F466244
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 583 | 232 | 583 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300005339|Ga0070660_100059225|Ga0070660_1000592255 |
| Length | 179 |
| Sequence | MTASAPMLPEPRYPAKIAGAGTSLARIAALPRPLVFTNGVFDLLHRGHVTYLEQARGLGASLVVAVNTDASVRRLGKGTERPLNAQDDRMAVLAALACVDLVVPFDEDTPHGLIVACAPDVLVKGGDYDATTTVGAREVIAAGGRFVAIPFRYRRSTSALVARIRGAGAAQAATSSKAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 4 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 172 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 174 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 175 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 176 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 177 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 182 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 183 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 196 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 197 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 198 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 204 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 205 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 206 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 207 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 208 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 211 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 212 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 213 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 214 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 215 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.12 |
| Rhizosphere | 95.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1002390 | 3300001976 | Bacteria | 2497 |
| 2 | JGI24743J22301_10004644 | 3300001991 | Bacteria | 2248 |
| 3 | JGI24749J21850_1005128 | 3300002076 | Bacteria | 1835 |
| 4 | JGI24035J26624_1002883 | 3300002126 | Bacteria | 1607 |
| 5 | Ga0065712_10091630 | 3300005290 | Bacteria | 2365 |
| 6 | Ga0065715_10140802 | 3300005293 | Bacteria | 1857 |
| 7 | Ga0070658_10003752 | 3300005327 | Bacteria | 12431 |
| 8 | Ga0070658_10138820 | 3300005327 | Bacteria | 2029 |
| 9 | Ga0070658_10214452 | 3300005327 | Bacteria | 1627 |
| 10 | Ga0070683_100013983 | 3300005329 | Bacteria | 7010 |
| 11 | Ga0070683_100190181 | 3300005329 | Bacteria | 1949 |
| 12 | Ga0070683_100231789 | 3300005329 | Bacteria | 1755 |
| 13 | Ga0070683_100369848 | 3300005329 | Bacteria | 1366 |
| 14 | Ga0070683_101222202 | 3300005329 | Bacteria | 722 |
| 15 | Ga0070690_100015636 | 3300005330 | Bacteria | 4533 |
| 16 | Ga0070690_100023121 | 3300005330 | Bacteria | 3810 |
| 17 | Ga0070670_100042370 | 3300005331 | Bacteria | 3913 |
| 18 | Ga0070670_100066203 | 3300005331 | Bacteria | 3100 |
| 19 | Ga0070670_100119753 | 3300005331 | Bacteria | 2270 |
| 20 | Ga0070670_100222608 | 3300005331 | Bacteria | 1642 |
| 21 | Ga0070677_10022140 | 3300005333 | Bacteria | 2337 |
| 22 | Ga0068869_100003831 | 3300005334 | Bacteria | 9277 |
| 23 | Ga0068869_100039952 | 3300005334 | Bacteria | 3352 |
| 24 | Ga0068869_100839054 | 3300005334 | Bacteria | 792 |
| 25 | Ga0070666_10002948 | 3300005335 | Bacteria | 10303 |
| 26 | Ga0070666_10019763 | 3300005335 | Bacteria | 4351 |
| 27 | Ga0070666_10207090 | 3300005335 | Bacteria | 1381 |
| 28 | Ga0070666_10251540 | 3300005335 | Bacteria | 1251 |
| 29 | Ga0070680_100027835 | 3300005336 | Bacteria | 4529 |
| 30 | Ga0070682_100903059 | 3300005337 | Bacteria | 726 |
| 31 | Ga0068868_100003299 | 3300005338 | Bacteria | 11226 |
| 32 | Ga0068868_100146109 | 3300005338 | Bacteria | 1944 |
| 33 | Ga0068868_100459050 | 3300005338 | Bacteria | 1109 |
| 34 | Ga0070660_100013791 | 3300005339 | Bacteria | 5813 |
| 35 | Ga0070660_100053089 | 3300005339 | Bacteria | 3125 |
| 36 | Ga0070660_100059225 | 3300005339 | Bacteria | 2969 |
| 37 | Ga0070660_100114916 | 3300005339 | Bacteria | 2145 |
| 38 | Ga0070660_100161784 | 3300005339 | Bacteria | 1804 |
| 39 | Ga0070660_100309531 | 3300005339 | Bacteria | 1296 |
| 40 | Ga0070660_100777524 | 3300005339 | Bacteria | 805 |
| 41 | Ga0070689_100002823 | 3300005340 | Bacteria | 11423 |
| 42 | Ga0070691_10245292 | 3300005341 | Bacteria | 958 |
| 43 | Ga0070661_100001471 | 3300005344 | Bacteria | 16352 |
| 44 | Ga0070661_100033740 | 3300005344 | Bacteria | 3710 |
| 45 | Ga0070661_100058684 | 3300005344 | Bacteria | 2820 |
| 46 | Ga0070661_100069378 | 3300005344 | Bacteria | 2591 |
| 47 | Ga0070661_100117706 | 3300005344 | Bacteria | 1988 |
| 48 | Ga0070661_100180123 | 3300005344 | Bacteria | 1607 |
| 49 | Ga0070668_100001131 | 3300005347 | Bacteria | 18735 |
| 50 | Ga0070669_100005744 | 3300005353 | Bacteria | 8944 |
| 51 | Ga0070669_100107964 | 3300005353 | Bacteria | 2109 |
| 52 | Ga0070669_100625899 | 3300005353 | Bacteria | 903 |
| 53 | Ga0070675_100012131 | 3300005354 | Bacteria | 6757 |
| 54 | Ga0070675_100222891 | 3300005354 | Bacteria | 1643 |
| 55 | Ga0070675_100292175 | 3300005354 | Bacteria | 1434 |
| 56 | Ga0070671_100004532 | 3300005355 | Bacteria | 11002 |
| 57 | Ga0070671_100007222 | 3300005355 | Bacteria | 8881 |
| 58 | Ga0070671_100010513 | 3300005355 | Bacteria | 7428 |
| 59 | Ga0070671_100179292 | 3300005355 | Bacteria | 1793 |
| 60 | Ga0070671_100401577 | 3300005355 | Bacteria | 1172 |
| 61 | Ga0070674_100003089 | 3300005356 | Bacteria | 9267 |
| 62 | Ga0070674_100009506 | 3300005356 | Bacteria | 5822 |
| 63 | Ga0070674_100028420 | 3300005356 | Bacteria | 3673 |
| 64 | Ga0070673_100024376 | 3300005364 | Bacteria | 4436 |
| 65 | Ga0070673_100137778 | 3300005364 | Bacteria | 2056 |
| 66 | Ga0070673_100238090 | 3300005364 | Bacteria | 1581 |
| 67 | Ga0070673_100970421 | 3300005364 | Bacteria | 790 |
| 68 | Ga0070673_101607106 | 3300005364 | Bacteria | 614 |
| 69 | Ga0070688_100001955 | 3300005365 | Bacteria | 10357 |
| 70 | Ga0070688_100029185 | 3300005365 | Bacteria | 3301 |
| 71 | Ga0070659_100004569 | 3300005366 | Bacteria | 9897 |
| 72 | Ga0070659_100019993 | 3300005366 | Bacteria | 5083 |
| 73 | Ga0070659_100036791 | 3300005366 | Bacteria | 3816 |
| 74 | Ga0070659_100043306 | 3300005366 | Bacteria | 3521 |
| 75 | Ga0070659_100106858 | 3300005366 | Bacteria | 2256 |
| 76 | Ga0070659_100115990 | 3300005366 | Bacteria | 2165 |
| 77 | Ga0070659_100146686 | 3300005366 | Bacteria | 1923 |
| 78 | Ga0070659_100147610 | 3300005366 | Bacteria | 1917 |
| 79 | Ga0070659_100517925 | 3300005366 | Bacteria | 1018 |
| 80 | Ga0070667_100031601 | 3300005367 | Bacteria | 4414 |
| 81 | Ga0070667_100047276 | 3300005367 | Bacteria | 3620 |
| 82 | Ga0070667_100171093 | 3300005367 | Bacteria | 1918 |
| 83 | Ga0070709_10060146 | 3300005434 | Bacteria | 2414 |
| 84 | Ga0070709_10065128 | 3300005434 | Bacteria | 2332 |
| 85 | Ga0070709_10393969 | 3300005434 | Bacteria | 1033 |
| 86 | Ga0070714_100014951 | 3300005435 | Bacteria | 6239 |
| 87 | Ga0070714_100019491 | 3300005435 | Bacteria | 5529 |
| 88 | Ga0070714_100508328 | 3300005435 | Bacteria | 1150 |
| 89 | Ga0070714_100535891 | 3300005435 | Bacteria | 1119 |
| 90 | Ga0070710_10036685 | 3300005437 | Bacteria | 2681 |
| 91 | Ga0070711_100082826 | 3300005439 | Bacteria | 2290 |
| 92 | Ga0070711_100214405 | 3300005439 | Bacteria | 1493 |
| 93 | Ga0070700_100008699 | 3300005441 | Bacteria | 5538 |
| 94 | Ga0070708_100000731 | 3300005445 | Bacteria | 24915 |
| 95 | Ga0070663_100034726 | 3300005455 | Bacteria | 3494 |
| 96 | Ga0070663_100276822 | 3300005455 | Bacteria | 1336 |
| 97 | Ga0070678_100000550 | 3300005456 | Bacteria | 18321 |
| 98 | Ga0070678_100005330 | 3300005456 | Bacteria | 7419 |
| 99 | Ga0070662_100003464 | 3300005457 | Bacteria | 9838 |
| 100 | Ga0070662_100080518 | 3300005457 | Bacteria | 2425 |
| 101 | Ga0070662_100777455 | 3300005457 | Bacteria | 813 |
| 102 | Ga0070681_10007825 | 3300005458 | Bacteria | 10453 |
| 103 | Ga0070681_10160094 | 3300005458 | Bacteria | 2175 |
| 104 | Ga0070681_10234749 | 3300005458 | Bacteria | 1748 |
| 105 | Ga0070681_10555821 | 3300005458 | Bacteria | 1062 |
| 106 | Ga0070681_10711777 | 3300005458 | Bacteria | 920 |
| 107 | Ga0070681_10871204 | 3300005458 | Bacteria | 819 |
| 108 | Ga0068867_100001145 | 3300005459 | Bacteria | 18123 |
| 109 | Ga0068867_100341082 | 3300005459 | Bacteria | 1247 |
| 110 | Ga0070685_10007504 | 3300005466 | Bacteria | 5582 |
| 111 | Ga0070685_10017469 | 3300005466 | Bacteria | 3841 |
| 112 | Ga0070699_100034428 | 3300005518 | Bacteria | 4377 |
| 113 | Ga0070699_100622173 | 3300005518 | Bacteria | 985 |
| 114 | Ga0070679_100031289 | 3300005530 | Bacteria | 5256 |
| 115 | Ga0070679_100038137 | 3300005530 | Bacteria | 4777 |
| 116 | Ga0070679_100040034 | 3300005530 | Bacteria | 4661 |
| 117 | Ga0070679_100044282 | 3300005530 | Bacteria | 4434 |
| 118 | Ga0070679_100179248 | 3300005530 | Bacteria | 2091 |
| 119 | Ga0070679_100466004 | 3300005530 | Bacteria | 1208 |
| 120 | Ga0070684_100072246 | 3300005535 | Bacteria | 3037 |
| 121 | Ga0070684_100608165 | 3300005535 | Bacteria | 1016 |
| 122 | Ga0068853_100013226 | 3300005539 | Bacteria | 6735 |
| 123 | Ga0068853_100020039 | 3300005539 | Bacteria | 5558 |
| 124 | Ga0068853_100029634 | 3300005539 | Bacteria | 4616 |
| 125 | Ga0068853_100127208 | 3300005539 | Bacteria | 2277 |
| 126 | Ga0070672_100001458 | 3300005543 | Bacteria | 14657 |
| 127 | Ga0070672_100006692 | 3300005543 | Bacteria | 7768 |
| 128 | Ga0070672_100031429 | 3300005543 | Bacteria | 3996 |
| 129 | Ga0070672_100189319 | 3300005543 | Bacteria | 1717 |
| 130 | Ga0070686_100102045 | 3300005544 | Bacteria | 1940 |
| 131 | Ga0070696_100021047 | 3300005546 | Bacteria | 4420 |
| 132 | Ga0070693_100084621 | 3300005547 | Bacteria | 1899 |
| 133 | Ga0070665_100001395 | 3300005548 | Bacteria | 28413 |
| 134 | Ga0070665_100064945 | 3300005548 | Bacteria | 3661 |
| 135 | Ga0070665_100083004 | 3300005548 | Bacteria | 3209 |
| 136 | Ga0068855_100017552 | 3300005563 | Bacteria | 8606 |
| 137 | Ga0068855_100069548 | 3300005563 | Bacteria | 4097 |
| 138 | Ga0068855_100125811 | 3300005563 | Bacteria | 2931 |
