10189561 3300025912 Bacteria 1794
328 Ga0207707_10544460 3300025912 Bacteria 987
329 Ga0207707_10690220 3300025912 Bacteria 858
330 Ga0207707_10999100 3300025912 Bacteria 687
331 Ga0207695_10031079 3300025913 Bacteria 5866
332 Ga0207695_10091719 3300025913 Bacteria 3051
333 Ga0207695_10230291 3300025913 Bacteria 1758
334 Ga0207671_10260310 3300025914 Bacteria 1365
335 Ga0207671_10261930 3300025914 Bacteria 1361
336 Ga0207663_10136827 3300025916 Bacteria 1701
337 Ga0207663_10219879 3300025916 Bacteria 1381
338 Ga0207660_10091459 3300025917 Bacteria 2257
339 Ga0207660_10142483 3300025917 Bacteria 1833
340 Ga0207660_10249727 3300025917 Bacteria 1400
341 Ga0207662_10002021 3300025918 Bacteria 10033
342 Ga0207657_10000708 3300025919 Bacteria 35432
343 Ga0207657_10003690 3300025919 Bacteria 16285
344 Ga0207657_10010189 3300025919 Bacteria 9390
345 Ga0207657_10014283 3300025919 Bacteria 7760
346 Ga0207657_10023357 3300025919 Bacteria 5758
347 Ga0207657_10174144 3300025919 Bacteria 1742
348 Ga0207649_10007330 3300025920 Bacteria 6002
349 Ga0207649_10008352 3300025920 Bacteria 5643
350 Ga0207649_10126162 3300025920 Bacteria 1732
351 Ga0207649_10219535 3300025920 Bacteria 1353
352 Ga0207652_10011154 3300025921 Bacteria 7245
353 Ga0207652_10113159 3300025921 Bacteria 2409
354 Ga0207652_10114438 3300025921 Bacteria 2395
355 Ga0207652_10404535 3300025921 Bacteria 1232
356 Ga0207652_10545315 3300025921 Bacteria 1042
357 Ga0207652_10549348 3300025921 Bacteria 1038
358 Ga0207681_10004098 3300025923 Bacteria 9030
359 Ga0207681_10060188 3300025923 Bacteria 2606
360 Ga0207694_10247700 3300025924 Bacteria 1457
361 Ga0207694_10375033 3300025924 Bacteria 1180
362 Ga0207650_10008074 3300025925 Bacteria 7172
363 Ga0207650_10098254 3300025925 Bacteria 2249
364 Ga0207650_10199489 3300025925 Unclassified 1602
365 Ga0207650_10369961 3300025925 Bacteria 1182
366 Ga0207650_10733131 3300025925 Bacteria 836
367 Ga0207659_10002127 3300025926 Bacteria 11741
368 Ga0207659_10029352 3300025926 Bacteria 3748
369 Ga0207687_10453432 3300025927 Bacteria 1064
370 Ga0207700_10299043 3300025928 Bacteria 1389
371 Ga0207664_10015101 3300025929 Bacteria 5595
372 Ga0207664_10034664 3300025929 Bacteria 3888
373 Ga0207664_10041829 3300025929 Bacteria 3572
374 Ga0207644_10003938 3300025931 Bacteria 9632
375 Ga0207644_10014150 3300025931 Bacteria 5336
376 Ga0207644_10029083 3300025931 Bacteria 3830
377 Ga0207644_10235335 3300025931 Bacteria 1457
378 Ga0207690_10001716 3300025932 Bacteria 13456
379 Ga0207690_10094870 3300025932 Bacteria 2118
380 Ga0207690_10144241 3300025932 Bacteria 1758
381 Ga0207690_10172527 3300025932 Bacteria 1621
382 Ga0207690_10178032 3300025932 Bacteria 1599
383 Ga0207690_10355438 3300025932 Bacteria 1159
384 Ga0207690_10380771 3300025932 Bacteria 1121
385 Ga0207706_10000133 3300025933 Bacteria 80935
386 Ga0207706_10033148 3300025933 Bacteria 4598
387 Ga0207706_10054691 3300025933 Bacteria 3522
388 Ga0207706_10096130 3300025933 Bacteria 2605
389 Ga0207670_10006864 3300025936 Bacteria 6333
390 Ga0207669_10002496 3300025937 Bacteria 7849
391 Ga0207704_10002146 3300025938 Bacteria 8842
392 Ga0207691_10000170 3300025940 Bacteria 60463
393 Ga0207691_10000856 3300025940 Bacteria 30200
394 Ga0207691_10007017 3300025940 Bacteria 10867
395 Ga0207691_10033757 3300025940 Bacteria 4764
396 Ga0207691_10194763 3300025940 Bacteria 1766
397 Ga0207711_10002653 3300025941 Bacteria 15812
398 Ga0207711_10011403 3300025941 Bacteria 7386
399 Ga0207689_10000236 3300025942 Bacteria 49281
400 Ga0207689_10003037 3300025942 Bacteria 15469
401 Ga0207661_10018568 3300025944 Bacteria 5168
402 Ga0207661_10089564 3300025944 Bacteria 2560
403 Ga0207679_10002499 3300025945 Bacteria 11318
404 Ga0207679_10014127 3300025945 Bacteria 5243
405 Ga0207679_10031512 3300025945 Bacteria 3711
406 Ga0207679_10075861 3300025945 Bacteria 2553
407 Ga0207679_10100619 3300025945 Bacteria 2259
408 Ga0207679_10130749 3300025945 Bacteria 2013
409 Ga0207679_10508463 3300025945 Bacteria 1076
410 Ga0207679_10993161 3300025945 Bacteria 769
411 Ga0207679_11353653 3300025945 Bacteria 653
412 Ga0207667_10000842 3300025949 Bacteria 39549
413 Ga0207667_10055675 3300025949 Bacteria 4157
414 Ga0207667_10064662 3300025949 Bacteria 3818
415 Ga0207667_10214562 3300025949 Bacteria 1972
416 Ga0207667_10250264 3300025949 Bacteria 1812
417 Ga0207667_10392936 3300025949 Bacteria 1412
418 Ga0207667_10656185 3300025949 Bacteria 1054
419 Ga0207651_10035355 3300025960 Bacteria 3247
420 Ga0207651_10985404 3300025960 Bacteria 753
421 Ga0207651_11424214 3300025960 Bacteria 624
422 Ga0207668_10003080 3300025972 Bacteria 9776
423 Ga0207640_10055618 3300025981 Bacteria 2593
424 Ga0207640_10063995 3300025981 Bacteria 2447
425 Ga0207640_10149602 3300025981 Bacteria 1713
426 Ga0207640_10356211 3300025981 Bacteria 1177
427 Ga0207640_10806441 3300025981 Bacteria 814
428 Ga0207658_10004449 3300025986 Bacteria 9745
429 Ga0207658_10021041 3300025986 Bacteria 4523
430 Ga0207658_10459824 3300025986 Bacteria 1128
431 Ga0207677_10005466 3300026023 Bacteria 6896
432 Ga0207677_10097806 3300026023 Bacteria 2151
433 Ga0207677_10153839 3300026023 Bacteria 1778
434 Ga0207703_10003353 3300026035 Bacteria 13453
435 Ga0207703_10108962 3300026035 Bacteria 2360
436 Ga0207639_10003306 3300026041 Bacteria 10852
437 Ga0207639_10053019 3300026041 Bacteria 3093
438 Ga0207639_10256481 3300026041 Bacteria 1527
439 Ga0207639_10416802 3300026041 Bacteria 1213
440 Ga0207678_10001121 3300026067 Bacteria 24571
441 Ga0207678_10001129 3300026067 Bacteria 24466
442 Ga0207678_10003812 3300026067 Bacteria 13569
443 Ga0207678_10081231 3300026067 Bacteria 2774
444 Ga0207678_10293631 3300026067 Bacteria 1396
445 Ga0207708_10001142 3300026075 Bacteria 19955
446 Ga0207708_10779664 3300026075 Bacteria 822
447 Ga0207702_10003101 3300026078 Bacteria 15414
448 Ga0207702_10006833 3300026078 Bacteria 9785
449 Ga0207702_10026811 3300026078 Bacteria 4784
450 Ga0207702_10043978 3300026078 Bacteria 3752
451 Ga0207702_10054365 3300026078 Bacteria 3393
452 Ga0207702_10542452 3300026078 Bacteria 1137
453 Ga0207702_10707012 3300026078 Bacteria 993