| 139 | Ga0068855_100173260 | 3300005563 | Bacteria | 2443 |
| 140 | Ga0068855_100472479 | 3300005563 | Bacteria | 1366 |
| 141 | Ga0068855_101122397 | 3300005563 | Bacteria | 821 |
| 142 | Ga0068855_101252395 | 3300005563 | Bacteria | 769 |
| 143 | Ga0070664_100022377 | 3300005564 | Bacteria | 5211 |
| 144 | Ga0070664_100033744 | 3300005564 | Bacteria | 4289 |
| 145 | Ga0070664_100057956 | 3300005564 | Bacteria | 3294 |
| 146 | Ga0070664_100104149 | 3300005564 | Bacteria | 2470 |
| 147 | Ga0070664_100117485 | 3300005564 | Bacteria | 2326 |
| 148 | Ga0070664_100245765 | 3300005564 | Bacteria | 1607 |
| 149 | Ga0070664_100330583 | 3300005564 | Bacteria | 1383 |
| 150 | Ga0070664_100641342 | 3300005564 | Bacteria | 987 |
| 151 | Ga0070664_100798204 | 3300005564 | Bacteria | 882 |
| 152 | Ga0068857_100000465 | 3300005577 | Bacteria | 28816 |
| 153 | Ga0068857_100035965 | 3300005577 | Bacteria | 4387 |
| 154 | Ga0068857_100156898 | 3300005577 | Bacteria | 2064 |
| 155 | Ga0068857_100160303 | 3300005577 | Bacteria | 2041 |
| 156 | Ga0068857_100316065 | 3300005577 | Bacteria | 1442 |
| 157 | Ga0068854_100028699 | 3300005578 | Bacteria | 3847 |
| 158 | Ga0068854_100416884 | 3300005578 | Bacteria | 1115 |
| 159 | Ga0068854_100726874 | 3300005578 | Bacteria | 859 |
| 160 | Ga0068854_101063692 | 3300005578 | Bacteria | 719 |
| 161 | Ga0068856_100000125 | 3300005614 | Bacteria | 77301 |
| 162 | Ga0068856_100060384 | 3300005614 | Bacteria | 3745 |
| 163 | Ga0068856_100105927 | 3300005614 | Bacteria | 2806 |
| 164 | Ga0070702_100338405 | 3300005615 | Bacteria | 1055 |
| 165 | Ga0068852_100016442 | 3300005616 | Bacteria | 5770 |
| 166 | Ga0068852_100036370 | 3300005616 | Bacteria | 4118 |
| 167 | Ga0068852_100039892 | 3300005616 | Bacteria | 3957 |
| 168 | Ga0068852_100177535 | 3300005616 | Bacteria | 2001 |
| 169 | Ga0068852_100247367 | 3300005616 | Bacteria | 1707 |
| 170 | Ga0068852_100325817 | 3300005616 | Bacteria | 1493 |
| 171 | Ga0068852_100336827 | 3300005616 | Bacteria | 1469 |
| 172 | Ga0068852_100842660 | 3300005616 | Bacteria | 932 |
| 173 | Ga0068852_100877272 | 3300005616 | Bacteria | 914 |
| 174 | Ga0068859_100005307 | 3300005617 | Bacteria | 13103 |
| 175 | Ga0068859_100279055 | 3300005617 | Bacteria | 1763 |
| 176 | Ga0068864_100007610 | 3300005618 | Bacteria | 8919 |
| 177 | Ga0068864_100021513 | 3300005618 | Bacteria | 5402 |
| 178 | Ga0068864_101388788 | 3300005618 | Bacteria | 704 |
| 179 | Ga0068866_10128591 | 3300005718 | Bacteria | 1437 |
| 180 | Ga0068866_10359268 | 3300005718 | Bacteria | 928 |
| 181 | Ga0068861_100027250 | 3300005719 | Bacteria | 4160 |
| 182 | Ga0068861_100240334 | 3300005719 | Bacteria | 1540 |
| 183 | Ga0068851_10001567 | 3300005834 | Bacteria | 10036 |
| 184 | Ga0068851_10004364 | 3300005834 | Bacteria | 6368 |
| 185 | Ga0068851_10018654 | 3300005834 | Bacteria | 3344 |
| 186 | Ga0068851_10030813 | 3300005834 | Bacteria | 2662 |
| 187 | Ga0068851_10041195 | 3300005834 | Bacteria | 2322 |
| 188 | Ga0068851_10236518 | 3300005834 | Bacteria | 1031 |
| 189 | Ga0068870_10060990 | 3300005840 | Bacteria | 2026 |
| 190 | Ga0068870_10178316 | 3300005840 | Bacteria | 1273 |
| 191 | Ga0068858_100005787 | 3300005842 | Bacteria | 12077 |
| 192 | Ga0068858_100116074 | 3300005842 | Bacteria | 2502 |
| 193 | Ga0068860_100010721 | 3300005843 | Bacteria | 9049 |
| 194 | Ga0068862_100024936 | 3300005844 | Bacteria | 5019 |
| 195 | Ga0068862_100796358 | 3300005844 | Bacteria | 923 |
| 196 | Ga0070716_100038139 | 3300006173 | Bacteria | 2659 |
| 197 | Ga0070712_100265969 | 3300006175 | Bacteria | 1376 |
| 198 | Ga0097621_100002227 | 3300006237 | Bacteria | 13288 |
| 199 | Ga0097621_100044991 | 3300006237 | Bacteria | 3564 |
| 200 | Ga0097621_100251433 | 3300006237 | Bacteria | 1548 |
| 201 | Ga0097621_101039698 | 3300006237 | Bacteria | 767 |
| 202 | Ga0097621_101113892 | 3300006237 | Bacteria | 741 |
| 203 | Ga0068871_100011822 | 3300006358 | Bacteria | 6417 |
| 204 | Ga0068871_100020681 | 3300006358 | Bacteria | 5046 |
| 205 | Ga0068871_100117896 | 3300006358 | Bacteria | 2239 |
| 206 | Ga0075433_10740576 | 3300006852 | Bacteria | 860 |
| 207 | Ga0075434_100140265 | 3300006871 | Unclassified | 2436 |
| 208 | Ga0075434_100669387 | 3300006871 | Bacteria | 1056 |
| 209 | Ga0068865_100003988 | 3300006881 | Bacteria | 8856 |
| 210 | Ga0097620_100005307 | 3300006931 | Bacteria | 13103 |
| 211 | Ga0097620_100279082 | 3300006931 | Bacteria | 1763 |
| 212 | Ga0105240_10014137 | 3300009093 | Bacteria | 10906 |
| 213 | Ga0105240_10032172 | 3300009093 | Bacteria | 6793 |
| 214 | Ga0105240_10308528 | 3300009093 | Bacteria | 1808 |
| 215 | Ga0111539_10002947 | 3300009094 | Bacteria | 22580 |
| 216 | Ga0111539_10485242 | 3300009094 | Bacteria | 1439 |
| 217 | Ga0105245_10063107 | 3300009098 | Bacteria | 3345 |
| 218 | Ga0105243_10183833 | 3300009148 | Bacteria | 1820 |
| 219 | Ga0105241_10061671 | 3300009174 | Bacteria | 2888 |
| 220 | Ga0105241_10146102 | 3300009174 | Bacteria | 1930 |
| 221 | Ga0105241_10364282 | 3300009174 | Bacteria | 1259 |
| 222 | Ga0105241_10397221 | 3300009174 | Bacteria | 1208 |
| 223 | Ga0105248_10001562 | 3300009177 | Bacteria | 25458 |
| 224 | Ga0105248_10017740 | 3300009177 | Bacteria | 7850 |
| 225 | Ga0105248_10789439 | 3300009177 | Bacteria | 1072 |
| 226 | Ga0105237_10044821 | 3300009545 | Bacteria | 4453 |
| 227 | Ga0105237_10134500 | 3300009545 | Bacteria | 2467 |
| 228 | Ga0105237_10174282 | 3300009545 | Bacteria | 2151 |
| 229 | Ga0105237_10340953 | 3300009545 | Bacteria | 1503 |
| 230 | Ga0105237_11883096 | 3300009545 | Bacteria | 606 |
| 231 | Ga0105238_10000495 | 3300009551 | Bacteria | 41322 |
| 232 | Ga0105238_10719657 | 3300009551 | Bacteria | 1011 |
| 233 | Ga0105249_10094719 | 3300009553 | Bacteria | 2799 |
| 234 | Ga0105249_10175316 | 3300009553 | Bacteria | 2082 |
| 235 | Ga0105239_10195414 | 3300010375 | Bacteria | 2266 |
| 236 | Ga0105239_10301609 | 3300010375 | Bacteria | 1804 |
| 237 | Ga0105239_10433722 | 3300010375 | Bacteria | 1489 |
| 238 | Ga0105239_10571229 | 3300010375 | Bacteria | 1289 |
| 239 | Ga0105246_11304431 | 3300011119 | Bacteria | 673 |
| 240 | Ga0157373_10001602 | 3300013100 | Bacteria | 17274 |
| 241 | Ga0157373_10003939 | 3300013100 | Bacteria | 11212 |
| 242 | Ga0157373_10113744 | 3300013100 | Bacteria | 1902 |
| 243 | Ga0157373_10476285 | 3300013100 | Bacteria | 900 |
| 244 | Ga0157371_10001964 | 3300013102 | Bacteria | 20390 |
| 245 | Ga0157371_10069943 | 3300013102 | Bacteria | 2485 |
| 246 | Ga0157371_10330864 | 3300013102 | Bacteria | 1107 |
| 247 | Ga0157370_10025794 | 3300013104 | Bacteria | 5814 |
| 248 | Ga0157370_10113544 | 3300013104 | Bacteria | 2531 |
| 249 | Ga0157370_10127528 | 3300013104 | Bacteria | 2375 |
| 250 | Ga0157369_10028044 | 3300013105 | Bacteria | 6235 |
| 251 | Ga0157369_10169453 | 3300013105 | Bacteria | 2301 |
| 252 | Ga0157369_10430712 | 3300013105 | Bacteria | 1367 |
| 253 | Ga0157369_10665000 | 3300013105 | Bacteria | 1074 |
| 254 | Ga0157369_11323092 | 3300013105 | Bacteria | 734 |
| 255 | Ga0157374_10005777 | 3300013296 | Bacteria | 10445 |
| 256 | Ga0157374_10093490 | 3300013296 | Bacteria | 2871 |
| 257 | Ga0157374_10169054 | 3300013296 | Bacteria | 2132 |
| 258 | Ga0157374_10292891 | 3300013296 | Bacteria | 1609 |
| 259 | Ga0157378_10670215 | 3300013297 | Bacteria | 1054 |
| 260 | Ga0163162_10008638 | 3300013306 | Bacteria | 9923 |
| 261 | Ga0163162_10389067 | 3300013306 | Bacteria | 1527 |
| 262 | Ga0163162_10596167 | 3300013306 | Bacteria | 1231 |
| 263 | Ga0157372_10003272 | 3300013307 | Bacteria | 17507 |
| 264 | Ga0157372_10008814 | 3300013307 | Bacteria | 10714 |
| 265 | Ga0157372_10026178 | 3300013307 | Bacteria | 6347 |
| 266 | Ga0157372_10046744 | 3300013307 | Bacteria | 4806 |
| 267 | Ga0157372_10073874 | 3300013307 | Bacteria | 3844 |
| 268 | Ga0157372_10179304 | 3300013307 | Bacteria | 2452 |
| 269 | Ga0157372_10180439 | 3300013307 | Bacteria | 2444 |
| 270 | Ga0157372_10186020 | 3300013307 | Bacteria | 2405 |
| 271 | Ga0157372_10888989 | 3300013307 | Bacteria | 1034 |
| 272 | Ga0157372_10974071 | 3300013307 | Bacteria | 983 |
| 273 | Ga0157375_10017367 | 3300013308 | Bacteria | 6491 |
| 274 | Ga0157375_10223311 | 3300013308 | Bacteria | 2043 |
| 275 | Ga0157375_10516061 | 3300013308 | Bacteria | 1358 |
| 276 | Ga0157375_12114494 | 3300013308 | Bacteria | 670 |
| 277 | Ga0157380_10003087 | 3300014326 | Bacteria | 11360 |
| 278 | Ga0157380_10552358 | 3300014326 | Bacteria | 1130 |
| 279 | Ga0182008_10062675 | 3300014497 | Bacteria | 1832 |
| 280 | Ga0182008_10263546 | 3300014497 | Bacteria | 892 |
| 281 | Ga0157377_10006265 | 3300014745 | Bacteria | 5663 |
| 282 | Ga0157379_10006361 | 3300014968 | Bacteria | 10169 |
| 283 | Ga0157379_10403709 | 3300014968 | Bacteria | 1256 |
| 284 | Ga0157376_10019347 | 3300014969 | Bacteria | 5246 |
| 285 | Ga0157376_10164878 | 3300014969 | Bacteria | 2012 |
| 286 | Ga0157376_12519627 | 3300014969 | Bacteria | 554 |
| 287 | Ga0163161_10033638 | 3300017792 | Bacteria | 3663 |
| 288 | Ga0163161_10072192 | 3300017792 | Bacteria | 2527 |
| 289 | Ga0206354_10077192 | 3300020081 | Bacteria | 2315 |
| 290 | Ga0206353_10609133 | 3300020082 | Bacteria | 3210 |
| 291 | Ga0207697_10000331 | 3300025315 | Bacteria | 26425 |
| 292 | Ga0207656_10003424 | 3300025321 | Bacteria | 5453 |
| 293 | Ga0207656_10044679 | 3300025321 | Bacteria | 1893 |
| 294 | Ga0207656_10056830 | 3300025321 | Bacteria | 1706 |
| 295 | Ga0207656_10076382 | 3300025321 | Bacteria | 1498 |
| 296 | Ga0207656_10123975 | 3300025321 | Bacteria | 1205 |
| 297 | Ga0207656_10134965 | 3300025321 | Bacteria | 1159 |
| 298 | Ga0207656_10141812 | 3300025321 | Bacteria | 1133 |
| 299 | Ga0207682_10000010 | 3300025893 | Bacteria | 85697 |
| 300 | Ga0207692_10357021 | 3300025898 | Bacteria | 902 |
| 301 | Ga0207642_10045549 | 3300025899 | Bacteria | 1948 |
| 302 | Ga0207642_10246592 | 3300025899 | Bacteria | 1011 |
| 303 | Ga0207688_10009140 | 3300025901 | Bacteria | 5397 |
| 304 | Ga0207680_10004083 | 3300025903 | Bacteria | 6899 |
| 305 | Ga0207680_10040734 | 3300025903 | Bacteria | 2705 |
| 306 | Ga0207680_10466514 | 3300025903 | Bacteria | 897 |
| 307 | Ga0207680_11142325 | 3300025903 | Bacteria | 556 |
| 308 | Ga0207647_10023273 | 3300025904 | Bacteria | 4099 |
| 309 | Ga0207699_10112110 | 3300025906 | Bacteria | 1750 |
| 310 | Ga0207645_10001212 | 3300025907 | Bacteria | 21289 |
| 311 | Ga0207645_10001222 | 3300025907 | Bacteria | 21187 |
| 312 | Ga0207645_10104954 | 3300025907 | Bacteria | 1825 |
| 313 | Ga0207643_10000339 | 3300025908 | Bacteria | 31901 |
| 314 | Ga0207643_10010876 | 3300025908 | Bacteria | 4907 |
| 315 | Ga0207643_10233186 | 3300025908 | Bacteria | 1129 |
| 316 | Ga0207705_10088193 | 3300025909 | Bacteria | 2269 |
| 317 | Ga0207705_10603742 | 3300025909 | Bacteria | 853 |
| 318 | Ga0207705_10626443 | 3300025909 | Bacteria | 836 |
| 319 | Ga0207684_10809514 | 3300025910 | Bacteria | 792 |
| 320 | Ga0207654_10106864 | 3300025911 | Bacteria | 1734 |
| 321 | Ga0207654_10180220 | 3300025911 | Bacteria | 1378 |
| 322 | Ga0207654_10230642 | 3300025911 | Bacteria | 1233 |
| 323 | Ga0207707_10011174 | 3300025912 | Bacteria | 7811 |
| 324 | Ga0207707_10026818 | 3300025912 | Bacteria | 5035 |
| 325 | Ga0207707_10154012 | 3300025912 | Bacteria | 2010 |
| 326 | Ga0207707_10170450 | 3300025912 | Bacteria | 1902 |
| 327 | Ga0207707_10189561 | 3300025912 | Bacteria | 1794 |
| 328 | Ga0207707_10544460 | 3300025912 | Bacteria | 987 |
| 329 | Ga0207707_10690220 | 3300025912 | Bacteria | 858 |
| 330 | Ga0207707_10999100 | 3300025912 | Bacteria | 687 |
| 331 | Ga0207695_10031079 | 3300025913 | Bacteria | 5866 |
| 332 | Ga0207695_10091719 | 3300025913 | Bacteria | 3051 |
| 333 | Ga0207695_10230291 | 3300025913 | Bacteria | 1758 |
| 334 | Ga0207671_10260310 | 3300025914 | Bacteria | 1365 |
| 335 | Ga0207671_10261930 | 3300025914 | Bacteria | 1361 |
| 336 | Ga0207663_10136827 | 3300025916 | Bacteria | 1701 |
| 337 | Ga0207663_10219879 | 3300025916 | Bacteria | 1381 |
| 338 | Ga0207660_10091459 | 3300025917 | Bacteria | 2257 |
| 339 | Ga0207660_10142483 | 3300025917 | Bacteria | 1833 |
| 340 | Ga0207660_10249727 | 3300025917 | Bacteria | 1400 |
| 341 | Ga0207662_10002021 | 3300025918 | Bacteria | 10033 |
| 342 | Ga0207657_10000708 | 3300025919 | Bacteria | 35432 |
| 343 | Ga0207657_10003690 | 3300025919 | Bacteria | 16285 |
| 344 | Ga0207657_10010189 | 3300025919 | Bacteria | 9390 |
| 345 | Ga0207657_10014283 | 3300025919 | Bacteria | 7760 |
| 346 | Ga0207657_10023357 | 3300025919 | Bacteria | 5758 |
| 347 | Ga0207657_10174144 | 3300025919 | Bacteria | 1742 |
| 348 | Ga0207649_10007330 | 3300025920 | Bacteria | 6002 |
| 349 | Ga0207649_10008352 | 3300025920 | Bacteria | 5643 |
| 350 | Ga0207649_10126162 | 3300025920 | Bacteria | 1732 |
| 351 | Ga0207649_10219535 | 3300025920 | Bacteria | 1353 |
| 352 | Ga0207652_10011154 | 3300025921 | Bacteria | 7245 |
| 353 | Ga0207652_10113159 | 3300025921 | Bacteria | 2409 |
| 354 | Ga0207652_10114438 | 3300025921 | Bacteria | 2395 |
| 355 | Ga0207652_10404535 | 3300025921 | Bacteria | 1232 |
| 356 | Ga0207652_10545315 | 3300025921 | Bacteria | 1042 |
| 357 | Ga0207652_10549348 | 3300025921 | Bacteria | 1038 |
| 358 | Ga0207681_10004098 | 3300025923 | Bacteria | 9030 |
| 359 | Ga0207681_10060188 | 3300025923 | Bacteria | 2606 |
| 360 | Ga0207694_10247700 | 3300025924 | Bacteria | 1457 |
| 361 | Ga0207694_10375033 | 3300025924 | Bacteria | 1180 |
| 362 | Ga0207650_10008074 | 3300025925 | Bacteria | 7172 |
| 363 | Ga0207650_10098254 | 3300025925 | Bacteria | 2249 |
| 364 | Ga0207650_10199489 | 3300025925 | Unclassified | 1602 |
| 365 | Ga0207650_10369961 | 3300025925 | Bacteria | 1182 |
| 366 | Ga0207650_10733131 | 3300025925 | Bacteria | 836 |
| 367 | Ga0207659_10002127 | 3300025926 | Bacteria | 11741 |
| 368 | Ga0207659_10029352 | 3300025926 | Bacteria | 3748 |
| 369 | Ga0207687_10453432 | 3300025927 | Bacteria | 1064 |
| 370 | Ga0207700_10299043 | 3300025928 | Bacteria | 1389 |
| 371 | Ga0207664_10015101 | 3300025929 | Bacteria | 5595 |
| 372 | Ga0207664_10034664 | 3300025929 | Bacteria | 3888 |
| 373 | Ga0207664_10041829 | 3300025929 | Bacteria | 3572 |
| 374 | Ga0207644_10003938 | 3300025931 | Bacteria | 9632 |
| 375 | Ga0207644_10014150 | 3300025931 | Bacteria | 5336 |
| 376 | Ga0207644_10029083 | 3300025931 | Bacteria | 3830 |
| 377 | Ga0207644_10235335 | 3300025931 | Bacteria | 1457 |
| 378 | Ga0207690_10001716 | 3300025932 | Bacteria | 13456 |
| 379 | Ga0207690_10094870 | 3300025932 | Bacteria | 2118 |
| 380 | Ga0207690_10144241 | 3300025932 | Bacteria | 1758 |
| 381 | Ga0207690_10172527 | 3300025932 | Bacteria | 1621 |
| 382 | Ga0207690_10178032 | 3300025932 | Bacteria | 1599 |
| 383 | Ga0207690_10355438 | 3300025932 | Bacteria | 1159 |
| 384 | Ga0207690_10380771 | 3300025932 | Bacteria | 1121 |
| 385 | Ga0207706_10000133 | 3300025933 | Bacteria | 80935 |
| 386 | Ga0207706_10033148 | 3300025933 | Bacteria | 4598 |
| 387 | Ga0207706_10054691 | 3300025933 | Bacteria | 3522 |
| 388 | Ga0207706_10096130 | 3300025933 | Bacteria | 2605 |
| 389 | Ga0207670_10006864 | 3300025936 | Bacteria | 6333 |
| 390 | Ga0207669_10002496 | 3300025937 | Bacteria | 7849 |
| 391 | Ga0207704_10002146 | 3300025938 | Bacteria | 8842 |
| 392 | Ga0207691_10000170 | 3300025940 | Bacteria | 60463 |
| 393 | Ga0207691_10000856 | 3300025940 | Bacteria | 30200 |
| 394 | Ga0207691_10007017 | 3300025940 | Bacteria | 10867 |
| 395 | Ga0207691_10033757 | 3300025940 | Bacteria | 4764 |
| 396 | Ga0207691_10194763 | 3300025940 | Bacteria | 1766 |
| 397 | Ga0207711_10002653 | 3300025941 | Bacteria | 15812 |
| 398 | Ga0207711_10011403 | 3300025941 | Bacteria | 7386 |
| 399 | Ga0207689_10000236 | 3300025942 | Bacteria | 49281 |
| 400 | Ga0207689_10003037 | 3300025942 | Bacteria | 15469 |
| 401 | Ga0207661_10018568 | 3300025944 | Bacteria | 5168 |
| 402 | Ga0207661_10089564 | 3300025944 | Bacteria | 2560 |
| 403 | Ga0207679_10002499 | 3300025945 | Bacteria | 11318 |
| 404 | Ga0207679_10014127 | 3300025945 | Bacteria | 5243 |
| 405 | Ga0207679_10031512 | 3300025945 | Bacteria | 3711 |
| 406 | Ga0207679_10075861 | 3300025945 | Bacteria | 2553 |
| 407 | Ga0207679_10100619 | 3300025945 | Bacteria | 2259 |
| 408 | Ga0207679_10130749 | 3300025945 | Bacteria | 2013 |
| 409 | Ga0207679_10508463 | 3300025945 | Bacteria | 1076 |
| 410 | Ga0207679_10993161 | 3300025945 | Bacteria | 769 |
| 411 | Ga0207679_11353653 | 3300025945 | Bacteria | 653 |
| 412 | Ga0207667_10000842 | 3300025949 | Bacteria | 39549 |
| 413 | Ga0207667_10055675 | 3300025949 | Bacteria | 4157 |
| 414 | Ga0207667_10064662 | 3300025949 | Bacteria | 3818 |
| 415 | Ga0207667_10214562 | 3300025949 | Bacteria | 1972 |
| 416 | Ga0207667_10250264 | 3300025949 | Bacteria | 1812 |
| 417 | Ga0207667_10392936 | 3300025949 | Bacteria | 1412 |
| 418 | Ga0207667_10656185 | 3300025949 | Bacteria | 1054 |
| 419 | Ga0207651_10035355 | 3300025960 | Bacteria | 3247 |
| 420 | Ga0207651_10985404 | 3300025960 | Bacteria | 753 |
| 421 | Ga0207651_11424214 | 3300025960 | Bacteria | 624 |
| 422 | Ga0207668_10003080 | 3300025972 | Bacteria | 9776 |
| 423 | Ga0207640_10055618 | 3300025981 | Bacteria | 2593 |
| 424 | Ga0207640_10063995 | 3300025981 | Bacteria | 2447 |
| 425 | Ga0207640_10149602 | 3300025981 | Bacteria | 1713 |
| 426 | Ga0207640_10356211 | 3300025981 | Bacteria | 1177 |
| 427 | Ga0207640_10806441 | 3300025981 | Bacteria | 814 |
| 428 | Ga0207658_10004449 | 3300025986 | Bacteria | 9745 |
| 429 | Ga0207658_10021041 | 3300025986 | Bacteria | 4523 |
| 430 | Ga0207658_10459824 | 3300025986 | Bacteria | 1128 |
| 431 | Ga0207677_10005466 | 3300026023 | Bacteria | 6896 |
| 432 | Ga0207677_10097806 | 3300026023 | Bacteria | 2151 |
| 433 | Ga0207677_10153839 | 3300026023 | Bacteria | 1778 |
| 434 | Ga0207703_10003353 | 3300026035 | Bacteria | 13453 |
| 435 | Ga0207703_10108962 | 3300026035 | Bacteria | 2360 |
| 436 | Ga0207639_10003306 | 3300026041 | Bacteria | 10852 |
| 437 | Ga0207639_10053019 | 3300026041 | Bacteria | 3093 |
| 438 | Ga0207639_10256481 | 3300026041 | Bacteria | 1527 |
| 439 | Ga0207639_10416802 | 3300026041 | Bacteria | 1213 |
| 440 | Ga0207678_10001121 | 3300026067 | Bacteria | 24571 |
| 441 | Ga0207678_10001129 | 3300026067 | Bacteria | 24466 |
| 442 | Ga0207678_10003812 | 3300026067 | Bacteria | 13569 |
| 443 | Ga0207678_10081231 | 3300026067 | Bacteria | 2774 |
| 444 | Ga0207678_10293631 | 3300026067 | Bacteria | 1396 |
| 445 | Ga0207708_10001142 | 3300026075 | Bacteria | 19955 |
| 446 | Ga0207708_10779664 | 3300026075 | Bacteria | 822 |
| 447 | Ga0207702_10003101 | 3300026078 | Bacteria | 15414 |
| 448 | Ga0207702_10006833 | 3300026078 | Bacteria | 9785 |
| 449 | Ga0207702_10026811 | 3300026078 | Bacteria | 4784 |
| 450 | Ga0207702_10043978 | 3300026078 | Bacteria | 3752 |
| 451 | Ga0207702_10054365 | 3300026078 | Bacteria | 3393 |
| 452 | Ga0207702_10542452 | 3300026078 | Bacteria | 1137 |
| 453 | Ga0207702_10707012 | 3300026078 | Bacteria | 993 |
| 454 | Ga0207641_10004021 | 3300026088 | Bacteria | 12833 |
| 455 | Ga0207641_10387273 | 3300026088 | Bacteria | 1340 |
| 456 | Ga0207648_10000203 | 3300026089 | Bacteria | 63192 |
| 457 | Ga0207648_10004638 | 3300026089 | Bacteria | 14072 |
| 458 | Ga0207648_10400377 | 3300026089 | Bacteria | 1244 |
| 459 | Ga0207676_10009806 | 3300026095 | Bacteria | 6811 |
| 460 | Ga0207676_10041440 | 3300026095 | Bacteria | 3534 |
| 461 | Ga0207676_10873095 | 3300026095 | Bacteria | 881 |
| 462 | Ga0207674_10000182 | 3300026116 | Bacteria | 77228 |
| 463 | Ga0207674_10003596 | 3300026116 | Bacteria | 18901 |
| 464 | Ga0207674_10003869 | 3300026116 | Bacteria | 18251 |
| 465 | Ga0207674_10050678 | 3300026116 | Bacteria | 4240 |
| 466 | Ga0207674_10131068 | 3300026116 | Bacteria | 2470 |
| 467 | Ga0207674_10136113 | 3300026116 | Bacteria | 2418 |
| 468 | Ga0207674_11081083 | 3300026116 | Bacteria | 771 |
| 469 | Ga0207675_100000778 | 3300026118 | Bacteria | 31816 |
| 470 | Ga0207675_100139819 | 3300026118 | Bacteria | 2300 |
| 471 | Ga0207683_10000428 | 3300026121 | Bacteria | 38922 |