454 Ga0207641_10004021 3300026088 Bacteria 12833
455 Ga0207641_10387273 3300026088 Bacteria 1340
456 Ga0207648_10000203 3300026089 Bacteria 63192
457 Ga0207648_10004638 3300026089 Bacteria 14072
458 Ga0207648_10400377 3300026089 Bacteria 1244
459 Ga0207676_10009806 3300026095 Bacteria 6811
460 Ga0207676_10041440 3300026095 Bacteria 3534
461 Ga0207676_10873095 3300026095 Bacteria 881
462 Ga0207674_10000182 3300026116 Bacteria 77228
463 Ga0207674_10003596 3300026116 Bacteria 18901
464 Ga0207674_10003869 3300026116 Bacteria 18251
465 Ga0207674_10050678 3300026116 Bacteria 4240
466 Ga0207674_10131068 3300026116 Bacteria 2470
467 Ga0207674_10136113 3300026116 Bacteria 2418
468 Ga0207674_11081083 3300026116 Bacteria 771
469 Ga0207675_100000778 3300026118 Bacteria 31816
470 Ga0207675_100139819 3300026118 Bacteria 2300
471 Ga0207683_10000428 3300026121 Bacteria 38922
472 Ga0207683_10006316 3300026121 Bacteria 10151
473 Ga0207683_10006980 3300026121 Bacteria 9681
474 Ga0207683_11812115 3300026121 Bacteria 559
475 Ga0207698_10007390 3300026142 Bacteria 6883
476 Ga0207698_10064370 3300026142 Bacteria 2874
477 Ga0207698_10093838 3300026142 Bacteria 2465
478 Ga0207698_10184858 3300026142 Bacteria 1850
479 Ga0207698_10302432 3300026142 Bacteria 1490
480 Ga0207698_10453713 3300026142 Bacteria 1238
481 Ga0209984_1012580 3300027424 Bacteria 1104
482 Ga0209995_1002596 3300027471 Bacteria 2856
483 Ga0209982_1028217 3300027552 Bacteria 878
484 Ga0209971_1000786 3300027682 Bacteria 8175
485 Ga0209971_1003145 3300027682 Bacteria 3943
486 Ga0209998_10013992 3300027717 Bacteria 1674
487 Ga0209974_10020735 3300027876 Bacteria 2178
488 Ga0207428_10181538 3300027907 Bacteria 1590
489 Ga0268266_10013867 3300028379 Bacteria 6938
490 Ga0268266_10023138 3300028379 Bacteria 5289
491 Ga0268264_10005632 3300028381 Bacteria 10612
492 Ga0268264_10730570 3300028381 Bacteria 985
493 Ga0307408_100003056 3300031548 Bacteria 11553
494 Ga0307405_10005591 3300031731 Bacteria 6078
495 Ga0307405_10066790 3300031731 Bacteria 2294
496 Ga0307413_10032300 3300031824 Bacteria 2966
497 Ga0307413_10056747 3300031824 Bacteria 2390
498 Ga0307410_10001203 3300031852 Bacteria 11485
499 Ga0307410_10217434 3300031852 Bacteria 1468
500 Ga0307406_10010877 3300031901 Bacteria 5144
501 Ga0307407_10000203 3300031903 Bacteria 18046
502 Ga0307407_10207662 3300031903 Bacteria 1316
503 Ga0307412_10011210 3300031911 Bacteria 5186
504 Ga0307412_10150964 3300031911 Bacteria 1714
505 Ga0307409_100019726 3300031995 Bacteria 4574
506 Ga0307409_100410711 3300031995 Bacteria 1296
507 Ga0307416_100001590 3300032002 Bacteria 12467
508 Ga0307416_100002228 3300032002 Bacteria 11029
509 Ga0307416_101706426 3300032002 Bacteria 734
510 Ga0307414_10189685 3300032004 Bacteria 1662
511 Ga0307411_10004280 3300032005 Bacteria 6809
512 Ga0307411_10008858 3300032005 Bacteria 5244
513 Ga0307415_100003471 3300032126 Bacteria 8034
514 Ga0307415_100008758 3300032126 Bacteria 5630
515 Ga0373948_0048233 3300034817 Bacteria 909
516 Ga0373954_0137809 3300035118 Bacteria 1190
517 Ga0373943_0068446 3300035170 Bacteria 1792
518 Ga0373955_0201730 3300035172 Bacteria 1184
519 Ga0373955_0550498 3300035172 Bacteria 706
520 Ga0373955_0601492 3300035172 Bacteria 673
521 Ga0373942_0134447 3300035207 Bacteria 783
522 Ga0373931_0019306 3300035691 Bacteria 3402
523 Ga0373931_0201978 3300035691 Bacteria 1188
524 Ga0373931_0453851 3300035691 Bacteria 820
525 Ga0373937_0112656 3300036401 Bacteria 2531
526 Ga0373937_0140755 3300036401 Bacteria 2257
527 Ga0395899_0123580 3300037312 Bacteria 1852
528 Ga0395900_0116142 3300037418 Bacteria 2746
529 Ga0395900_0872057 3300037418 Bacteria 825
530 Ga0395898_0072294 3300037466 Bacteria 3332
531 Ga0395905_0439204 3300037471 Bacteria 1202
532 Ga0395901_0139202 3300038443 Bacteria 2551
533 Ga0450889_010903 3300042144 Bacteria 941
534 Ga0439464_0080170 3300042439 Bacteria 974
535 Ga0466963_0409914 3300044694 Bacteria 956
536 Ga0466957_0960237 3300044842 Bacteria 613
537 Ga0495580_0173127 3300046472 Bacteria 1492
538 Ga0495580_0242374 3300046472 Bacteria 1236
539 Ga0495669_0276952 3300046684 Bacteria 807
540 Ga0496100_0620126 3300048903 Bacteria 841
541 Ga0496101_0070730 3300048904 Bacteria 2556
542 Ga0496101_0077721 3300048904 Bacteria 2446
543 Ga0496102_0057587 3300048905 Bacteria 3549
544 Ga0496103_0390054 3300048906 Bacteria 894
545 Ga0496104_0011504 3300048907 Bacteria 7930
546 Ga0496104_0324017 3300048907 Bacteria 1454
547 Ga0496104_1414115 3300048907 Bacteria 599
548 Ga0496106_0017225 3300048909 Bacteria 5349
549 Ga0496106_0030287 3300048909 Bacteria 4036
550 Ga0496106_0359935 3300048909 Bacteria 1169
551 Ga0496107_0016770 3300048910 Bacteria 5149
552 Ga0496107_0044879 3300048910 Bacteria 3178
553 Ga0496108_0003801 3300048911 Bacteria 12089
554 Ga0496108_0139295 3300048911 Bacteria 2090
555 Ga0496108_1543572 3300048911 Bacteria 551
556 Ga0496109_0002100 3300048912 Bacteria 16566
557 Ga0496109_1303194 3300048912 Bacteria 662
558 Ga0496110_0004792 3300048913 Bacteria 10535
559 Ga0496110_0194977 3300048913 Bacteria 1839
560 Ga0496111_0086050 3300048914 Bacteria 2299
561 Ga0496112_0022147 3300048915 Bacteria 6053
562 Ga0496113_0380611 3300048916 Bacteria 1133
563 Ga0496114_0059776 3300048917 Bacteria 3184
564 Ga0501034_0017729 3300049571 Bacteria 7303
565 Ga0501047_0028565 3300049581 Bacteria 5380
566 Ga0501067_0189199 3300049583 Bacteria 1146
567 Ga0501068_0057313 3300049584 Bacteria 2362
568 Ga0501069_0216664 3300049585 Bacteria 1112
569 Ga0501070_0030130 3300049586 Bacteria 4547
570 Ga0501070_1507587 3300049586 Bacteria 509
571 Ga0501072_0004840 3300049588 Bacteria 10252
572 Ga0501073_0006370 3300049589 Bacteria 8785
573 Ga0501074_0164522 3300049590 Bacteria 1584
574 Ga0501080_0007259 3300049742 Bacteria 9998
575 Ga0501083_0011792 3300049744 Bacteria 6125
576 nmdc:mga08y16_61486_c1 3300050511 Bacteria 3922
577 nmdc:mga0n895_640849_c1 3300050512 Bacteria 1062
578 nmdc:mga0n895_81040_c1 3300050512 Bacteria 3234
579 nmdc:mga0rr50_526869_c1 3300050513 Bacteria 1005
580 nmdc:mga0a205_893655_c1 3300050515 Bacteria 735