| 472 | Ga0207683_10006316 | 3300026121 | Bacteria | 10151 |
| 473 | Ga0207683_10006980 | 3300026121 | Bacteria | 9681 |
| 474 | Ga0207683_11812115 | 3300026121 | Bacteria | 559 |
| 475 | Ga0207698_10007390 | 3300026142 | Bacteria | 6883 |
| 476 | Ga0207698_10064370 | 3300026142 | Bacteria | 2874 |
| 477 | Ga0207698_10093838 | 3300026142 | Bacteria | 2465 |
| 478 | Ga0207698_10184858 | 3300026142 | Bacteria | 1850 |
| 479 | Ga0207698_10302432 | 3300026142 | Bacteria | 1490 |
| 480 | Ga0207698_10453713 | 3300026142 | Bacteria | 1238 |
| 481 | Ga0209984_1012580 | 3300027424 | Bacteria | 1104 |
| 482 | Ga0209995_1002596 | 3300027471 | Bacteria | 2856 |
| 483 | Ga0209982_1028217 | 3300027552 | Bacteria | 878 |
| 484 | Ga0209971_1000786 | 3300027682 | Bacteria | 8175 |
| 485 | Ga0209971_1003145 | 3300027682 | Bacteria | 3943 |
| 486 | Ga0209998_10013992 | 3300027717 | Bacteria | 1674 |
| 487 | Ga0209974_10020735 | 3300027876 | Bacteria | 2178 |
| 488 | Ga0207428_10181538 | 3300027907 | Bacteria | 1590 |
| 489 | Ga0268266_10013867 | 3300028379 | Bacteria | 6938 |
| 490 | Ga0268266_10023138 | 3300028379 | Bacteria | 5289 |
| 491 | Ga0268264_10005632 | 3300028381 | Bacteria | 10612 |
| 492 | Ga0268264_10730570 | 3300028381 | Bacteria | 985 |
| 493 | Ga0307408_100003056 | 3300031548 | Bacteria | 11553 |
| 494 | Ga0307405_10005591 | 3300031731 | Bacteria | 6078 |
| 495 | Ga0307405_10066790 | 3300031731 | Bacteria | 2294 |
| 496 | Ga0307413_10032300 | 3300031824 | Bacteria | 2966 |
| 497 | Ga0307413_10056747 | 3300031824 | Bacteria | 2390 |
| 498 | Ga0307410_10001203 | 3300031852 | Bacteria | 11485 |
| 499 | Ga0307410_10217434 | 3300031852 | Bacteria | 1468 |
| 500 | Ga0307406_10010877 | 3300031901 | Bacteria | 5144 |
| 501 | Ga0307407_10000203 | 3300031903 | Bacteria | 18046 |
| 502 | Ga0307407_10207662 | 3300031903 | Bacteria | 1316 |
| 503 | Ga0307412_10011210 | 3300031911 | Bacteria | 5186 |
| 504 | Ga0307412_10150964 | 3300031911 | Bacteria | 1714 |
| 505 | Ga0307409_100019726 | 3300031995 | Bacteria | 4574 |
| 506 | Ga0307409_100410711 | 3300031995 | Bacteria | 1296 |
| 507 | Ga0307416_100001590 | 3300032002 | Bacteria | 12467 |
| 508 | Ga0307416_100002228 | 3300032002 | Bacteria | 11029 |
| 509 | Ga0307416_101706426 | 3300032002 | Bacteria | 734 |
| 510 | Ga0307414_10189685 | 3300032004 | Bacteria | 1662 |
| 511 | Ga0307411_10004280 | 3300032005 | Bacteria | 6809 |
| 512 | Ga0307411_10008858 | 3300032005 | Bacteria | 5244 |
| 513 | Ga0307415_100003471 | 3300032126 | Bacteria | 8034 |
| 514 | Ga0307415_100008758 | 3300032126 | Bacteria | 5630 |
| 515 | Ga0373948_0048233 | 3300034817 | Bacteria | 909 |
| 516 | Ga0373954_0137809 | 3300035118 | Bacteria | 1190 |
| 517 | Ga0373943_0068446 | 3300035170 | Bacteria | 1792 |
| 518 | Ga0373955_0201730 | 3300035172 | Bacteria | 1184 |
| 519 | Ga0373955_0550498 | 3300035172 | Bacteria | 706 |
| 520 | Ga0373955_0601492 | 3300035172 | Bacteria | 673 |
| 521 | Ga0373942_0134447 | 3300035207 | Bacteria | 783 |
| 522 | Ga0373931_0019306 | 3300035691 | Bacteria | 3402 |
| 523 | Ga0373931_0201978 | 3300035691 | Bacteria | 1188 |
| 524 | Ga0373931_0453851 | 3300035691 | Bacteria | 820 |
| 525 | Ga0373937_0112656 | 3300036401 | Bacteria | 2531 |
| 526 | Ga0373937_0140755 | 3300036401 | Bacteria | 2257 |
| 527 | Ga0395899_0123580 | 3300037312 | Bacteria | 1852 |
| 528 | Ga0395900_0116142 | 3300037418 | Bacteria | 2746 |
| 529 | Ga0395900_0872057 | 3300037418 | Bacteria | 825 |
| 530 | Ga0395898_0072294 | 3300037466 | Bacteria | 3332 |
| 531 | Ga0395905_0439204 | 3300037471 | Bacteria | 1202 |
| 532 | Ga0395901_0139202 | 3300038443 | Bacteria | 2551 |
| 533 | Ga0450889_010903 | 3300042144 | Bacteria | 941 |
| 534 | Ga0439464_0080170 | 3300042439 | Bacteria | 974 |
| 535 | Ga0466963_0409914 | 3300044694 | Bacteria | 956 |
| 536 | Ga0466957_0960237 | 3300044842 | Bacteria | 613 |
| 537 | Ga0495580_0173127 | 3300046472 | Bacteria | 1492 |
| 538 | Ga0495580_0242374 | 3300046472 | Bacteria | 1236 |
| 539 | Ga0495669_0276952 | 3300046684 | Bacteria | 807 |
| 540 | Ga0496100_0620126 | 3300048903 | Bacteria | 841 |
| 541 | Ga0496101_0070730 | 3300048904 | Bacteria | 2556 |
| 542 | Ga0496101_0077721 | 3300048904 | Bacteria | 2446 |
| 543 | Ga0496102_0057587 | 3300048905 | Bacteria | 3549 |
| 544 | Ga0496103_0390054 | 3300048906 | Bacteria | 894 |
| 545 | Ga0496104_0011504 | 3300048907 | Bacteria | 7930 |
| 546 | Ga0496104_0324017 | 3300048907 | Bacteria | 1454 |
| 547 | Ga0496104_1414115 | 3300048907 | Bacteria | 599 |
| 548 | Ga0496106_0017225 | 3300048909 | Bacteria | 5349 |
| 549 | Ga0496106_0030287 | 3300048909 | Bacteria | 4036 |
| 550 | Ga0496106_0359935 | 3300048909 | Bacteria | 1169 |
| 551 | Ga0496107_0016770 | 3300048910 | Bacteria | 5149 |
| 552 | Ga0496107_0044879 | 3300048910 | Bacteria | 3178 |
| 553 | Ga0496108_0003801 | 3300048911 | Bacteria | 12089 |
| 554 | Ga0496108_0139295 | 3300048911 | Bacteria | 2090 |
| 555 | Ga0496108_1543572 | 3300048911 | Bacteria | 551 |
| 556 | Ga0496109_0002100 | 3300048912 | Bacteria | 16566 |
| 557 | Ga0496109_1303194 | 3300048912 | Bacteria | 662 |
| 558 | Ga0496110_0004792 | 3300048913 | Bacteria | 10535 |
| 559 | Ga0496110_0194977 | 3300048913 | Bacteria | 1839 |
| 560 | Ga0496111_0086050 | 3300048914 | Bacteria | 2299 |
| 561 | Ga0496112_0022147 | 3300048915 | Bacteria | 6053 |
| 562 | Ga0496113_0380611 | 3300048916 | Bacteria | 1133 |
| 563 | Ga0496114_0059776 | 3300048917 | Bacteria | 3184 |
| 564 | Ga0501034_0017729 | 3300049571 | Bacteria | 7303 |
| 565 | Ga0501047_0028565 | 3300049581 | Bacteria | 5380 |
| 566 | Ga0501067_0189199 | 3300049583 | Bacteria | 1146 |
| 567 | Ga0501068_0057313 | 3300049584 | Bacteria | 2362 |
| 568 | Ga0501069_0216664 | 3300049585 | Bacteria | 1112 |
| 569 | Ga0501070_0030130 | 3300049586 | Bacteria | 4547 |
| 570 | Ga0501070_1507587 | 3300049586 | Bacteria | 509 |
| 571 | Ga0501072_0004840 | 3300049588 | Bacteria | 10252 |
| 572 | Ga0501073_0006370 | 3300049589 | Bacteria | 8785 |
| 573 | Ga0501074_0164522 | 3300049590 | Bacteria | 1584 |
| 574 | Ga0501080_0007259 | 3300049742 | Bacteria | 9998 |
| 575 | Ga0501083_0011792 | 3300049744 | Bacteria | 6125 |
| 576 | nmdc:mga08y16_61486_c1 | 3300050511 | Bacteria | 3922 |
| 577 | nmdc:mga0n895_640849_c1 | 3300050512 | Bacteria | 1062 |
| 578 | nmdc:mga0n895_81040_c1 | 3300050512 | Bacteria | 3234 |
| 579 | nmdc:mga0rr50_526869_c1 | 3300050513 | Bacteria | 1005 |
| 580 | nmdc:mga0a205_893655_c1 | 3300050515 | Bacteria | 735 |
| 581 | Ga0495595_0135689 | 3300053084 | Bacteria | 1205 |
| 582 | Ga0495619_0415110 | 3300053085 | Bacteria | 929 |
| 583 | Ga0501084_0178794 | 3300054114 | Bacteria | 1791 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037312 | Ga0395899_0123580 | Ga0395899_0123580_190_627 | 132 |
| 2 | 3300037418 | Ga0395900_0116142 | Ga0395900_0116142_1869_2306 | 132 |
| 3 | 3300037466 | Ga0395898_0072294 | Ga0395898_0072294_2533_2970 | 132 |
| 4 | 3300038443 | Ga0395901_0139202 | Ga0395901_0139202_1969_2406 | 132 |
| 5 | 3300025908 | Ga0207643_10233186 | Ga0207643_102331862 | 144 |
| 6 | 3300005434 | Ga0070709_10065128 | Ga0070709_100651282 | 150 |
| 7 | 3300005437 | Ga0070710_10036685 | Ga0070710_100366852 | 150 |
| 8 | 3300005439 | Ga0070711_100082826 | Ga0070711_1000828264 | 150 |
| 9 | 3300005458 | Ga0070681_10160094 | Ga0070681_101600944 | 150 |
| 10 | 3300005518 | Ga0070699_100034428 | Ga0070699_1000344283 | 150 |
| 11 | 3300005546 | Ga0070696_100021047 | Ga0070696_1000210475 | 150 |
| 12 | 3300006237 | Ga0097621_100251433 | Ga0097621_1002514333 | 150 |
| 13 | 3300009093 | Ga0105240_10032172 | Ga0105240_100321722 | 150 |
| 14 | 3300009174 | Ga0105241_10364282 | Ga0105241_103642822 | 150 |
| 15 | 3300009545 | Ga0105237_10174282 | Ga0105237_101742821 | 150 |
| 16 | 3300013104 | Ga0157370_10113544 | Ga0157370_101135443 | 150 |
| 17 | 3300013296 | Ga0157374_10169054 | Ga0157374_101690543 | 150 |
| 18 | 3300013307 | Ga0157372_10046744 | Ga0157372_100467444 | 150 |
| 19 | 3300025898 | Ga0207692_10357021 | Ga0207692_103570212 | 150 |
| 20 | 3300025906 | Ga0207699_10112110 | Ga0207699_101121101 | 150 |
| 21 | 3300025916 | Ga0207663_10136827 | Ga0207663_101368272 | 150 |
| 22 | 3300025928 | Ga0207700_10299043 | Ga0207700_102990431 | 150 |
| 23 | 3300025929 | Ga0207664_10041829 | Ga0207664_100418296 | 150 |
| 24 | 3300027424 | Ga0209984_1012580 | Ga0209984_10125802 | 150 |
| 25 | 3300027471 | Ga0209995_1002596 | Ga0209995_10025962 | 150 |
| 26 | 3300027682 | Ga0209971_1000786 | Ga0209971_10007863 | 150 |
| 27 | 3300027717 | Ga0209998_10013992 | Ga0209998_100139923 | 150 |
| 28 | 3300048907 | Ga0496104_0324017 | Ga0496104_0324017_258_761 | 150 |
| 29 | 3300005335 | Ga0070666_10019763 | Ga0070666_100197631 | 151 |
| 30 | 3300005338 | Ga0068868_100459050 | Ga0068868_1004590502 | 151 |
| 31 | 3300005356 | Ga0070674_100009506 | Ga0070674_1000095065 | 151 |
| 32 | 3300005364 | Ga0070673_100970421 | Ga0070673_1009704212 | 151 |
| 33 | 3300005367 | Ga0070667_100031601 | Ga0070667_1000316015 | 151 |
| 34 | 3300005456 | Ga0070678_100005330 | Ga0070678_1000053304 | 151 |
| 35 | 3300005543 | Ga0070672_100031429 | Ga0070672_1000314293 | 151 |
| 36 | 3300005548 | Ga0070665_100064945 | Ga0070665_1000649454 | 151 |
| 37 | 3300005718 | Ga0068866_10128591 | Ga0068866_101285912 | 151 |
| 38 | 3300006237 | Ga0097621_100044991 | Ga0097621_1000449915 | 151 |
| 39 | 3300006358 | Ga0068871_100020681 | Ga0068871_1000206816 | 151 |
| 40 | 3300013296 | Ga0157374_10292891 | Ga0157374_102928912 | 151 |
| 41 | 3300013308 | Ga0157375_10516061 | Ga0157375_105160612 | 151 |
| 42 | 3300014969 | Ga0157376_10019347 | Ga0157376_100193474 | 151 |
| 43 | 3300025903 | Ga0207680_10040734 | Ga0207680_100407343 | 151 |
| 44 | 3300025927 | Ga0207687_10453432 | Ga0207687_104534321 | 151 |
| 45 | 3300025940 | Ga0207691_10033757 | Ga0207691_100337575 | 151 |
| 46 | 3300025960 | Ga0207651_10985404 | Ga0207651_109854041 | 151 |
| 47 | 3300025986 | Ga0207658_10021041 | Ga0207658_100210415 | 151 |
| 48 | 3300026121 | Ga0207683_10006316 | Ga0207683_100063166 | 151 |