581 Ga0495595_0135689 3300053084 Bacteria 1205
582 Ga0495619_0415110 3300053085 Bacteria 929
583 Ga0501084_0178794 3300054114 Bacteria 1791

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0123580 Ga0395899_0123580_190_627 132
2 3300037418 Ga0395900_0116142 Ga0395900_0116142_1869_2306 132
3 3300037466 Ga0395898_0072294 Ga0395898_0072294_2533_2970 132
4 3300038443 Ga0395901_0139202 Ga0395901_0139202_1969_2406 132
5 3300025908 Ga0207643_10233186 Ga0207643_102331862 144
6 3300005434 Ga0070709_10065128 Ga0070709_100651282 150
7 3300005437 Ga0070710_10036685 Ga0070710_100366852 150
8 3300005439 Ga0070711_100082826 Ga0070711_1000828264 150
9 3300005458 Ga0070681_10160094 Ga0070681_101600944 150
10 3300005518 Ga0070699_100034428 Ga0070699_1000344283 150
11 3300005546 Ga0070696_100021047 Ga0070696_1000210475 150
12 3300006237 Ga0097621_100251433 Ga0097621_1002514333 150
13 3300009093 Ga0105240_10032172 Ga0105240_100321722 150
14 3300009174 Ga0105241_10364282 Ga0105241_103642822 150
15 3300009545 Ga0105237_10174282 Ga0105237_101742821 150
16 3300013104 Ga0157370_10113544 Ga0157370_101135443 150
17 3300013296 Ga0157374_10169054 Ga0157374_101690543 150
18 3300013307 Ga0157372_10046744 Ga0157372_100467444 150
19 3300025898 Ga0207692_10357021 Ga0207692_103570212 150
20 3300025906 Ga0207699_10112110 Ga0207699_101121101 150
21 3300025916 Ga0207663_10136827 Ga0207663_101368272 150
22 3300025928 Ga0207700_10299043 Ga0207700_102990431 150
23 3300025929 Ga0207664_10041829 Ga0207664_100418296 150
24 3300027424 Ga0209984_1012580 Ga0209984_10125802 150
25 3300027471 Ga0209995_1002596 Ga0209995_10025962 150
26 3300027682 Ga0209971_1000786 Ga0209971_10007863 150
27 3300027717 Ga0209998_10013992 Ga0209998_100139923 150
28 3300048907 Ga0496104_0324017 Ga0496104_0324017_258_761 150
29 3300005335 Ga0070666_10019763 Ga0070666_100197631 151
30 3300005338 Ga0068868_100459050 Ga0068868_1004590502 151
31 3300005356 Ga0070674_100009506 Ga0070674_1000095065 151
32 3300005364 Ga0070673_100970421 Ga0070673_1009704212 151
33 3300005367 Ga0070667_100031601 Ga0070667_1000316015 151
34 3300005456 Ga0070678_100005330 Ga0070678_1000053304 151
35 3300005543 Ga0070672_100031429 Ga0070672_1000314293 151
36 3300005548 Ga0070665_100064945 Ga0070665_1000649454 151
37 3300005718 Ga0068866_10128591 Ga0068866_101285912 151
38 3300006237 Ga0097621_100044991 Ga0097621_1000449915 151
39 3300006358 Ga0068871_100020681 Ga0068871_1000206816 151
40 3300013296 Ga0157374_10292891 Ga0157374_102928912 151
41 3300013308 Ga0157375_10516061 Ga0157375_105160612 151
42 3300014969 Ga0157376_10019347 Ga0157376_100193474 151
43 3300025903 Ga0207680_10040734 Ga0207680_100407343 151
44 3300025927 Ga0207687_10453432 Ga0207687_104534321 151
45 3300025940 Ga0207691_10033757 Ga0207691_100337575 151
46 3300025960 Ga0207651_10985404 Ga0207651_109854041 151
47 3300025986 Ga0207658_10021041 Ga0207658_100210415 151
48 3300026121 Ga0207683_10006316 Ga0207683_100063166 151
49 3300028379 Ga0268266_10013867 Ga0268266_100138678 151
50 3300035118 Ga0373954_0137809 Ga0373954_0137809_128_631 151
51 3300035172 Ga0373955_0201730 Ga0373955_0201730_490_993 151
52 3300005458 Ga0070681_10555821 Ga0070681_105558211 154
53 3300005563 Ga0068855_101122397 Ga0068855_1011223972 154
54 3300005578 Ga0068854_100726874 Ga0068854_1007268742 154
55 3300013100 Ga0157373_10476285 Ga0157373_104762852 154
56 3300025912 Ga0207707_10189561 Ga0207707_101895611 154
57 3300025981 Ga0207640_10806441 Ga0207640_108064411 154
58 3300049583 Ga0501067_0189199 Ga0501067_0189199_382_855 154
59 3300031731 Ga0307405_10005591 Ga0307405_100055913 155
60 3300031852 Ga0307410_10001203 Ga0307410_100012036 155
61 3300031903 Ga0307407_10000203 Ga0307407_1000020312 155
62 3300031911 Ga0307412_10011210 Ga0307412_100112103 155
63 3300031995 Ga0307409_100410711 Ga0307409_1004107113 155
64 3300032002 Ga0307416_100001590 Ga0307416_1000015904 155
65 3300032005 Ga0307411_10004280 Ga0307411_100042803 155
66 3300032126 Ga0307415_100003471 Ga0307415_1000034715 155
67 3300035691 Ga0373931_0019306 Ga0373931_0019306_570_1070 155
68 3300044694 Ga0466963_0409914 Ga0466963_0409914_16_528 155
69 3300049571 Ga0501034_0017729 Ga0501034_0017729_3850_4329 155
70 3300049581 Ga0501047_0028565 Ga0501047_0028565_2837_3316 155
71 3300049584 Ga0501068_0057313 Ga0501068_0057313_54_533 155
72 3300049585 Ga0501069_0216664 Ga0501069_0216664_526_1005 155
73 3300049586 Ga0501070_0030130 Ga0501070_0030130_1162_1641 155
74 3300049586 Ga0501070_1507587 Ga0501070_1507587_17_496 155
75 3300049588 Ga0501072_0004840 Ga0501072_0004840_2571_3050 155
76 3300049589 Ga0501073_0006370 Ga0501073_0006370_3572_4051 155
77 3300049590 Ga0501074_0164522 Ga0501074_0164522_880_1359 155
78 3300049742 Ga0501080_0007259 Ga0501080_0007259_2007_2486 155
79 3300049744 Ga0501083_0011792 Ga0501083_0011792_1945_2424 155
80 3300054114 Ga0501084_0178794 Ga0501084_0178794_407_886 155
81 3300026078 Ga0207702_10542452 Ga0207702_105424522 156
82 3300027552 Ga0209982_1028217 Ga0209982_10282172 157
83 3300005330 Ga0070690_100023121 Ga0070690_1000231213 158
84 3300014497 Ga0182008_10263546 Ga0182008_102635462 159
85 3300031824 Ga0307413_10032300 Ga0307413_100323005 159
86 3300031852 Ga0307410_10217434 Ga0307410_102174342 159
87 3300032002 Ga0307416_101706426 Ga0307416_1017064262 159
88 3300032004 Ga0307414_10189685 Ga0307414_101896853 159
89 3300010375 Ga0105239_10571229 Ga0105239_105712293 160
90 3300013307 Ga0157372_10974071 Ga0157372_109740712 160
91 3300035172 Ga0373955_0550498 Ga0373955_0550498_55_540 160
92 3300035172 Ga0373955_0601492 Ga0373955_0601492_78_566 160
93 3300036401 Ga0373937_0112656 Ga0373937_0112656_77_565 160
94 3300005329 Ga0070683_100013983 Ga0070683_1000139834 161
95 3300005344 Ga0070661_100001471 Ga0070661_10000147115 161
96 3300005366 Ga0070659_100115990 Ga0070659_1001159903 161
97 3300005435 Ga0070714_100014951 Ga0070714_1000149514 161
98 3300005457 Ga0070662_100777455 Ga0070662_1007774551 161
99 3300005530 Ga0070679_100044282 Ga0070679_1000442824 161
100 3300005535 Ga0070684_100072246 Ga0070684_1000722463 161
101 3300005539 Ga0068853_100020039 Ga0068853_1000200394 161
102 3300005547 Ga0070693_100084621 Ga0070693_1000846213 161
103 3300005577 Ga0068857_100000465 Ga0068857_10000046523 161
104 3300005616 Ga0068852_100016442 Ga0068852_1000164425 161
105 3300009093 Ga0105240_10014137 Ga0105240_100141378 161
106 3300009174 Ga0105241_10146102 Ga0105241_101461023 161
107 3300009545 Ga0105237_10340953 Ga0105237_103409533 161
108 3300009551 Ga0105238_10000495 Ga0105238_1000049513 161
109 3300010375 Ga0105239_10301609 Ga0105239_103016093 161
110 3300013104 Ga0157370_10025794 Ga0157370_100257943 161
111 3300013307 Ga0157372_10008814 Ga0157372_1000881410 161
112 3300014497 Ga0182008_10062675 Ga0182008_100626753 161
113 3300025911 Ga0207654_10106864 Ga0207654_101068643 161
114 3300025912 Ga0207707_10170450 Ga0207707_101704503 161
115 3300025913 Ga0207695_10031079 Ga0207695_100310794 161
116 3300025914 Ga0207671_10261930 Ga0207671_102619303 161
117 3300025920 Ga0207649_10126162 Ga0207649_101261622 161
118 3300025921 Ga0207652_10113159 Ga0207652_101131594 161
119 3300025924 Ga0207694_10247700 Ga0207694_102477001 161
120 3300025929 Ga0207664_10015101 Ga0207664_100151014 161
121 3300025932 Ga0207690_10144241 Ga0207690_101442412 161
122 3300025944 Ga0207661_10018568 Ga0207661_100185687 161
123 3300025949 Ga0207667_10000842 Ga0207667_1000084234 161
124 3300025981 Ga0207640_10063995 Ga0207640_100639955 161
125 3300026041 Ga0207639_10053019 Ga0207639_100530195 161
126 3300026078 Ga0207702_10006833 Ga0207702_1000683310 161
127 3300026116 Ga0207674_10000182 Ga0207674_1000018232 161
128 3300026142 Ga0207698_10007390 Ga0207698_100073904 161
129 3300048916 Ga0496113_0380611 Ga0496113_0380611_56_565 161
130 3300005564 Ga0070664_100330583 Ga0070664_1003305833 163
131 3300005577 Ga0068857_100156898 Ga0068857_1001568984 163
132 3300005616 Ga0068852_100177535 Ga0068852_1001775353 163
133 3300013105 Ga0157369_10665000 Ga0157369_106650003 163
134 3300014969 Ga0157376_12519627 Ga0157376_125196271 163
135 3300025945 Ga0207679_10014127 Ga0207679_100141277 163
136 3300026116 Ga0207674_10131068 Ga0207674_101310682 163
137 3300048911 Ga0496108_1543572 Ga0496108_1543572_39_530 163
138 3300048912 Ga0496109_1303194 Ga0496109_1303194_51_542 163
139 3300048915 Ga0496112_0022147 Ga0496112_0022147_652_1143 163
140 3300053085 Ga0495619_0415110 Ga0495619_0415110_52_546 163
141 3300005329 Ga0070683_101222202 Ga0070683_1012222021 164
142 3300005331 Ga0070670_100042370 Ga0070670_1000423702 164
143 3300005331 Ga0070670_100222608 Ga0070670_1002226082 164
144 3300005334 Ga0068869_100003831 Ga0068869_1000038313 164
145 3300005335 Ga0070666_10002948 Ga0070666_100029485 164
146 3300005338 Ga0068868_100003299 Ga0068868_1000032995 164
147 3300005339 Ga0070660_100013791 Ga0070660_1000137915 164
148 3300005344 Ga0070661_100033740 Ga0070661_1000337404 164
149 3300005347 Ga0070668_100001131 Ga0070668_10000113117 164
150 3300005353 Ga0070669_100005744 Ga0070669_1000057444 164
151 3300005354 Ga0070675_100012131 Ga0070675_1000121313 164
152 3300005355 Ga0070671_100004532 Ga0070671_1000045329 164
153 3300005355 Ga0070671_100010513 Ga0070671_1000105136 164
154 3300005356 Ga0070674_100003089 Ga0070674_1000030894 164
155 3300005364 Ga0070673_100024376 Ga0070673_1000243765 164
156 3300005365 Ga0070688_100029185 Ga0070688_1000291854 164
157 3300005366 Ga0070659_100004569 Ga0070659_1000045696 164
158 3300005367 Ga0070667_100047276 Ga0070667_1000472763 164
159 3300005445 Ga0070708_100000731 Ga0070708_10000073111 164
160 3300005455 Ga0070663_100034726 Ga0070663_1000347262 164
161 3300005455 Ga0070663_100276822 Ga0070663_1002768222 164
162 3300005456 Ga0070678_100000550 Ga0070678_1000005504 164
163 3300005457 Ga0070662_100003464 Ga0070662_1000034649 164
164 3300005458 Ga0070681_10234749 Ga0070681_102347493 164
165 3300005459 Ga0068867_100001145 Ga0068867_10000114516 164
166 3300005466 Ga0070685_10017469 Ga0070685_100174693 164
167 3300005518 Ga0070699_100622173 Ga0070699_1006221732 164
168 3300005539 Ga0068853_100029634 Ga0068853_1000296343 164
169 3300005543 Ga0070672_100001458 Ga0070672_10000145810 164
170 3300005543 Ga0070672_100189319 Ga0070672_1001893193 164
171 3300005548 Ga0070665_100001395 Ga0070665_1000013959 164
172 3300005564 Ga0070664_100022377 Ga0070664_1000223772 164
173 3300005614 Ga0068856_100000125 Ga0068856_1000001252 164
174 3300005615 Ga0070702_100338405 Ga0070702_1003384051 164
175 3300005616 Ga0068852_100325817 Ga0068852_1003258173 164
176 3300005617 Ga0068859_100005307 Ga0068859_1000053079 164
177 3300005618 Ga0068864_100007610 Ga0068864_1000076109 164
178 3300005718 Ga0068866_10359268 Ga0068866_103592682 164
179 3300005719 Ga0068861_100240334 Ga0068861_1002403342 164
180 3300005834 Ga0068851_10041195 Ga0068851_100411953 164
181 3300005840 Ga0068870_10060990 Ga0068870_100609902 164
182 3300005842 Ga0068858_100005787 Ga0068858_1000057876 164
183 3300005843 Ga0068860_100010721 Ga0068860_1000107214 164
184 3300006237 Ga0097621_100002227 Ga0097621_10000222711 164
185 3300006358 Ga0068871_100011822 Ga0068871_1000118224 164
186 3300006881 Ga0068865_100003988 Ga0068865_1000039884 164
187 3300006931 Ga0097620_100005307 Ga0097620_1000053079 164
188 3300009098 Ga0105245_10063107 Ga0105245_100631073 164
189 3300009177 Ga0105248_10017740 Ga0105248_100177408 164
190 3300009553 Ga0105249_10175316 Ga0105249_101753162 164
191 3300010375 Ga0105239_10433722 Ga0105239_104337223 164
192 3300013100 Ga0157373_10003939 Ga0157373_100039396 164
193 3300013102 Ga0157371_10001964 Ga0157371_1000196411 164
194 3300013105 Ga0157369_10169453 Ga0157369_101694532 164
195 3300013296 Ga0157374_10005777 Ga0157374_100057779 164
196 3300013297 Ga0157378_10670215 Ga0157378_106702153 164
197 3300013306 Ga0163162_10008638 Ga0163162_100086389 164
198 3300013306 Ga0163162_10596167 Ga0163162_105961672 164
199 3300013307 Ga0157372_10003272 Ga0157372_1000327215 164
200 3300013308 Ga0157375_10017367 Ga0157375_100173674 164
201 3300013308 Ga0157375_12114494 Ga0157375_121144942 164
202 3300014326 Ga0157380_10552358 Ga0157380_105523583 164
203 3300014968 Ga0157379_10006361 Ga0157379_100063615 164
204 3300017792 Ga0163161_10072192 Ga0163161_100721924 164