| 49 | 3300028379 | Ga0268266_10013867 | Ga0268266_100138678 | 151 |
| 50 | 3300035118 | Ga0373954_0137809 | Ga0373954_0137809_128_631 | 151 |
| 51 | 3300035172 | Ga0373955_0201730 | Ga0373955_0201730_490_993 | 151 |
| 52 | 3300005458 | Ga0070681_10555821 | Ga0070681_105558211 | 154 |
| 53 | 3300005563 | Ga0068855_101122397 | Ga0068855_1011223972 | 154 |
| 54 | 3300005578 | Ga0068854_100726874 | Ga0068854_1007268742 | 154 |
| 55 | 3300013100 | Ga0157373_10476285 | Ga0157373_104762852 | 154 |
| 56 | 3300025912 | Ga0207707_10189561 | Ga0207707_101895611 | 154 |
| 57 | 3300025981 | Ga0207640_10806441 | Ga0207640_108064411 | 154 |
| 58 | 3300049583 | Ga0501067_0189199 | Ga0501067_0189199_382_855 | 154 |
| 59 | 3300031731 | Ga0307405_10005591 | Ga0307405_100055913 | 155 |
| 60 | 3300031852 | Ga0307410_10001203 | Ga0307410_100012036 | 155 |
| 61 | 3300031903 | Ga0307407_10000203 | Ga0307407_1000020312 | 155 |
| 62 | 3300031911 | Ga0307412_10011210 | Ga0307412_100112103 | 155 |
| 63 | 3300031995 | Ga0307409_100410711 | Ga0307409_1004107113 | 155 |
| 64 | 3300032002 | Ga0307416_100001590 | Ga0307416_1000015904 | 155 |
| 65 | 3300032005 | Ga0307411_10004280 | Ga0307411_100042803 | 155 |
| 66 | 3300032126 | Ga0307415_100003471 | Ga0307415_1000034715 | 155 |
| 67 | 3300035691 | Ga0373931_0019306 | Ga0373931_0019306_570_1070 | 155 |
| 68 | 3300044694 | Ga0466963_0409914 | Ga0466963_0409914_16_528 | 155 |
| 69 | 3300049571 | Ga0501034_0017729 | Ga0501034_0017729_3850_4329 | 155 |
| 70 | 3300049581 | Ga0501047_0028565 | Ga0501047_0028565_2837_3316 | 155 |
| 71 | 3300049584 | Ga0501068_0057313 | Ga0501068_0057313_54_533 | 155 |
| 72 | 3300049585 | Ga0501069_0216664 | Ga0501069_0216664_526_1005 | 155 |
| 73 | 3300049586 | Ga0501070_0030130 | Ga0501070_0030130_1162_1641 | 155 |
| 74 | 3300049586 | Ga0501070_1507587 | Ga0501070_1507587_17_496 | 155 |
| 75 | 3300049588 | Ga0501072_0004840 | Ga0501072_0004840_2571_3050 | 155 |
| 76 | 3300049589 | Ga0501073_0006370 | Ga0501073_0006370_3572_4051 | 155 |
| 77 | 3300049590 | Ga0501074_0164522 | Ga0501074_0164522_880_1359 | 155 |
| 78 | 3300049742 | Ga0501080_0007259 | Ga0501080_0007259_2007_2486 | 155 |
| 79 | 3300049744 | Ga0501083_0011792 | Ga0501083_0011792_1945_2424 | 155 |
| 80 | 3300054114 | Ga0501084_0178794 | Ga0501084_0178794_407_886 | 155 |
| 81 | 3300026078 | Ga0207702_10542452 | Ga0207702_105424522 | 156 |
| 82 | 3300027552 | Ga0209982_1028217 | Ga0209982_10282172 | 157 |
| 83 | 3300005330 | Ga0070690_100023121 | Ga0070690_1000231213 | 158 |
| 84 | 3300014497 | Ga0182008_10263546 | Ga0182008_102635462 | 159 |
| 85 | 3300031824 | Ga0307413_10032300 | Ga0307413_100323005 | 159 |
| 86 | 3300031852 | Ga0307410_10217434 | Ga0307410_102174342 | 159 |
| 87 | 3300032002 | Ga0307416_101706426 | Ga0307416_1017064262 | 159 |
| 88 | 3300032004 | Ga0307414_10189685 | Ga0307414_101896853 | 159 |
| 89 | 3300010375 | Ga0105239_10571229 | Ga0105239_105712293 | 160 |
| 90 | 3300013307 | Ga0157372_10974071 | Ga0157372_109740712 | 160 |
| 91 | 3300035172 | Ga0373955_0550498 | Ga0373955_0550498_55_540 | 160 |
| 92 | 3300035172 | Ga0373955_0601492 | Ga0373955_0601492_78_566 | 160 |
| 93 | 3300036401 | Ga0373937_0112656 | Ga0373937_0112656_77_565 | 160 |
| 94 | 3300005329 | Ga0070683_100013983 | Ga0070683_1000139834 | 161 |
| 95 | 3300005344 | Ga0070661_100001471 | Ga0070661_10000147115 | 161 |
| 96 | 3300005366 | Ga0070659_100115990 | Ga0070659_1001159903 | 161 |
| 97 | 3300005435 | Ga0070714_100014951 | Ga0070714_1000149514 | 161 |
| 98 | 3300005457 | Ga0070662_100777455 | Ga0070662_1007774551 | 161 |
| 99 | 3300005530 | Ga0070679_100044282 | Ga0070679_1000442824 | 161 |
| 100 | 3300005535 | Ga0070684_100072246 | Ga0070684_1000722463 | 161 |
| 101 | 3300005539 | Ga0068853_100020039 | Ga0068853_1000200394 | 161 |
| 102 | 3300005547 | Ga0070693_100084621 | Ga0070693_1000846213 | 161 |
| 103 | 3300005577 | Ga0068857_100000465 | Ga0068857_10000046523 | 161 |
| 104 | 3300005616 | Ga0068852_100016442 | Ga0068852_1000164425 | 161 |
| 105 | 3300009093 | Ga0105240_10014137 | Ga0105240_100141378 | 161 |
| 106 | 3300009174 | Ga0105241_10146102 | Ga0105241_101461023 | 161 |
| 107 | 3300009545 | Ga0105237_10340953 | Ga0105237_103409533 | 161 |
| 108 | 3300009551 | Ga0105238_10000495 | Ga0105238_1000049513 | 161 |
| 109 | 3300010375 | Ga0105239_10301609 | Ga0105239_103016093 | 161 |
| 110 | 3300013104 | Ga0157370_10025794 | Ga0157370_100257943 | 161 |
| 111 | 3300013307 | Ga0157372_10008814 | Ga0157372_1000881410 | 161 |
| 112 | 3300014497 | Ga0182008_10062675 | Ga0182008_100626753 | 161 |
| 113 | 3300025911 | Ga0207654_10106864 | Ga0207654_101068643 | 161 |
| 114 | 3300025912 | Ga0207707_10170450 | Ga0207707_101704503 | 161 |
| 115 | 3300025913 | Ga0207695_10031079 | Ga0207695_100310794 | 161 |
| 116 | 3300025914 | Ga0207671_10261930 | Ga0207671_102619303 | 161 |
| 117 | 3300025920 | Ga0207649_10126162 | Ga0207649_101261622 | 161 |
| 118 | 3300025921 | Ga0207652_10113159 | Ga0207652_101131594 | 161 |
| 119 | 3300025924 | Ga0207694_10247700 | Ga0207694_102477001 | 161 |
| 120 | 3300025929 | Ga0207664_10015101 | Ga0207664_100151014 | 161 |
| 121 | 3300025932 | Ga0207690_10144241 | Ga0207690_101442412 | 161 |
| 122 | 3300025944 | Ga0207661_10018568 | Ga0207661_100185687 | 161 |
| 123 | 3300025949 | Ga0207667_10000842 | Ga0207667_1000084234 | 161 |
| 124 | 3300025981 | Ga0207640_10063995 | Ga0207640_100639955 | 161 |
| 125 | 3300026041 | Ga0207639_10053019 | Ga0207639_100530195 | 161 |
| 126 | 3300026078 | Ga0207702_10006833 | Ga0207702_1000683310 | 161 |
| 127 | 3300026116 | Ga0207674_10000182 | Ga0207674_1000018232 | 161 |
| 128 | 3300026142 | Ga0207698_10007390 | Ga0207698_100073904 | 161 |
| 129 | 3300048916 | Ga0496113_0380611 | Ga0496113_0380611_56_565 | 161 |
| 130 | 3300005564 | Ga0070664_100330583 | Ga0070664_1003305833 | 163 |
| 131 | 3300005577 | Ga0068857_100156898 | Ga0068857_1001568984 | 163 |
| 132 | 3300005616 | Ga0068852_100177535 | Ga0068852_1001775353 | 163 |
| 133 | 3300013105 | Ga0157369_10665000 | Ga0157369_106650003 | 163 |
| 134 | 3300014969 | Ga0157376_12519627 | Ga0157376_125196271 | 163 |
| 135 | 3300025945 | Ga0207679_10014127 | Ga0207679_100141277 | 163 |
| 136 | 3300026116 | Ga0207674_10131068 | Ga0207674_101310682 | 163 |
| 137 | 3300048911 | Ga0496108_1543572 | Ga0496108_1543572_39_530 | 163 |
| 138 | 3300048912 | Ga0496109_1303194 | Ga0496109_1303194_51_542 | 163 |
| 139 | 3300048915 | Ga0496112_0022147 | Ga0496112_0022147_652_1143 | 163 |
| 140 | 3300053085 | Ga0495619_0415110 | Ga0495619_0415110_52_546 | 163 |
| 141 | 3300005329 | Ga0070683_101222202 | Ga0070683_1012222021 | 164 |
| 142 | 3300005331 | Ga0070670_100042370 | Ga0070670_1000423702 | 164 |
| 143 | 3300005331 | Ga0070670_100222608 | Ga0070670_1002226082 | 164 |
| 144 | 3300005334 | Ga0068869_100003831 | Ga0068869_1000038313 | 164 |
| 145 | 3300005335 | Ga0070666_10002948 | Ga0070666_100029485 | 164 |
| 146 | 3300005338 | Ga0068868_100003299 | Ga0068868_1000032995 | 164 |
| 147 | 3300005339 | Ga0070660_100013791 | Ga0070660_1000137915 | 164 |
| 148 | 3300005344 | Ga0070661_100033740 | Ga0070661_1000337404 | 164 |
| 149 | 3300005347 | Ga0070668_100001131 | Ga0070668_10000113117 | 164 |
| 150 | 3300005353 | Ga0070669_100005744 | Ga0070669_1000057444 | 164 |
| 151 | 3300005354 | Ga0070675_100012131 | Ga0070675_1000121313 | 164 |
| 152 | 3300005355 | Ga0070671_100004532 | Ga0070671_1000045329 | 164 |
| 153 | 3300005355 | Ga0070671_100010513 | Ga0070671_1000105136 | 164 |
| 154 | 3300005356 | Ga0070674_100003089 | Ga0070674_1000030894 | 164 |
| 155 | 3300005364 | Ga0070673_100024376 | Ga0070673_1000243765 | 164 |
| 156 | 3300005365 | Ga0070688_100029185 | Ga0070688_1000291854 | 164 |
| 157 | 3300005366 | Ga0070659_100004569 | Ga0070659_1000045696 | 164 |
| 158 | 3300005367 | Ga0070667_100047276 | Ga0070667_1000472763 | 164 |
| 159 | 3300005445 | Ga0070708_100000731 | Ga0070708_10000073111 | 164 |
| 160 | 3300005455 | Ga0070663_100034726 | Ga0070663_1000347262 | 164 |
| 161 | 3300005455 | Ga0070663_100276822 | Ga0070663_1002768222 | 164 |
| 162 | 3300005456 | Ga0070678_100000550 | Ga0070678_1000005504 | 164 |
| 163 | 3300005457 | Ga0070662_100003464 | Ga0070662_1000034649 | 164 |
| 164 | 3300005458 | Ga0070681_10234749 | Ga0070681_102347493 | 164 |
| 165 | 3300005459 | Ga0068867_100001145 | Ga0068867_10000114516 | 164 |
| 166 | 3300005466 | Ga0070685_10017469 | Ga0070685_100174693 | 164 |
| 167 | 3300005518 | Ga0070699_100622173 | Ga0070699_1006221732 | 164 |
| 168 | 3300005539 | Ga0068853_100029634 | Ga0068853_1000296343 | 164 |
| 169 | 3300005543 | Ga0070672_100001458 | Ga0070672_10000145810 | 164 |
| 170 | 3300005543 | Ga0070672_100189319 | Ga0070672_1001893193 | 164 |
| 171 | 3300005548 | Ga0070665_100001395 | Ga0070665_1000013959 | 164 |
| 172 | 3300005564 | Ga0070664_100022377 | Ga0070664_1000223772 | 164 |
| 173 | 3300005614 | Ga0068856_100000125 | Ga0068856_1000001252 | 164 |
| 174 | 3300005615 | Ga0070702_100338405 | Ga0070702_1003384051 | 164 |
| 175 | 3300005616 | Ga0068852_100325817 | Ga0068852_1003258173 | 164 |
| 176 | 3300005617 | Ga0068859_100005307 | Ga0068859_1000053079 | 164 |
| 177 | 3300005618 | Ga0068864_100007610 | Ga0068864_1000076109 | 164 |
| 178 | 3300005718 | Ga0068866_10359268 | Ga0068866_103592682 | 164 |
| 179 | 3300005719 | Ga0068861_100240334 | Ga0068861_1002403342 | 164 |
| 180 | 3300005834 | Ga0068851_10041195 | Ga0068851_100411953 | 164 |
| 181 | 3300005840 | Ga0068870_10060990 | Ga0068870_100609902 | 164 |
| 182 | 3300005842 | Ga0068858_100005787 | Ga0068858_1000057876 | 164 |
| 183 | 3300005843 | Ga0068860_100010721 | Ga0068860_1000107214 | 164 |
| 184 | 3300006237 | Ga0097621_100002227 | Ga0097621_10000222711 | 164 |
| 185 | 3300006358 | Ga0068871_100011822 | Ga0068871_1000118224 | 164 |
| 186 | 3300006881 | Ga0068865_100003988 | Ga0068865_1000039884 | 164 |
| 187 | 3300006931 | Ga0097620_100005307 | Ga0097620_1000053079 | 164 |
| 188 | 3300009098 | Ga0105245_10063107 | Ga0105245_100631073 | 164 |