205 3300025321 Ga0207656_10134965 Ga0207656_101349651 164
206 3300025321 Ga0207656_10141812 Ga0207656_101418121 164
207 3300025899 Ga0207642_10246592 Ga0207642_102465922 164
208 3300025903 Ga0207680_10004083 Ga0207680_100040837 164
209 3300025907 Ga0207645_10001212 Ga0207645_1000121216 164
210 3300025907 Ga0207645_10104954 Ga0207645_101049543 164
211 3300025908 Ga0207643_10010876 Ga0207643_100108767 164
212 3300025912 Ga0207707_10154012 Ga0207707_101540122 164
213 3300025919 Ga0207657_10023357 Ga0207657_100233575 164
214 3300025920 Ga0207649_10007330 Ga0207649_100073305 164
215 3300025923 Ga0207681_10004098 Ga0207681_100040989 164
216 3300025925 Ga0207650_10008074 Ga0207650_100080748 164
217 3300025925 Ga0207650_10098254 Ga0207650_100982543 164
218 3300025926 Ga0207659_10002127 Ga0207659_1000212710 164
219 3300025926 Ga0207659_10029352 Ga0207659_100293524 164
220 3300025931 Ga0207644_10014150 Ga0207644_100141505 164
221 3300025932 Ga0207690_10001716 Ga0207690_1000171612 164
222 3300025933 Ga0207706_10000133 Ga0207706_1000013333 164
223 3300025937 Ga0207669_10002496 Ga0207669_100024964 164
224 3300025938 Ga0207704_10002146 Ga0207704_100021463 164
225 3300025940 Ga0207691_10000170 Ga0207691_1000017036 164
226 3300025940 Ga0207691_10194763 Ga0207691_101947632 164
227 3300025941 Ga0207711_10011403 Ga0207711_100114033 164
228 3300025942 Ga0207689_10003037 Ga0207689_100030379 164
229 3300025945 Ga0207679_10002499 Ga0207679_1000249912 164
230 3300025949 Ga0207667_10055675 Ga0207667_100556756 164
231 3300025960 Ga0207651_10035355 Ga0207651_100353553 164
232 3300025972 Ga0207668_10003080 Ga0207668_100030806 164
233 3300025986 Ga0207658_10004449 Ga0207658_100044496 164
234 3300026023 Ga0207677_10005466 Ga0207677_100054666 164
235 3300026035 Ga0207703_10003353 Ga0207703_1000335311 164
236 3300026041 Ga0207639_10003306 Ga0207639_100033065 164
237 3300026067 Ga0207678_10001121 Ga0207678_100011217 164
238 3300026075 Ga0207708_10779664 Ga0207708_107796642 164
239 3300026078 Ga0207702_10003101 Ga0207702_1000310112 164
240 3300026088 Ga0207641_10004021 Ga0207641_100040213 164
241 3300026088 Ga0207641_10387273 Ga0207641_103872732 164
242 3300026089 Ga0207648_10000203 Ga0207648_1000020329 164
243 3300026095 Ga0207676_10009806 Ga0207676_100098064 164
244 3300026118 Ga0207675_100139819 Ga0207675_1001398193 164
245 3300026121 Ga0207683_10000428 Ga0207683_1000042816 164
246 3300026142 Ga0207698_10064370 Ga0207698_100643705 164
247 3300028379 Ga0268266_10023138 Ga0268266_100231384 164
248 3300028381 Ga0268264_10005632 Ga0268264_100056323 164
249 3300035207 Ga0373942_0134447 Ga0373942_0134447_76_579 164
250 3300035691 Ga0373931_0453851 Ga0373931_0453851_11_517 164
251 3300048904 Ga0496101_0070730 Ga0496101_0070730_634_1131 164
252 3300048906 Ga0496103_0390054 Ga0496103_0390054_229_735 164
253 3300048907 Ga0496104_1414115 Ga0496104_1414115_36_542 164
254 3300048909 Ga0496106_0017225 Ga0496106_0017225_3992_4498 164
255 3300048909 Ga0496106_0359935 Ga0496106_0359935_621_1118 164
256 3300048910 Ga0496107_0016770 Ga0496107_0016770_2312_2818 164
257 3300048911 Ga0496108_0139295 Ga0496108_0139295_1273_1770 164
258 3300048913 Ga0496110_0194977 Ga0496110_0194977_130_627 164
259 3300005355 Ga0070671_100401577 Ga0070671_1004015772 165
260 3300025931 Ga0207644_10235335 Ga0207644_102353353 165
261 3300026041 Ga0207639_10256481 Ga0207639_102564813 165
262 3300050513 nmdc:mga0rr50_526869_c1 nmdc:mga0rr50_526869_c1_65_568 165
263 3300001976 JGI24752J21851_1002390 JGI24752J21851_10023904 166
264 3300001991 JGI24743J22301_10004644 JGI24743J22301_100046443 166
265 3300002076 JGI24749J21850_1005128 JGI24749J21850_10051283 166
266 3300002126 JGI24035J26624_1002883 JGI24035J26624_10028832 166
267 3300005290 Ga0065712_10091630 Ga0065712_100916303 166
268 3300005293 Ga0065715_10140802 Ga0065715_101408023 166
269 3300005327 Ga0070658_10003752 Ga0070658_100037529 166
270 3300005327 Ga0070658_10138820 Ga0070658_101388203 166
271 3300005327 Ga0070658_10214452 Ga0070658_102144522 166
272 3300005329 Ga0070683_100190181 Ga0070683_1001901812 166
273 3300005329 Ga0070683_100231789 Ga0070683_1002317892 166
274 3300005329 Ga0070683_100369848 Ga0070683_1003698482 166
275 3300005330 Ga0070690_100015636 Ga0070690_1000156366 166
276 3300005331 Ga0070670_100066203 Ga0070670_1000662035 166
277 3300005331 Ga0070670_100119753 Ga0070670_1001197534 166
278 3300005333 Ga0070677_10022140 Ga0070677_100221403 166
279 3300005334 Ga0068869_100039952 Ga0068869_1000399521 166
280 3300005334 Ga0068869_100839054 Ga0068869_1008390541 166
281 3300005335 Ga0070666_10207090 Ga0070666_102070902 166
282 3300005335 Ga0070666_10251540 Ga0070666_102515402 166
283 3300005336 Ga0070680_100027835 Ga0070680_1000278354 166
284 3300005337 Ga0070682_100903059 Ga0070682_1009030591 166
285 3300005338 Ga0068868_100146109 Ga0068868_1001461093 166
286 3300005339 Ga0070660_100053089 Ga0070660_1000530891 166
287 3300005339 Ga0070660_100059225 Ga0070660_1000592255 166
288 3300005339 Ga0070660_100114916 Ga0070660_1001149161 166
289 3300005339 Ga0070660_100161784 Ga0070660_1001617844 166
290 3300005339 Ga0070660_100309531 Ga0070660_1003095312 166
291 3300005339 Ga0070660_100777524 Ga0070660_1007775241 166
292 3300005340 Ga0070689_100002823 Ga0070689_10000282311 166
293 3300005341 Ga0070691_10245292 Ga0070691_102452922 166
294 3300005344 Ga0070661_100058684 Ga0070661_1000586845 166
295 3300005344 Ga0070661_100069378 Ga0070661_1000693784 166
296 3300005344 Ga0070661_100117706 Ga0070661_1001177063 166
297 3300005344 Ga0070661_100180123 Ga0070661_1001801232 166
298 3300005353 Ga0070669_100107964 Ga0070669_1001079643 166
299 3300005353 Ga0070669_100625899 Ga0070669_1006258991 166
300 3300005354 Ga0070675_100222891 Ga0070675_1002228913 166
301 3300005354 Ga0070675_100292175 Ga0070675_1002921753 166
302 3300005355 Ga0070671_100007222 Ga0070671_10000722210 166
303 3300005355 Ga0070671_100179292 Ga0070671_1001792923 166
304 3300005356 Ga0070674_100028420 Ga0070674_1000284204 166
305 3300005364 Ga0070673_100137778 Ga0070673_1001377783 166
306 3300005364 Ga0070673_100238090 Ga0070673_1002380902 166
307 3300005364 Ga0070673_101607106 Ga0070673_1016071061 166
308 3300005365 Ga0070688_100001955 Ga0070688_1000019554 166
309 3300005366 Ga0070659_100019993 Ga0070659_1000199936 166
310 3300005366 Ga0070659_100036791 Ga0070659_1000367916 166
311 3300005366 Ga0070659_100043306 Ga0070659_1000433063 166
312 3300005366 Ga0070659_100106858 Ga0070659_1001068584 166
313 3300005366 Ga0070659_100146686 Ga0070659_1001466862 166
314 3300005366 Ga0070659_100147610 Ga0070659_1001476103 166
315 3300005366 Ga0070659_100517925 Ga0070659_1005179251 166
316 3300005367 Ga0070667_100171093 Ga0070667_1001710934 166
317 3300005434 Ga0070709_10060146 Ga0070709_100601463 166
318 3300005434 Ga0070709_10393969 Ga0070709_103939691 166
319 3300005435 Ga0070714_100019491 Ga0070714_1000194914 166
320 3300005435 Ga0070714_100508328 Ga0070714_1005083281 166
321 3300005435 Ga0070714_100535891 Ga0070714_1005358912 166
322 3300005439 Ga0070711_100214405 Ga0070711_1002144053 166
323 3300005441 Ga0070700_100008699 Ga0070700_1000086994 166
324 3300005457 Ga0070662_100080518 Ga0070662_1000805181 166
325 3300005458 Ga0070681_10007825 Ga0070681_1000782513 166
326 3300005458 Ga0070681_10711777 Ga0070681_107117772 166
327 3300005458 Ga0070681_10871204 Ga0070681_108712042 166
328 3300005459 Ga0068867_100341082 Ga0068867_1003410822 166
329 3300005466 Ga0070685_10007504 Ga0070685_100075045 166
330 3300005530 Ga0070679_100031289 Ga0070679_1000312892 166
331 3300005530 Ga0070679_100038137 Ga0070679_1000381375 166
332 3300005530 Ga0070679_100040034 Ga0070679_1000400342 166
333 3300005530 Ga0070679_100179248 Ga0070679_1001792481 166
334 3300005530 Ga0070679_100466004 Ga0070679_1004660042 166
335 3300005535 Ga0070684_100608165 Ga0070684_1006081652 166
336 3300005539 Ga0068853_100013226 Ga0068853_1000132261 166
337 3300005539 Ga0068853_100127208 Ga0068853_1001272084 166
338 3300005543 Ga0070672_100006692 Ga0070672_1000066926 166
339 3300005544 Ga0070686_100102045 Ga0070686_1001020453 166
340 3300005548 Ga0070665_100083004 Ga0070665_1000830044 166
341 3300005563 Ga0068855_100017552 Ga0068855_1000175526 166
342 3300005563 Ga0068855_100069548 Ga0068855_1000695486 166
343 3300005563 Ga0068855_100125811 Ga0068855_1001258114 166
344 3300005563 Ga0068855_100173260 Ga0068855_1001732602 166
345 3300005563 Ga0068855_100472479 Ga0068855_1004724792 166
346 3300005563 Ga0068855_101252395 Ga0068855_1012523951 166
347 3300005564 Ga0070664_100033744 Ga0070664_1000337443 166
348 3300005564 Ga0070664_100057956 Ga0070664_1000579563 166
349 3300005564 Ga0070664_100104149 Ga0070664_1001041493 166
350 3300005564 Ga0070664_100117485 Ga0070664_1001174852 166
351 3300005564 Ga0070664_100245765 Ga0070664_1002457651 166
352 3300005564 Ga0070664_100641342 Ga0070664_1006413421 166
353 3300005564 Ga0070664_100798204 Ga0070664_1007982042 166
354 3300005577 Ga0068857_100035965 Ga0068857_1000359651 166
355 3300005577 Ga0068857_100160303 Ga0068857_1001603032 166
356 3300005577 Ga0068857_100316065 Ga0068857_1003160653 166
357 3300005578 Ga0068854_100028699 Ga0068854_1000286994 166
358 3300005578 Ga0068854_100416884 Ga0068854_1004168842 166
359 3300005578 Ga0068854_101063692 Ga0068854_1010636922 166
360 3300005614 Ga0068856_100060384 Ga0068856_1000603846 166
361 3300005614 Ga0068856_100105927 Ga0068856_1001059274 166
362 3300005616 Ga0068852_100036370 Ga0068852_1000363706 166
363 3300005616 Ga0068852_100039892 Ga0068852_1000398925 166
364 3300005616 Ga0068852_100247367 Ga0068852_1002473672 166
365 3300005616 Ga0068852_100336827 Ga0068852_1003368272 166
366 3300005616 Ga0068852_100842660 Ga0068852_1008426602 166
367 3300005616 Ga0068852_100877272 Ga0068852_1008772722 166
368 3300005617 Ga0068859_100279055 Ga0068859_1002790553 166
369 3300005618 Ga0068864_100021513 Ga0068864_1000215131 166
370 3300005618 Ga0068864_101388788 Ga0068864_1013887881 166
371 3300005719 Ga0068861_100027250 Ga0068861_1000272502 166
372 3300005834 Ga0068851_10001567 Ga0068851_100015679 166
373 3300005834 Ga0068851_10004364 Ga0068851_100043644 166
374 3300005834 Ga0068851_10018654 Ga0068851_100186545 166
375 3300005834 Ga0068851_10030813 Ga0068851_100308133 166
376 3300005834 Ga0068851_10236518 Ga0068851_102365182 166
377 3300005840 Ga0068870_10178316 Ga0068870_101783163 166
378 3300005842 Ga0068858_100116074 Ga0068858_1001160743 166
379 3300005844 Ga0068862_100024936 Ga0068862_1000249366 166
380 3300005844 Ga0068862_100796358 Ga0068862_1007963582 166
381 3300006173 Ga0070716_100038139 Ga0070716_1000381392 166
382 3300006175 Ga0070712_100265969 Ga0070712_1002659692 166
383 3300006237 Ga0097621_101039698 Ga0097621_1010396981 166
384 3300006237 Ga0097621_101113892 Ga0097621_1011138921 166
385 3300006358 Ga0068871_100117896 Ga0068871_1001178963 166
386 3300006852 Ga0075433_10740576 Ga0075433_107405761 166
387 3300006871 Ga0075434_100140265 Ga0075434_1001402653 166
388 3300006871 Ga0075434_100669387 Ga0075434_1006693872 166
389 3300006931 Ga0097620_100279082 Ga0097620_1002790823 166
390 3300009093 Ga0105240_10308528 Ga0105240_103085283 166
391 3300009094 Ga0111539_10002947 Ga0111539_1000294715 166
392 3300009094 Ga0111539_10485242 Ga0111539_104852423 166
393 3300009148 Ga0105243_10183833 Ga0105243_101838333 166
394 3300009174 Ga0105241_10061671 Ga0105241_100616715 166
395 3300009174 Ga0105241_10397221 Ga0105241_103972213 166
396 3300009177 Ga0105248_10001562 Ga0105248_1000156213 166
397 3300009177 Ga0105248_10789439 Ga0105248_107894392 166
398 3300009545 Ga0105237_10044821 Ga0105237_100448215 166
399 3300009545 Ga0105237_10134500 Ga0105237_101345004 166
400 3300009545 Ga0105237_11883096 Ga0105237_118830961 166
401 3300009551 Ga0105238_10719657 Ga0105238_107196572 166
402 3300009553 Ga0105249_10094719 Ga0105249_100947195 166
403 3300010375 Ga0105239_10195414 Ga0105239_101954141 166
404 3300011119 Ga0105246_11304431 Ga0105246_113044311 166
405 3300013100 Ga0157373_10001602 Ga0157373_1000160217 166
406 3300013100 Ga0157373_10113744 Ga0157373_101137443 166
407 3300013102 Ga0157371_10069943 Ga0157371_100699433 166
408 3300013102 Ga0157371_10330864 Ga0157371_103308641 166