| 189 | 3300009177 | Ga0105248_10017740 | Ga0105248_100177408 | 164 |
| 190 | 3300009553 | Ga0105249_10175316 | Ga0105249_101753162 | 164 |
| 191 | 3300010375 | Ga0105239_10433722 | Ga0105239_104337223 | 164 |
| 192 | 3300013100 | Ga0157373_10003939 | Ga0157373_100039396 | 164 |
| 193 | 3300013102 | Ga0157371_10001964 | Ga0157371_1000196411 | 164 |
| 194 | 3300013105 | Ga0157369_10169453 | Ga0157369_101694532 | 164 |
| 195 | 3300013296 | Ga0157374_10005777 | Ga0157374_100057779 | 164 |
| 196 | 3300013297 | Ga0157378_10670215 | Ga0157378_106702153 | 164 |
| 197 | 3300013306 | Ga0163162_10008638 | Ga0163162_100086389 | 164 |
| 198 | 3300013306 | Ga0163162_10596167 | Ga0163162_105961672 | 164 |
| 199 | 3300013307 | Ga0157372_10003272 | Ga0157372_1000327215 | 164 |
| 200 | 3300013308 | Ga0157375_10017367 | Ga0157375_100173674 | 164 |
| 201 | 3300013308 | Ga0157375_12114494 | Ga0157375_121144942 | 164 |
| 202 | 3300014326 | Ga0157380_10552358 | Ga0157380_105523583 | 164 |
| 203 | 3300014968 | Ga0157379_10006361 | Ga0157379_100063615 | 164 |
| 204 | 3300017792 | Ga0163161_10072192 | Ga0163161_100721924 | 164 |
| 205 | 3300025321 | Ga0207656_10134965 | Ga0207656_101349651 | 164 |
| 206 | 3300025321 | Ga0207656_10141812 | Ga0207656_101418121 | 164 |
| 207 | 3300025899 | Ga0207642_10246592 | Ga0207642_102465922 | 164 |
| 208 | 3300025903 | Ga0207680_10004083 | Ga0207680_100040837 | 164 |
| 209 | 3300025907 | Ga0207645_10001212 | Ga0207645_1000121216 | 164 |
| 210 | 3300025907 | Ga0207645_10104954 | Ga0207645_101049543 | 164 |
| 211 | 3300025908 | Ga0207643_10010876 | Ga0207643_100108767 | 164 |
| 212 | 3300025912 | Ga0207707_10154012 | Ga0207707_101540122 | 164 |
| 213 | 3300025919 | Ga0207657_10023357 | Ga0207657_100233575 | 164 |
| 214 | 3300025920 | Ga0207649_10007330 | Ga0207649_100073305 | 164 |
| 215 | 3300025923 | Ga0207681_10004098 | Ga0207681_100040989 | 164 |
| 216 | 3300025925 | Ga0207650_10008074 | Ga0207650_100080748 | 164 |
| 217 | 3300025925 | Ga0207650_10098254 | Ga0207650_100982543 | 164 |
| 218 | 3300025926 | Ga0207659_10002127 | Ga0207659_1000212710 | 164 |
| 219 | 3300025926 | Ga0207659_10029352 | Ga0207659_100293524 | 164 |
| 220 | 3300025931 | Ga0207644_10014150 | Ga0207644_100141505 | 164 |
| 221 | 3300025932 | Ga0207690_10001716 | Ga0207690_1000171612 | 164 |
| 222 | 3300025933 | Ga0207706_10000133 | Ga0207706_1000013333 | 164 |
| 223 | 3300025937 | Ga0207669_10002496 | Ga0207669_100024964 | 164 |
| 224 | 3300025938 | Ga0207704_10002146 | Ga0207704_100021463 | 164 |
| 225 | 3300025940 | Ga0207691_10000170 | Ga0207691_1000017036 | 164 |
| 226 | 3300025940 | Ga0207691_10194763 | Ga0207691_101947632 | 164 |
| 227 | 3300025941 | Ga0207711_10011403 | Ga0207711_100114033 | 164 |
| 228 | 3300025942 | Ga0207689_10003037 | Ga0207689_100030379 | 164 |
| 229 | 3300025945 | Ga0207679_10002499 | Ga0207679_1000249912 | 164 |
| 230 | 3300025949 | Ga0207667_10055675 | Ga0207667_100556756 | 164 |
| 231 | 3300025960 | Ga0207651_10035355 | Ga0207651_100353553 | 164 |
| 232 | 3300025972 | Ga0207668_10003080 | Ga0207668_100030806 | 164 |
| 233 | 3300025986 | Ga0207658_10004449 | Ga0207658_100044496 | 164 |
| 234 | 3300026023 | Ga0207677_10005466 | Ga0207677_100054666 | 164 |
| 235 | 3300026035 | Ga0207703_10003353 | Ga0207703_1000335311 | 164 |
| 236 | 3300026041 | Ga0207639_10003306 | Ga0207639_100033065 | 164 |
| 237 | 3300026067 | Ga0207678_10001121 | Ga0207678_100011217 | 164 |
| 238 | 3300026075 | Ga0207708_10779664 | Ga0207708_107796642 | 164 |
| 239 | 3300026078 | Ga0207702_10003101 | Ga0207702_1000310112 | 164 |
| 240 | 3300026088 | Ga0207641_10004021 | Ga0207641_100040213 | 164 |
| 241 | 3300026088 | Ga0207641_10387273 | Ga0207641_103872732 | 164 |
| 242 | 3300026089 | Ga0207648_10000203 | Ga0207648_1000020329 | 164 |
| 243 | 3300026095 | Ga0207676_10009806 | Ga0207676_100098064 | 164 |
| 244 | 3300026118 | Ga0207675_100139819 | Ga0207675_1001398193 | 164 |
| 245 | 3300026121 | Ga0207683_10000428 | Ga0207683_1000042816 | 164 |
| 246 | 3300026142 | Ga0207698_10064370 | Ga0207698_100643705 | 164 |
| 247 | 3300028379 | Ga0268266_10023138 | Ga0268266_100231384 | 164 |
| 248 | 3300028381 | Ga0268264_10005632 | Ga0268264_100056323 | 164 |
| 249 | 3300035207 | Ga0373942_0134447 | Ga0373942_0134447_76_579 | 164 |
| 250 | 3300035691 | Ga0373931_0453851 | Ga0373931_0453851_11_517 | 164 |
| 251 | 3300048904 | Ga0496101_0070730 | Ga0496101_0070730_634_1131 | 164 |
| 252 | 3300048906 | Ga0496103_0390054 | Ga0496103_0390054_229_735 | 164 |
| 253 | 3300048907 | Ga0496104_1414115 | Ga0496104_1414115_36_542 | 164 |
| 254 | 3300048909 | Ga0496106_0017225 | Ga0496106_0017225_3992_4498 | 164 |
| 255 | 3300048909 | Ga0496106_0359935 | Ga0496106_0359935_621_1118 | 164 |
| 256 | 3300048910 | Ga0496107_0016770 | Ga0496107_0016770_2312_2818 | 164 |
| 257 | 3300048911 | Ga0496108_0139295 | Ga0496108_0139295_1273_1770 | 164 |
| 258 | 3300048913 | Ga0496110_0194977 | Ga0496110_0194977_130_627 | 164 |
| 259 | 3300005355 | Ga0070671_100401577 | Ga0070671_1004015772 | 165 |
| 260 | 3300025931 | Ga0207644_10235335 | Ga0207644_102353353 | 165 |
| 261 | 3300026041 | Ga0207639_10256481 | Ga0207639_102564813 | 165 |
| 262 | 3300050513 | nmdc:mga0rr50_526869_c1 | nmdc:mga0rr50_526869_c1_65_568 | 165 |
| 263 | 3300001976 | JGI24752J21851_1002390 | JGI24752J21851_10023904 | 166 |
| 264 | 3300001991 | JGI24743J22301_10004644 | JGI24743J22301_100046443 | 166 |
| 265 | 3300002076 | JGI24749J21850_1005128 | JGI24749J21850_10051283 | 166 |
| 266 | 3300002126 | JGI24035J26624_1002883 | JGI24035J26624_10028832 | 166 |
| 267 | 3300005290 | Ga0065712_10091630 | Ga0065712_100916303 | 166 |
| 268 | 3300005293 | Ga0065715_10140802 | Ga0065715_101408023 | 166 |
| 269 | 3300005327 | Ga0070658_10003752 | Ga0070658_100037529 | 166 |
| 270 | 3300005327 | Ga0070658_10138820 | Ga0070658_101388203 | 166 |
| 271 | 3300005327 | Ga0070658_10214452 | Ga0070658_102144522 | 166 |
| 272 | 3300005329 | Ga0070683_100190181 | Ga0070683_1001901812 | 166 |
| 273 | 3300005329 | Ga0070683_100231789 | Ga0070683_1002317892 | 166 |
| 274 | 3300005329 | Ga0070683_100369848 | Ga0070683_1003698482 | 166 |
| 275 | 3300005330 | Ga0070690_100015636 | Ga0070690_1000156366 | 166 |
| 276 | 3300005331 | Ga0070670_100066203 | Ga0070670_1000662035 | 166 |
| 277 | 3300005331 | Ga0070670_100119753 | Ga0070670_1001197534 | 166 |
| 278 | 3300005333 | Ga0070677_10022140 | Ga0070677_100221403 | 166 |
| 279 | 3300005334 | Ga0068869_100039952 | Ga0068869_1000399521 | 166 |
| 280 | 3300005334 | Ga0068869_100839054 | Ga0068869_1008390541 | 166 |
| 281 | 3300005335 | Ga0070666_10207090 | Ga0070666_102070902 | 166 |
| 282 | 3300005335 | Ga0070666_10251540 | Ga0070666_102515402 | 166 |
| 283 | 3300005336 | Ga0070680_100027835 | Ga0070680_1000278354 | 166 |
| 284 | 3300005337 | Ga0070682_100903059 | Ga0070682_1009030591 | 166 |
| 285 | 3300005338 | Ga0068868_100146109 | Ga0068868_1001461093 | 166 |
| 286 | 3300005339 | Ga0070660_100053089 | Ga0070660_1000530891 | 166 |
| 287 | 3300005339 | Ga0070660_100059225 | Ga0070660_1000592255 | 166 |
| 288 | 3300005339 | Ga0070660_100114916 | Ga0070660_1001149161 | 166 |
| 289 | 3300005339 | Ga0070660_100161784 | Ga0070660_1001617844 | 166 |
| 290 | 3300005339 | Ga0070660_100309531 | Ga0070660_1003095312 | 166 |
| 291 | 3300005339 | Ga0070660_100777524 | Ga0070660_1007775241 | 166 |
| 292 | 3300005340 | Ga0070689_100002823 | Ga0070689_10000282311 | 166 |
| 293 | 3300005341 | Ga0070691_10245292 | Ga0070691_102452922 | 166 |
| 294 | 3300005344 | Ga0070661_100058684 | Ga0070661_1000586845 | 166 |
| 295 | 3300005344 | Ga0070661_100069378 | Ga0070661_1000693784 | 166 |
| 296 | 3300005344 | Ga0070661_100117706 | Ga0070661_1001177063 | 166 |
| 297 | 3300005344 | Ga0070661_100180123 | Ga0070661_1001801232 | 166 |
| 298 | 3300005353 | Ga0070669_100107964 | Ga0070669_1001079643 | 166 |
| 299 | 3300005353 | Ga0070669_100625899 | Ga0070669_1006258991 | 166 |
| 300 | 3300005354 | Ga0070675_100222891 | Ga0070675_1002228913 | 166 |
| 301 | 3300005354 | Ga0070675_100292175 | Ga0070675_1002921753 | 166 |
| 302 | 3300005355 | Ga0070671_100007222 | Ga0070671_10000722210 | 166 |
| 303 | 3300005355 | Ga0070671_100179292 | Ga0070671_1001792923 | 166 |
| 304 | 3300005356 | Ga0070674_100028420 | Ga0070674_1000284204 | 166 |
| 305 | 3300005364 | Ga0070673_100137778 | Ga0070673_1001377783 | 166 |
| 306 | 3300005364 | Ga0070673_100238090 | Ga0070673_1002380902 | 166 |
| 307 | 3300005364 | Ga0070673_101607106 | Ga0070673_1016071061 | 166 |
| 308 | 3300005365 | Ga0070688_100001955 | Ga0070688_1000019554 | 166 |
| 309 | 3300005366 | Ga0070659_100019993 | Ga0070659_1000199936 | 166 |
| 310 | 3300005366 | Ga0070659_100036791 | Ga0070659_1000367916 | 166 |
| 311 | 3300005366 | Ga0070659_100043306 | Ga0070659_1000433063 | 166 |
| 312 | 3300005366 | Ga0070659_100106858 | Ga0070659_1001068584 | 166 |
| 313 | 3300005366 | Ga0070659_100146686 | Ga0070659_1001466862 | 166 |
| 314 | 3300005366 | Ga0070659_100147610 | Ga0070659_1001476103 | 166 |
| 315 | 3300005366 | Ga0070659_100517925 | Ga0070659_1005179251 | 166 |
| 316 | 3300005367 | Ga0070667_100171093 | Ga0070667_1001710934 | 166 |
| 317 | 3300005434 | Ga0070709_10060146 | Ga0070709_100601463 | 166 |
| 318 | 3300005434 | Ga0070709_10393969 | Ga0070709_103939691 | 166 |
| 319 | 3300005435 | Ga0070714_100019491 | Ga0070714_1000194914 | 166 |
| 320 | 3300005435 | Ga0070714_100508328 | Ga0070714_1005083281 | 166 |
| 321 | 3300005435 | Ga0070714_100535891 | Ga0070714_1005358912 | 166 |
| 322 | 3300005439 | Ga0070711_100214405 | Ga0070711_1002144053 | 166 |
| 323 | 3300005441 | Ga0070700_100008699 | Ga0070700_1000086994 | 166 |
| 324 | 3300005457 | Ga0070662_100080518 | Ga0070662_1000805181 | 166 |
| 325 | 3300005458 | Ga0070681_10007825 | Ga0070681_1000782513 | 166 |
| 326 | 3300005458 | Ga0070681_10711777 | Ga0070681_107117772 | 166 |
| 327 | 3300005458 | Ga0070681_10871204 | Ga0070681_108712042 | 166 |
| 328 | 3300005459 | Ga0068867_100341082 | Ga0068867_1003410822 | 166 |
| 329 | 3300005466 | Ga0070685_10007504 | Ga0070685_100075045 | 166 |
| 330 | 3300005530 | Ga0070679_100031289 | Ga0070679_1000312892 | 166 |
| 331 | 3300005530 | Ga0070679_100038137 | Ga0070679_1000381375 | 166 |
| 332 | 3300005530 | Ga0070679_100040034 | Ga0070679_1000400342 | 166 |
| 333 | 3300005530 | Ga0070679_100179248 | Ga0070679_1001792481 | 166 |
| 334 | 3300005530 | Ga0070679_100466004 | Ga0070679_1004660042 | 166 |
| 335 | 3300005535 | Ga0070684_100608165 | Ga0070684_1006081652 | 166 |
| 336 | 3300005539 | Ga0068853_100013226 | Ga0068853_1000132261 | 166 |
| 337 | 3300005539 | Ga0068853_100127208 | Ga0068853_1001272084 | 166 |
| 338 | 3300005543 | Ga0070672_100006692 | Ga0070672_1000066926 | 166 |
| 339 | 3300005544 | Ga0070686_100102045 | Ga0070686_1001020453 | 166 |
| 340 | 3300005548 | Ga0070665_100083004 | Ga0070665_1000830044 | 166 |
| 341 | 3300005563 | Ga0068855_100017552 | Ga0068855_1000175526 | 166 |
| 342 | 3300005563 | Ga0068855_100069548 | Ga0068855_1000695486 | 166 |
| 343 | 3300005563 | Ga0068855_100125811 | Ga0068855_1001258114 | 166 |
| 344 | 3300005563 | Ga0068855_100173260 | Ga0068855_1001732602 | 166 |
| 345 | 3300005563 | Ga0068855_100472479 | Ga0068855_1004724792 | 166 |
| 346 | 3300005563 | Ga0068855_101252395 | Ga0068855_1012523951 | 166 |
| 347 | 3300005564 | Ga0070664_100033744 | Ga0070664_1000337443 | 166 |
| 348 | 3300005564 | Ga0070664_100057956 | Ga0070664_1000579563 | 166 |
| 349 | 3300005564 | Ga0070664_100104149 | Ga0070664_1001041493 | 166 |
| 350 | 3300005564 | Ga0070664_100117485 | Ga0070664_1001174852 | 166 |
| 351 | 3300005564 | Ga0070664_100245765 | Ga0070664_1002457651 | 166 |
| 352 | 3300005564 | Ga0070664_100641342 | Ga0070664_1006413421 | 166 |
| 353 | 3300005564 | Ga0070664_100798204 | Ga0070664_1007982042 | 166 |
| 354 | 3300005577 | Ga0068857_100035965 | Ga0068857_1000359651 | 166 |
| 355 | 3300005577 | Ga0068857_100160303 | Ga0068857_1001603032 | 166 |
| 356 | 3300005577 | Ga0068857_100316065 | Ga0068857_1003160653 | 166 |
| 357 | 3300005578 | Ga0068854_100028699 | Ga0068854_1000286994 | 166 |
| 358 | 3300005578 | Ga0068854_100416884 | Ga0068854_1004168842 | 166 |
| 359 | 3300005578 | Ga0068854_101063692 | Ga0068854_1010636922 | 166 |
| 360 | 3300005614 | Ga0068856_100060384 | Ga0068856_1000603846 | 166 |
| 361 | 3300005614 | Ga0068856_100105927 | Ga0068856_1001059274 | 166 |
| 362 | 3300005616 | Ga0068852_100036370 | Ga0068852_1000363706 | 166 |
| 363 | 3300005616 | Ga0068852_100039892 | Ga0068852_1000398925 | 166 |
| 364 | 3300005616 | Ga0068852_100247367 | Ga0068852_1002473672 | 166 |
| 365 | 3300005616 | Ga0068852_100336827 | Ga0068852_1003368272 | 166 |
| 366 | 3300005616 | Ga0068852_100842660 | Ga0068852_1008426602 | 166 |
| 367 | 3300005616 | Ga0068852_100877272 | Ga0068852_1008772722 | 166 |
| 368 | 3300005617 | Ga0068859_100279055 | Ga0068859_1002790553 | 166 |
| 369 | 3300005618 | Ga0068864_100021513 | Ga0068864_1000215131 | 166 |
| 370 | 3300005618 | Ga0068864_101388788 | Ga0068864_1013887881 | 166 |
| 371 | 3300005719 | Ga0068861_100027250 | Ga0068861_1000272502 | 166 |
| 372 | 3300005834 | Ga0068851_10001567 | Ga0068851_100015679 | 166 |
| 373 | 3300005834 | Ga0068851_10004364 | Ga0068851_100043644 | 166 |
| 374 | 3300005834 | Ga0068851_10018654 | Ga0068851_100186545 | 166 |
| 375 | 3300005834 | Ga0068851_10030813 | Ga0068851_100308133 | 166 |
| 376 | 3300005834 | Ga0068851_10236518 | Ga0068851_102365182 | 166 |
| 377 | 3300005840 | Ga0068870_10178316 | Ga0068870_101783163 | 166 |
| 378 | 3300005842 | Ga0068858_100116074 | Ga0068858_1001160743 | 166 |
| 379 | 3300005844 | Ga0068862_100024936 | Ga0068862_1000249366 | 166 |
| 380 | 3300005844 | Ga0068862_100796358 | Ga0068862_1007963582 | 166 |
| 381 | 3300006173 | Ga0070716_100038139 | Ga0070716_1000381392 | 166 |
| 382 | 3300006175 | Ga0070712_100265969 | Ga0070712_1002659692 | 166 |
| 383 | 3300006237 | Ga0097621_101039698 | Ga0097621_1010396981 | 166 |
| 384 | 3300006237 | Ga0097621_101113892 | Ga0097621_1011138921 | 166 |
| 385 | 3300006358 | Ga0068871_100117896 | Ga0068871_1001178963 | 166 |
| 386 | 3300006852 | Ga0075433_10740576 | Ga0075433_107405761 | 166 |
| 387 | 3300006871 | Ga0075434_100140265 | Ga0075434_1001402653 | 166 |
| 388 | 3300006871 | Ga0075434_100669387 | Ga0075434_1006693872 | 166 |
| 389 | 3300006931 | Ga0097620_100279082 | Ga0097620_1002790823 | 166 |
| 390 | 3300009093 | Ga0105240_10308528 | Ga0105240_103085283 | 166 |
| 391 | 3300009094 | Ga0111539_10002947 | Ga0111539_1000294715 | 166 |
| 392 | 3300009094 | Ga0111539_10485242 | Ga0111539_104852423 | 166 |
| 393 | 3300009148 | Ga0105243_10183833 | Ga0105243_101838333 | 166 |
| 394 | 3300009174 | Ga0105241_10061671 | Ga0105241_100616715 | 166 |
| 395 | 3300009174 | Ga0105241_10397221 | Ga0105241_103972213 | 166 |
| 396 | 3300009177 | Ga0105248_10001562 | Ga0105248_1000156213 | 166 |
| 397 | 3300009177 | Ga0105248_10789439 | Ga0105248_107894392 | 166 |
| 398 | 3300009545 | Ga0105237_10044821 | Ga0105237_100448215 | 166 |
| 399 | 3300009545 | Ga0105237_10134500 | Ga0105237_101345004 | 166 |
| 400 | 3300009545 | Ga0105237_11883096 | Ga0105237_118830961 | 166 |
| 401 | 3300009551 | Ga0105238_10719657 | Ga0105238_107196572 | 166 |
| 402 | 3300009553 | Ga0105249_10094719 | Ga0105249_100947195 | 166 |
| 403 | 3300010375 | Ga0105239_10195414 | Ga0105239_101954141 | 166 |
| 404 | 3300011119 | Ga0105246_11304431 | Ga0105246_113044311 | 166 |
| 405 | 3300013100 | Ga0157373_10001602 | Ga0157373_1000160217 | 166 |
| 406 | 3300013100 | Ga0157373_10113744 | Ga0157373_101137443 | 166 |
| 407 | 3300013102 | Ga0157371_10069943 | Ga0157371_100699433 | 166 |
| 408 | 3300013102 | Ga0157371_10330864 | Ga0157371_103308641 | 166 |
| 409 | 3300013104 | Ga0157370_10127528 | Ga0157370_101275283 | 166 |
| 410 | 3300013105 | Ga0157369_10028044 | Ga0157369_100280443 | 166 |
| 411 | 3300013105 | Ga0157369_10430712 | Ga0157369_104307123 | 166 |
| 412 | 3300013105 | Ga0157369_11323092 | Ga0157369_113230922 | 166 |
| 413 | 3300013296 | Ga0157374_10093490 | Ga0157374_100934903 | 166 |
| 414 | 3300013306 | Ga0163162_10389067 | Ga0163162_103890672 | 166 |
| 415 | 3300013307 | Ga0157372_10026178 | Ga0157372_100261785 | 166 |
| 416 | 3300013307 | Ga0157372_10073874 | Ga0157372_100738743 | 166 |
| 417 | 3300013307 | Ga0157372_10179304 | Ga0157372_101793042 | 166 |
| 418 | 3300013307 | Ga0157372_10180439 | Ga0157372_101804392 | 166 |
| 419 | 3300013307 | Ga0157372_10186020 | Ga0157372_101860202 | 166 |
| 420 | 3300013307 | Ga0157372_10888989 | Ga0157372_108889892 | 166 |
| 421 | 3300013308 | Ga0157375_10223311 | Ga0157375_102233114 | 166 |
| 422 | 3300014326 | Ga0157380_10003087 | Ga0157380_1000308711 | 166 |
| 423 | 3300014745 | Ga0157377_10006265 | Ga0157377_100062656 | 166 |
| 424 | 3300014968 | Ga0157379_10403709 | Ga0157379_104037093 | 166 |
| 425 | 3300014969 | Ga0157376_10164878 | Ga0157376_101648781 | 166 |
| 426 | 3300017792 | Ga0163161_10033638 | Ga0163161_100336384 | 166 |
| 427 | 3300020081 | Ga0206354_10077192 | Ga0206354_100771923 | 166 |
| 428 | 3300020082 | Ga0206353_10609133 | Ga0206353_106091333 | 166 |
| 429 | 3300025315 | Ga0207697_10000331 | Ga0207697_1000033111 | 166 |
| 430 | 3300025321 | Ga0207656_10003424 | Ga0207656_100034242 | 166 |
| 431 | 3300025321 | Ga0207656_10044679 | Ga0207656_100446794 | 166 |
| 432 | 3300025321 | Ga0207656_10056830 | Ga0207656_100568303 | 166 |
| 433 | 3300025321 | Ga0207656_10076382 | Ga0207656_100763823 | 166 |
| 434 | 3300025321 | Ga0207656_10123975 | Ga0207656_101239752 | 166 |
| 435 | 3300025893 | Ga0207682_10000010 | Ga0207682_1000001026 | 166 |
| 436 | 3300025899 | Ga0207642_10045549 | Ga0207642_100455493 | 166 |
| 437 | 3300025901 | Ga0207688_10009140 | Ga0207688_100091405 | 166 |
| 438 | 3300025903 | Ga0207680_10466514 | Ga0207680_104665142 | 166 |
| 439 | 3300025903 | Ga0207680_11142325 | Ga0207680_111423251 | 166 |
| 440 | 3300025904 | Ga0207647_10023273 | Ga0207647_100232734 | 166 |
| 441 | 3300025907 | Ga0207645_10001222 | Ga0207645_1000122214 | 166 |
| 442 | 3300025908 | Ga0207643_10000339 | Ga0207643_1000033913 | 166 |
| 443 | 3300025909 | Ga0207705_10088193 | Ga0207705_100881933 | 166 |
| 444 | 3300025909 | Ga0207705_10603742 | Ga0207705_106037421 | 166 |
| 445 | 3300025909 | Ga0207705_10626443 | Ga0207705_106264432 | 166 |
| 446 | 3300025910 | Ga0207684_10809514 | Ga0207684_108095142 | 166 |
| 447 | 3300025911 | Ga0207654_10180220 | Ga0207654_101802203 | 166 |
| 448 | 3300025911 | Ga0207654_10230642 | Ga0207654_102306422 | 166 |
| 449 | 3300025912 | Ga0207707_10011174 | Ga0207707_1001117410 | 166 |
| 450 | 3300025912 | Ga0207707_10026818 | Ga0207707_100268186 | 166 |
| 451 | 3300025912 | Ga0207707_10544460 | Ga0207707_105444602 | 166 |
| 452 | 3300025912 | Ga0207707_10690220 | Ga0207707_106902202 | 166 |
| 453 | 3300025912 | Ga0207707_10999100 | Ga0207707_109991002 | 166 |
| 454 | 3300025913 | Ga0207695_10091719 | Ga0207695_100917192 | 166 |
| 455 | 3300025913 | Ga0207695_10230291 | Ga0207695_102302912 | 166 |
| 456 | 3300025914 | Ga0207671_10260310 | Ga0207671_102603102 | 166 |
| 457 | 3300025916 | Ga0207663_10219879 | Ga0207663_102198793 | 166 |
| 458 | 3300025917 | Ga0207660_10091459 | Ga0207660_100914594 | 166 |
| 459 | 3300025917 | Ga0207660_10142483 | Ga0207660_101424832 | 166 |
| 460 | 3300025917 | Ga0207660_10249727 | Ga0207660_102497272 | 166 |
| 461 | 3300025918 | Ga0207662_10002021 | Ga0207662_100020215 | 166 |
| 462 | 3300025919 | Ga0207657_10000708 | Ga0207657_1000070817 | 166 |
| 463 | 3300025919 | Ga0207657_10003690 | Ga0207657_100036905 | 166 |
| 464 | 3300025919 | Ga0207657_10010189 | Ga0207657_100101894 | 166 |
| 465 | 3300025919 | Ga0207657_10014283 | Ga0207657_100142837 | 166 |
| 466 | 3300025919 | Ga0207657_10174144 | Ga0207657_101741443 | 166 |
| 467 | 3300025920 | Ga0207649_10008352 | Ga0207649_100083526 | 166 |
| 468 | 3300025920 | Ga0207649_10219535 | Ga0207649_102195353 | 166 |
| 469 | 3300025921 | Ga0207652_10011154 | Ga0207652_100111542 | 166 |
| 470 | 3300025921 | Ga0207652_10114438 | Ga0207652_101144383 | 166 |