409 3300013104 Ga0157370_10127528 Ga0157370_101275283 166
410 3300013105 Ga0157369_10028044 Ga0157369_100280443 166
411 3300013105 Ga0157369_10430712 Ga0157369_104307123 166
412 3300013105 Ga0157369_11323092 Ga0157369_113230922 166
413 3300013296 Ga0157374_10093490 Ga0157374_100934903 166
414 3300013306 Ga0163162_10389067 Ga0163162_103890672 166
415 3300013307 Ga0157372_10026178 Ga0157372_100261785 166
416 3300013307 Ga0157372_10073874 Ga0157372_100738743 166
417 3300013307 Ga0157372_10179304 Ga0157372_101793042 166
418 3300013307 Ga0157372_10180439 Ga0157372_101804392 166
419 3300013307 Ga0157372_10186020 Ga0157372_101860202 166
420 3300013307 Ga0157372_10888989 Ga0157372_108889892 166
421 3300013308 Ga0157375_10223311 Ga0157375_102233114 166
422 3300014326 Ga0157380_10003087 Ga0157380_1000308711 166
423 3300014745 Ga0157377_10006265 Ga0157377_100062656 166
424 3300014968 Ga0157379_10403709 Ga0157379_104037093 166
425 3300014969 Ga0157376_10164878 Ga0157376_101648781 166
426 3300017792 Ga0163161_10033638 Ga0163161_100336384 166
427 3300020081 Ga0206354_10077192 Ga0206354_100771923 166
428 3300020082 Ga0206353_10609133 Ga0206353_106091333 166
429 3300025315 Ga0207697_10000331 Ga0207697_1000033111 166
430 3300025321 Ga0207656_10003424 Ga0207656_100034242 166
431 3300025321 Ga0207656_10044679 Ga0207656_100446794 166
432 3300025321 Ga0207656_10056830 Ga0207656_100568303 166
433 3300025321 Ga0207656_10076382 Ga0207656_100763823 166
434 3300025321 Ga0207656_10123975 Ga0207656_101239752 166
435 3300025893 Ga0207682_10000010 Ga0207682_1000001026 166
436 3300025899 Ga0207642_10045549 Ga0207642_100455493 166
437 3300025901 Ga0207688_10009140 Ga0207688_100091405 166
438 3300025903 Ga0207680_10466514 Ga0207680_104665142 166
439 3300025903 Ga0207680_11142325 Ga0207680_111423251 166
440 3300025904 Ga0207647_10023273 Ga0207647_100232734 166
441 3300025907 Ga0207645_10001222 Ga0207645_1000122214 166
442 3300025908 Ga0207643_10000339 Ga0207643_1000033913 166
443 3300025909 Ga0207705_10088193 Ga0207705_100881933 166
444 3300025909 Ga0207705_10603742 Ga0207705_106037421 166
445 3300025909 Ga0207705_10626443 Ga0207705_106264432 166
446 3300025910 Ga0207684_10809514 Ga0207684_108095142 166
447 3300025911 Ga0207654_10180220 Ga0207654_101802203 166
448 3300025911 Ga0207654_10230642 Ga0207654_102306422 166
449 3300025912 Ga0207707_10011174 Ga0207707_1001117410 166
450 3300025912 Ga0207707_10026818 Ga0207707_100268186 166
451 3300025912 Ga0207707_10544460 Ga0207707_105444602 166
452 3300025912 Ga0207707_10690220 Ga0207707_106902202 166
453 3300025912 Ga0207707_10999100 Ga0207707_109991002 166
454 3300025913 Ga0207695_10091719 Ga0207695_100917192 166
455 3300025913 Ga0207695_10230291 Ga0207695_102302912 166
456 3300025914 Ga0207671_10260310 Ga0207671_102603102 166
457 3300025916 Ga0207663_10219879 Ga0207663_102198793 166
458 3300025917 Ga0207660_10091459 Ga0207660_100914594 166
459 3300025917 Ga0207660_10142483 Ga0207660_101424832 166
460 3300025917 Ga0207660_10249727 Ga0207660_102497272 166
461 3300025918 Ga0207662_10002021 Ga0207662_100020215 166
462 3300025919 Ga0207657_10000708 Ga0207657_1000070817 166
463 3300025919 Ga0207657_10003690 Ga0207657_100036905 166
464 3300025919 Ga0207657_10010189 Ga0207657_100101894 166
465 3300025919 Ga0207657_10014283 Ga0207657_100142837 166
466 3300025919 Ga0207657_10174144 Ga0207657_101741443 166
467 3300025920 Ga0207649_10008352 Ga0207649_100083526 166
468 3300025920 Ga0207649_10219535 Ga0207649_102195353 166
469 3300025921 Ga0207652_10011154 Ga0207652_100111542 166
470 3300025921 Ga0207652_10114438 Ga0207652_101144383 166
471 3300025921 Ga0207652_10404535 Ga0207652_104045351 166
472 3300025921 Ga0207652_10545315 Ga0207652_105453152 166
473 3300025921 Ga0207652_10549348 Ga0207652_105493482 166
474 3300025923 Ga0207681_10060188 Ga0207681_100601883 166
475 3300025924 Ga0207694_10375033 Ga0207694_103750332 166
476 3300025925 Ga0207650_10199489 Ga0207650_101994893 166
477 3300025925 Ga0207650_10369961 Ga0207650_103699612 166
478 3300025925 Ga0207650_10733131 Ga0207650_107331311 166
479 3300025929 Ga0207664_10034664 Ga0207664_100346642 166
480 3300025931 Ga0207644_10003938 Ga0207644_1000393811 166
481 3300025931 Ga0207644_10029083 Ga0207644_100290834 166
482 3300025932 Ga0207690_10094870 Ga0207690_100948702 166
483 3300025932 Ga0207690_10172527 Ga0207690_101725272 166
484 3300025932 Ga0207690_10178032 Ga0207690_101780322 166
485 3300025932 Ga0207690_10355438 Ga0207690_103554382 166
486 3300025932 Ga0207690_10380771 Ga0207690_103807712 166
487 3300025933 Ga0207706_10033148 Ga0207706_100331484 166
488 3300025933 Ga0207706_10054691 Ga0207706_100546915 166
489 3300025933 Ga0207706_10096130 Ga0207706_100961303 166
490 3300025936 Ga0207670_10006864 Ga0207670_100068646 166
491 3300025940 Ga0207691_10000856 Ga0207691_1000085621 166
492 3300025940 Ga0207691_10007017 Ga0207691_100070175 166
493 3300025941 Ga0207711_10002653 Ga0207711_100026535 166
494 3300025942 Ga0207689_10000236 Ga0207689_1000023635 166
495 3300025944 Ga0207661_10089564 Ga0207661_100895643 166
496 3300025945 Ga0207679_10031512 Ga0207679_100315125 166
497 3300025945 Ga0207679_10075861 Ga0207679_100758614 166
498 3300025945 Ga0207679_10100619 Ga0207679_101006193 166
499 3300025945 Ga0207679_10130749 Ga0207679_101307492 166
500 3300025945 Ga0207679_10508463 Ga0207679_105084632 166
501 3300025945 Ga0207679_10993161 Ga0207679_109931611 166
502 3300025945 Ga0207679_11353653 Ga0207679_113536531 166
503 3300025949 Ga0207667_10064662 Ga0207667_100646626 166
504 3300025949 Ga0207667_10214562 Ga0207667_102145624 166
505 3300025949 Ga0207667_10250264 Ga0207667_102502642 166
506 3300025949 Ga0207667_10392936 Ga0207667_103929362 166
507 3300025949 Ga0207667_10656185 Ga0207667_106561852 166
508 3300025960 Ga0207651_11424214 Ga0207651_114242141 166
509 3300025981 Ga0207640_10055618 Ga0207640_100556184 166
510 3300025981 Ga0207640_10149602 Ga0207640_101496023 166
511 3300025981 Ga0207640_10356211 Ga0207640_103562112 166
512 3300025986 Ga0207658_10459824 Ga0207658_104598241 166
513 3300026023 Ga0207677_10097806 Ga0207677_100978064 166
514 3300026023 Ga0207677_10153839 Ga0207677_101538393 166
515 3300026035 Ga0207703_10108962 Ga0207703_101089623 166
516 3300026041 Ga0207639_10416802 Ga0207639_104168023 166
517 3300026067 Ga0207678_10001129 Ga0207678_100011297 166
518 3300026067 Ga0207678_10003812 Ga0207678_1000381211 166
519 3300026067 Ga0207678_10081231 Ga0207678_100812315 166
520 3300026067 Ga0207678_10293631 Ga0207678_102936313 166
521 3300026075 Ga0207708_10001142 Ga0207708_1000114211 166
522 3300026078 Ga0207702_10026811 Ga0207702_100268112 166
523 3300026078 Ga0207702_10043978 Ga0207702_100439785 166
524 3300026078 Ga0207702_10054365 Ga0207702_100543654 166
525 3300026078 Ga0207702_10707012 Ga0207702_107070122 166
526 3300026089 Ga0207648_10004638 Ga0207648_1000463814 166
527 3300026089 Ga0207648_10400377 Ga0207648_104003772 166
528 3300026095 Ga0207676_10041440 Ga0207676_100414403 166
529 3300026095 Ga0207676_10873095 Ga0207676_108730952 166
530 3300026116 Ga0207674_10003596 Ga0207674_1000359616 166
531 3300026116 Ga0207674_10003869 Ga0207674_100038693 166
532 3300026116 Ga0207674_10050678 Ga0207674_100506783 166
533 3300026116 Ga0207674_10136113 Ga0207674_101361133 166
534 3300026116 Ga0207674_11081083 Ga0207674_110810831 166
535 3300026118 Ga0207675_100000778 Ga0207675_10000077829 166
536 3300026121 Ga0207683_10006980 Ga0207683_100069804 166
537 3300026121 Ga0207683_11812115 Ga0207683_118121151 166
538 3300026142 Ga0207698_10093838 Ga0207698_100938383 166
539 3300026142 Ga0207698_10184858 Ga0207698_101848583 166
540 3300026142 Ga0207698_10302432 Ga0207698_103024322 166
541 3300026142 Ga0207698_10453713 Ga0207698_104537131 166
542 3300027682 Ga0209971_1003145 Ga0209971_10031452 166
543 3300027876 Ga0209974_10020735 Ga0209974_100207353 166
544 3300027907 Ga0207428_10181538 Ga0207428_101815383 166
545 3300028381 Ga0268264_10730570 Ga0268264_107305702 166
546 3300031548 Ga0307408_100003056 Ga0307408_10000305610 166
547 3300031731 Ga0307405_10066790 Ga0307405_100667904 166
548 3300031824 Ga0307413_10056747 Ga0307413_100567473 166
549 3300031901 Ga0307406_10010877 Ga0307406_100108776 166
550 3300031903 Ga0307407_10207662 Ga0307407_102076623 166
551 3300031911 Ga0307412_10150964 Ga0307412_101509642 166
552 3300031995 Ga0307409_100019726 Ga0307409_1000197263 166
553 3300032002 Ga0307416_100002228 Ga0307416_1000022286 166
554 3300032005 Ga0307411_10008858 Ga0307411_100088581 166
555 3300032126 Ga0307415_100008758 Ga0307415_1000087583 166
556 3300034817 Ga0373948_0048233 Ga0373948_0048233_292_807 166
557 3300035170 Ga0373943_0068446 Ga0373943_0068446_1265_1765 166
558 3300035691 Ga0373931_0201978 Ga0373931_0201978_181_696 166
559 3300036401 Ga0373937_0140755 Ga0373937_0140755_1728_2231 166
560 3300037418 Ga0395900_0872057 Ga0395900_0872057_178_705 166
561 3300037471 Ga0395905_0439204 Ga0395905_0439204_173_700 166
562 3300042144 Ga0450889_010903 Ga0450889_010903_309_812 166
563 3300042439 Ga0439464_0080170 Ga0439464_0080170_326_829 166
564 3300044842 Ga0466957_0960237 Ga0466957_0960237_50_559 166
565 3300046472 Ga0495580_0173127 Ga0495580_0173127_40_543 166
566 3300046472 Ga0495580_0242374 Ga0495580_0242374_173_673 166
567 3300046684 Ga0495669_0276952 Ga0495669_0276952_19_528 166
568 3300048903 Ga0496100_0620126 Ga0496100_0620126_19_522 166
569 3300048904 Ga0496101_0077721 Ga0496101_0077721_482_982 166
570 3300048905 Ga0496102_0057587 Ga0496102_0057587_735_1235 166
571 3300048907 Ga0496104_0011504 Ga0496104_0011504_4029_4529 166
572 3300048909 Ga0496106_0030287 Ga0496106_0030287_1973_2473 166
573 3300048910 Ga0496107_0044879 Ga0496107_0044879_2636_3136 166
574 3300048911 Ga0496108_0003801 Ga0496108_0003801_4501_5001 166
575 3300048912 Ga0496109_0002100 Ga0496109_0002100_10269_10769 166
576 3300048913 Ga0496110_0004792 Ga0496110_0004792_5289_5789 166
577 3300048914 Ga0496111_0086050 Ga0496111_0086050_592_1092 166
578 3300048917 Ga0496114_0059776 Ga0496114_0059776_2422_2922 166
579 3300050511 nmdc:mga08y16_61486_c1 nmdc:mga08y16_61486_c1_240_740 166
580 3300050512 nmdc:mga0n895_640849_c1 nmdc:mga0n895_640849_c1_93_608 166
581 3300050512 nmdc:mga0n895_81040_c1 nmdc:mga0n895_81040_c1_291_794 166
582 3300050515 nmdc:mga0a205_893655_c1 nmdc:mga0a205_893655_c1_77_598 166
583 3300053084 Ga0495595_0135689 Ga0495595_0135689_555_1058 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

36

163

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xf2-assembly1.cif.gz_A crystal structure of semet-hldc from burkholderia pseudomallei 0.9407 13 152
5xf2-assembly1.cif.gz_A crystal structure of semet-hldc from burkholderia pseudomallei 0.9217 13 152
5x9q-assembly1.cif.gz_B crystal structure of hldc from burkholderia pseudomallei 0.8997 13 165
5x9q-assembly1.cif.gz_B crystal structure of hldc from burkholderia pseudomallei 0.8677 13 165
1n1d-assembly1.cif.gz_A glycerol-3-phosphate cytidylyltransferase complexed with cdp-glycerol 0.8609 34 163
ID Description Score Start End Superfamily
af_P76658_320_476_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9371 17 165 3.40.50.620
af_P76658_320_476_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8853 17 165 3.40.50.620
2b7lD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8539 34 150 3.40.50.620
3glvB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8525 34 153 3.40.50.620
1cozA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8446 34 163 3.40.50.620
ID Description Score Start End GO Terms
AF-T1BDM0-F1-model_v4 Cytidylyltransferase domain protein (EC 2.7.-.-) 0.9896 36 124 GO:0009058
GO:0016779
AF-A0A7W0X723-F1-model_v4 Adenylyltransferase/cytidyltransferase family protein 0.9867 12 166 GO:0009058
GO:0016779
AF-A0A7W0X723-F1-model_v4 Adenylyltransferase/cytidyltransferase family protein 0.9805 12 166 GO:0009058
GO:0016779
AF-A0A351D098-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase 0.9792 17 165 GO:0009058
GO:0016779
AF-A0A2E6P1M1-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase 0.978 35 165 GO:0009058
GO:0016779

Feature Viewer

pLDDT pTM Quality
92.05 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map