| 471 | 3300025921 | Ga0207652_10404535 | Ga0207652_104045351 | 166 |
| 472 | 3300025921 | Ga0207652_10545315 | Ga0207652_105453152 | 166 |
| 473 | 3300025921 | Ga0207652_10549348 | Ga0207652_105493482 | 166 |
| 474 | 3300025923 | Ga0207681_10060188 | Ga0207681_100601883 | 166 |
| 475 | 3300025924 | Ga0207694_10375033 | Ga0207694_103750332 | 166 |
| 476 | 3300025925 | Ga0207650_10199489 | Ga0207650_101994893 | 166 |
| 477 | 3300025925 | Ga0207650_10369961 | Ga0207650_103699612 | 166 |
| 478 | 3300025925 | Ga0207650_10733131 | Ga0207650_107331311 | 166 |
| 479 | 3300025929 | Ga0207664_10034664 | Ga0207664_100346642 | 166 |
| 480 | 3300025931 | Ga0207644_10003938 | Ga0207644_1000393811 | 166 |
| 481 | 3300025931 | Ga0207644_10029083 | Ga0207644_100290834 | 166 |
| 482 | 3300025932 | Ga0207690_10094870 | Ga0207690_100948702 | 166 |
| 483 | 3300025932 | Ga0207690_10172527 | Ga0207690_101725272 | 166 |
| 484 | 3300025932 | Ga0207690_10178032 | Ga0207690_101780322 | 166 |
| 485 | 3300025932 | Ga0207690_10355438 | Ga0207690_103554382 | 166 |
| 486 | 3300025932 | Ga0207690_10380771 | Ga0207690_103807712 | 166 |
| 487 | 3300025933 | Ga0207706_10033148 | Ga0207706_100331484 | 166 |
| 488 | 3300025933 | Ga0207706_10054691 | Ga0207706_100546915 | 166 |
| 489 | 3300025933 | Ga0207706_10096130 | Ga0207706_100961303 | 166 |
| 490 | 3300025936 | Ga0207670_10006864 | Ga0207670_100068646 | 166 |
| 491 | 3300025940 | Ga0207691_10000856 | Ga0207691_1000085621 | 166 |
| 492 | 3300025940 | Ga0207691_10007017 | Ga0207691_100070175 | 166 |
| 493 | 3300025941 | Ga0207711_10002653 | Ga0207711_100026535 | 166 |
| 494 | 3300025942 | Ga0207689_10000236 | Ga0207689_1000023635 | 166 |
| 495 | 3300025944 | Ga0207661_10089564 | Ga0207661_100895643 | 166 |
| 496 | 3300025945 | Ga0207679_10031512 | Ga0207679_100315125 | 166 |
| 497 | 3300025945 | Ga0207679_10075861 | Ga0207679_100758614 | 166 |
| 498 | 3300025945 | Ga0207679_10100619 | Ga0207679_101006193 | 166 |
| 499 | 3300025945 | Ga0207679_10130749 | Ga0207679_101307492 | 166 |
| 500 | 3300025945 | Ga0207679_10508463 | Ga0207679_105084632 | 166 |
| 501 | 3300025945 | Ga0207679_10993161 | Ga0207679_109931611 | 166 |
| 502 | 3300025945 | Ga0207679_11353653 | Ga0207679_113536531 | 166 |
| 503 | 3300025949 | Ga0207667_10064662 | Ga0207667_100646626 | 166 |
| 504 | 3300025949 | Ga0207667_10214562 | Ga0207667_102145624 | 166 |
| 505 | 3300025949 | Ga0207667_10250264 | Ga0207667_102502642 | 166 |
| 506 | 3300025949 | Ga0207667_10392936 | Ga0207667_103929362 | 166 |
| 507 | 3300025949 | Ga0207667_10656185 | Ga0207667_106561852 | 166 |
| 508 | 3300025960 | Ga0207651_11424214 | Ga0207651_114242141 | 166 |
| 509 | 3300025981 | Ga0207640_10055618 | Ga0207640_100556184 | 166 |
| 510 | 3300025981 | Ga0207640_10149602 | Ga0207640_101496023 | 166 |
| 511 | 3300025981 | Ga0207640_10356211 | Ga0207640_103562112 | 166 |
| 512 | 3300025986 | Ga0207658_10459824 | Ga0207658_104598241 | 166 |
| 513 | 3300026023 | Ga0207677_10097806 | Ga0207677_100978064 | 166 |
| 514 | 3300026023 | Ga0207677_10153839 | Ga0207677_101538393 | 166 |
| 515 | 3300026035 | Ga0207703_10108962 | Ga0207703_101089623 | 166 |
| 516 | 3300026041 | Ga0207639_10416802 | Ga0207639_104168023 | 166 |
| 517 | 3300026067 | Ga0207678_10001129 | Ga0207678_100011297 | 166 |
| 518 | 3300026067 | Ga0207678_10003812 | Ga0207678_1000381211 | 166 |
| 519 | 3300026067 | Ga0207678_10081231 | Ga0207678_100812315 | 166 |
| 520 | 3300026067 | Ga0207678_10293631 | Ga0207678_102936313 | 166 |
| 521 | 3300026075 | Ga0207708_10001142 | Ga0207708_1000114211 | 166 |
| 522 | 3300026078 | Ga0207702_10026811 | Ga0207702_100268112 | 166 |
| 523 | 3300026078 | Ga0207702_10043978 | Ga0207702_100439785 | 166 |
| 524 | 3300026078 | Ga0207702_10054365 | Ga0207702_100543654 | 166 |
| 525 | 3300026078 | Ga0207702_10707012 | Ga0207702_107070122 | 166 |
| 526 | 3300026089 | Ga0207648_10004638 | Ga0207648_1000463814 | 166 |
| 527 | 3300026089 | Ga0207648_10400377 | Ga0207648_104003772 | 166 |
| 528 | 3300026095 | Ga0207676_10041440 | Ga0207676_100414403 | 166 |
| 529 | 3300026095 | Ga0207676_10873095 | Ga0207676_108730952 | 166 |
| 530 | 3300026116 | Ga0207674_10003596 | Ga0207674_1000359616 | 166 |
| 531 | 3300026116 | Ga0207674_10003869 | Ga0207674_100038693 | 166 |
| 532 | 3300026116 | Ga0207674_10050678 | Ga0207674_100506783 | 166 |
| 533 | 3300026116 | Ga0207674_10136113 | Ga0207674_101361133 | 166 |
| 534 | 3300026116 | Ga0207674_11081083 | Ga0207674_110810831 | 166 |
| 535 | 3300026118 | Ga0207675_100000778 | Ga0207675_10000077829 | 166 |
| 536 | 3300026121 | Ga0207683_10006980 | Ga0207683_100069804 | 166 |
| 537 | 3300026121 | Ga0207683_11812115 | Ga0207683_118121151 | 166 |
| 538 | 3300026142 | Ga0207698_10093838 | Ga0207698_100938383 | 166 |
| 539 | 3300026142 | Ga0207698_10184858 | Ga0207698_101848583 | 166 |
| 540 | 3300026142 | Ga0207698_10302432 | Ga0207698_103024322 | 166 |
| 541 | 3300026142 | Ga0207698_10453713 | Ga0207698_104537131 | 166 |
| 542 | 3300027682 | Ga0209971_1003145 | Ga0209971_10031452 | 166 |
| 543 | 3300027876 | Ga0209974_10020735 | Ga0209974_100207353 | 166 |
| 544 | 3300027907 | Ga0207428_10181538 | Ga0207428_101815383 | 166 |
| 545 | 3300028381 | Ga0268264_10730570 | Ga0268264_107305702 | 166 |
| 546 | 3300031548 | Ga0307408_100003056 | Ga0307408_10000305610 | 166 |
| 547 | 3300031731 | Ga0307405_10066790 | Ga0307405_100667904 | 166 |
| 548 | 3300031824 | Ga0307413_10056747 | Ga0307413_100567473 | 166 |
| 549 | 3300031901 | Ga0307406_10010877 | Ga0307406_100108776 | 166 |
| 550 | 3300031903 | Ga0307407_10207662 | Ga0307407_102076623 | 166 |
| 551 | 3300031911 | Ga0307412_10150964 | Ga0307412_101509642 | 166 |
| 552 | 3300031995 | Ga0307409_100019726 | Ga0307409_1000197263 | 166 |
| 553 | 3300032002 | Ga0307416_100002228 | Ga0307416_1000022286 | 166 |
| 554 | 3300032005 | Ga0307411_10008858 | Ga0307411_100088581 | 166 |
| 555 | 3300032126 | Ga0307415_100008758 | Ga0307415_1000087583 | 166 |
| 556 | 3300034817 | Ga0373948_0048233 | Ga0373948_0048233_292_807 | 166 |
| 557 | 3300035170 | Ga0373943_0068446 | Ga0373943_0068446_1265_1765 | 166 |
| 558 | 3300035691 | Ga0373931_0201978 | Ga0373931_0201978_181_696 | 166 |
| 559 | 3300036401 | Ga0373937_0140755 | Ga0373937_0140755_1728_2231 | 166 |
| 560 | 3300037418 | Ga0395900_0872057 | Ga0395900_0872057_178_705 | 166 |
| 561 | 3300037471 | Ga0395905_0439204 | Ga0395905_0439204_173_700 | 166 |
| 562 | 3300042144 | Ga0450889_010903 | Ga0450889_010903_309_812 | 166 |
| 563 | 3300042439 | Ga0439464_0080170 | Ga0439464_0080170_326_829 | 166 |
| 564 | 3300044842 | Ga0466957_0960237 | Ga0466957_0960237_50_559 | 166 |
| 565 | 3300046472 | Ga0495580_0173127 | Ga0495580_0173127_40_543 | 166 |
| 566 | 3300046472 | Ga0495580_0242374 | Ga0495580_0242374_173_673 | 166 |
| 567 | 3300046684 | Ga0495669_0276952 | Ga0495669_0276952_19_528 | 166 |
| 568 | 3300048903 | Ga0496100_0620126 | Ga0496100_0620126_19_522 | 166 |
| 569 | 3300048904 | Ga0496101_0077721 | Ga0496101_0077721_482_982 | 166 |
| 570 | 3300048905 | Ga0496102_0057587 | Ga0496102_0057587_735_1235 | 166 |
| 571 | 3300048907 | Ga0496104_0011504 | Ga0496104_0011504_4029_4529 | 166 |
| 572 | 3300048909 | Ga0496106_0030287 | Ga0496106_0030287_1973_2473 | 166 |
| 573 | 3300048910 | Ga0496107_0044879 | Ga0496107_0044879_2636_3136 | 166 |
| 574 | 3300048911 | Ga0496108_0003801 | Ga0496108_0003801_4501_5001 | 166 |
| 575 | 3300048912 | Ga0496109_0002100 | Ga0496109_0002100_10269_10769 | 166 |
| 576 | 3300048913 | Ga0496110_0004792 | Ga0496110_0004792_5289_5789 | 166 |
| 577 | 3300048914 | Ga0496111_0086050 | Ga0496111_0086050_592_1092 | 166 |
| 578 | 3300048917 | Ga0496114_0059776 | Ga0496114_0059776_2422_2922 | 166 |
| 579 | 3300050511 | nmdc:mga08y16_61486_c1 | nmdc:mga08y16_61486_c1_240_740 | 166 |
| 580 | 3300050512 | nmdc:mga0n895_640849_c1 | nmdc:mga0n895_640849_c1_93_608 | 166 |
| 581 | 3300050512 | nmdc:mga0n895_81040_c1 | nmdc:mga0n895_81040_c1_291_794 | 166 |
| 582 | 3300050515 | nmdc:mga0a205_893655_c1 | nmdc:mga0a205_893655_c1_77_598 | 166 |
| 583 | 3300053084 | Ga0495595_0135689 | Ga0495595_0135689_555_1058 | 166 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xf2-assembly1.cif.gz_A | crystal structure of semet-hldc from burkholderia pseudomallei | 0.9407 | 13 | 152 |
| 5xf2-assembly1.cif.gz_A | crystal structure of semet-hldc from burkholderia pseudomallei | 0.9217 | 13 | 152 |
| 5x9q-assembly1.cif.gz_B | crystal structure of hldc from burkholderia pseudomallei | 0.8997 | 13 | 165 |
| 5x9q-assembly1.cif.gz_B | crystal structure of hldc from burkholderia pseudomallei | 0.8677 | 13 | 165 |
| 1n1d-assembly1.cif.gz_A | glycerol-3-phosphate cytidylyltransferase complexed with cdp-glycerol | 0.8609 | 34 | 163 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76658_320_476_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9371 | 17 | 165 | 3.40.50.620 |
| af_P76658_320_476_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8853 | 17 | 165 | 3.40.50.620 |
| 2b7lD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8539 | 34 | 150 | 3.40.50.620 |
| 3glvB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8525 | 34 | 153 | 3.40.50.620 |
| 1cozA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8446 | 34 | 163 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T1BDM0-F1-model_v4 | Cytidylyltransferase domain protein (EC 2.7.-.-) | 0.9896 | 36 | 124 |
GO:0009058
GO:0016779 |
| AF-A0A7W0X723-F1-model_v4 | Adenylyltransferase/cytidyltransferase family protein | 0.9867 | 12 | 166 |
GO:0009058
GO:0016779 |
| AF-A0A7W0X723-F1-model_v4 | Adenylyltransferase/cytidyltransferase family protein | 0.9805 | 12 | 166 |
GO:0009058
GO:0016779 |
| AF-A0A351D098-F1-model_v4 | D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase | 0.9792 | 17 | 165 |
GO:0009058
GO:0016779 |
| AF-A0A2E6P1M1-F1-model_v4 | D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase | 0.978 | 35 | 165 |
GO:0009058
GO:0016779 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar