F466242

General Info

Members Datasets Scaffolds Average Seq Length
583 229 1166 246

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100145061|Ga0070670_1001450612
Length 242
Sequence VNALVELHGVSKRYGSATALQPTDLNFARGQTTVLIGPSGCGKSTMLRLIIRLLEPDSGKIKIDGASVSSSNITEFRHRVGYVIQDGGLFPHLTARGNILLMARQLNKRIALDELCALTRFPTQALDRFPAELSGGQRQRVSLMRALALTPKLLLLDEPLGALDPLVRAALQKDLKEIFQRLQQTAILVTHDLAEAAFLGNEIVLMNEGRIVQKGTLGELRSQPASSFVSEFITAQRSLALI

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.97
Rhizosphere 95.03
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100145061 3300005331 Bacteria 2053
2 SwRhRL2b_contig_2214706 2162886007 Bacteria 2177
3 SwRhRL2b_contig_3701656 2162886007 Bacteria 1130
4 CNXas_1000508 3300000545 Bacteria 2632
5 JGI24035J26624_1005974 3300002126 Bacteria 1170
6 JGI25405J52794_10019727 3300003911 Bacteria 1354
7 Ga0065704_10009905 3300005289 Bacteria 2077
8 Ga0065704_10077488 3300005289 Bacteria 4718
9 Ga0065704_10101015 3300005289 Bacteria 2253
10 Ga0065712_10005429 3300005290 Bacteria 5586
11 Ga0065712_10022400 3300005290 Bacteria 2394
12 Ga0065715_10001582 3300005293 Bacteria 7423
13 Ga0065715_10004793 3300005293 Bacteria 4132
14 Ga0065715_10007093 3300005293 Bacteria 4366
15 Ga0065715_10089054 3300005293 Bacteria 15488
16 Ga0065715_10110257 3300005293 Bacteria 2602
17 Ga0065707_10014983 3300005295 Bacteria 2694
18 Ga0065707_10095476 3300005295 Bacteria 3374
19 Ga0065707_10136931 3300005295 Bacteria 1827
20 Ga0070676_10000496 3300005328 Bacteria 18732
21 Ga0070676_10044107 3300005328 Bacteria 2594
22 Ga0070676_10045286 3300005328 Bacteria 2562
23 Ga0070676_10089140 3300005328 Bacteria 1886
24 Ga0070683_100533998 3300005329 Bacteria 1121
25 Ga0070690_100018419 3300005330 Bacteria 4218
26 Ga0070690_100080820 3300005330 Bacteria 2126
27 Ga0070690_100456719 3300005330 Bacteria 948
28 Ga0070670_100006925 3300005331 Bacteria 9611
29 Ga0070670_100013638 3300005331 Bacteria 6964
30 Ga0070670_100115023 3300005331 Bacteria 2319
31 Ga0070670_100194137 3300005331 Bacteria 1764
32 Ga0068869_100014248 3300005334 Bacteria 5307
33 Ga0070666_10007304 3300005335 Bacteria 6808
34 Ga0070666_10025550 3300005335 Bacteria 3851
35 Ga0070666_10067046 3300005335 Bacteria 2436
36 Ga0070666_10173774 3300005335 Bacteria 1509
37 Ga0070666_10280414 3300005335 Bacteria 1184
38 Ga0070682_100114427 3300005337 Bacteria 1803
39 Ga0068868_100045879 3300005338 Bacteria 3420
40 Ga0070660_100173776 3300005339 Bacteria 1741
41 Ga0070660_100298655 3300005339 Bacteria 1320
42 Ga0070689_100058258 3300005340 Bacteria 3000
43 Ga0070689_100100390 3300005340 Bacteria 2290
44 Ga0070689_100531825 3300005340 Bacteria 1011
45 Ga0070689_100534959 3300005340 Bacteria 1008
46 Ga0070687_100000738 3300005343 Bacteria 10866
47 Ga0070687_100128789 3300005343 Bacteria 1458
48 Ga0070661_100013802 3300005344 Bacteria 5677
49 Ga0070661_100158283 3300005344 Bacteria 1714
50 Ga0070668_100001819 3300005347 Bacteria 15516
51 Ga0070668_100002809 3300005347 Bacteria 12815
52 Ga0070668_100021147 3300005347 Bacteria 4918
53 Ga0070668_100046273 3300005347 Bacteria 3340
54 Ga0070668_100140625 3300005347 Bacteria 1945
55 Ga0070669_100005824 3300005353 Bacteria 8887
56 Ga0070669_100016767 3300005353 Bacteria 5227
57 Ga0070669_100025343 3300005353 Bacteria 4259
58 Ga0070669_100095311 3300005353 Bacteria 2237
59 Ga0070669_100327742 3300005353 Bacteria 1238
60 Ga0070675_100002308 3300005354 Bacteria 14173
61 Ga0070675_100003019 3300005354 Bacteria 12705
62 Ga0070675_100008865 3300005354 Bacteria 7821
63 Ga0070675_100061899 3300005354 Bacteria 3091
64 Ga0070675_100073631 3300005354 Bacteria 2836
65 Ga0070675_100328814 3300005354 Bacteria 1351
66 Ga0070671_100015314 3300005355 Bacteria 6193
67 Ga0070671_100022984 3300005355 Bacteria 5095
68 Ga0070671_100206543 3300005355 Bacteria 1666
69 Ga0070671_100214457 3300005355 Bacteria 1633
70 Ga0070674_100005959 3300005356 Bacteria 7085
71 Ga0070674_100006717 3300005356 Bacteria 6733
72 Ga0070674_100085233 3300005356 Bacteria 2267
73 Ga0070673_100002956 3300005364 Bacteria 10477
74 Ga0070673_100084089 3300005364 Bacteria 2587
75 Ga0070673_100117067 3300005364 Bacteria 2217
76 Ga0070673_100329432 3300005364 Bacteria 1351
77 Ga0070688_100017922 3300005365 Bacteria 4073
78 Ga0070688_100026176 3300005365 Bacteria 3463
79 Ga0070688_100047853 3300005365 Bacteria 2655
80 Ga0070688_100054302 3300005365 Bacteria 2509
81 Ga0070688_100064629 3300005365 Bacteria 2322
82 Ga0070688_100226686 3300005365 Bacteria 1320
83 Ga0070659_100062155 3300005366 Bacteria 2952
84 Ga0070667_100003185 3300005367 Bacteria 14050
85 Ga0070667_100034041 3300005367 Bacteria 4262
86 Ga0070667_100053628 3300005367 Bacteria 3403
87 Ga0070667_100076588 3300005367 Bacteria 2856
88 Ga0070667_100097116 3300005367 Bacteria 2541
89 Ga0070709_10082679 3300005434 Bacteria 2098
90 Ga0070714_100125449 3300005435 Bacteria 2288
91 Ga0070713_100046276 3300005436 Bacteria 3569
92 Ga0070713_100077868 3300005436 Bacteria 2820
93 Ga0070713_100275285 3300005436 Bacteria 1543
94 Ga0070713_100549141 3300005436 Bacteria 1094
95 Ga0070710_10347761 3300005437 Bacteria 980
96 Ga0070711_100011273 3300005439 Bacteria 5544
97 Ga0070711_100027569 3300005439 Bacteria 3730
98 Ga0070711_100107047 3300005439 Bacteria 2045
99 Ga0070711_100217713 3300005439 Bacteria 1482
100 Ga0070705_100035650 3300005440 Bacteria 2790
101 Ga0070705_100157440 3300005440 Bacteria 1515
102 Ga0070705_100187360 3300005440 Bacteria 1407
103 Ga0070705_100312624 3300005440 Bacteria 1131
104 Ga0070694_100200153 3300005444 Bacteria 1488
105 Ga0070708_100027263 3300005445 Bacteria 4901
106 Ga0070708_100044586 3300005445 Bacteria 3900
107 Ga0070708_100096253 3300005445 Bacteria 2704
108 Ga0070708_100139698 3300005445 Bacteria 2246
109 Ga0070708_100236715 3300005445 Bacteria 1714
110 Ga0070708_100599475 3300005445 Bacteria 1038
111 Ga0070663_100056901 3300005455 Bacteria 2803
112 Ga0070678_100033705 3300005456 Bacteria 3559
113 Ga0070678_100080976 3300005456 Bacteria 2460
114 Ga0070678_100090002 3300005456 Bacteria 2351
115 Ga0070678_100117381 3300005456 Bacteria 2092
116 Ga0070678_100129523 3300005456 Bacteria 2003
117 Ga0070678_100356982 3300005456 Bacteria 1258
118 Ga0070662_100000628 3300005457 Bacteria 21350
119 Ga0070662_100122484 3300005457 Bacteria 1995
120 Ga0070662_100138939 3300005457 Bacteria 1881
121 Ga0070662_100330542 3300005457 Bacteria 1245
122 Ga0070662_100449116 3300005457 Bacteria 1070
123 Ga0070681_10021741 3300005458 Bacteria 6432
124 Ga0068867_100127097 3300005459 Bacteria 1977
125 Ga0070685_10064872 3300005466 Bacteria 2148
126 Ga0070685_10089537 3300005466 Bacteria 1860
127 Ga0070706_100000227 3300005467 Bacteria 68755
128 Ga0070706_100001453 3300005467 Bacteria 24940
129 Ga0070706_100012520 3300005467 Bacteria 7856
130 Ga0070706_100019455 3300005467 Bacteria 6262
131 Ga0070706_100042611 3300005467 Bacteria 4194
132 Ga0070706_100077475 3300005467 Bacteria 3077
133 Ga0070706_100241992 3300005467 Bacteria 1685
134 Ga0070706_100263151 3300005467 Bacteria 1610
135 Ga0070706_100335442 3300005467 Bacteria 1410
136 Ga0070706_100454739 3300005467 Bacteria 1191
137 Ga0070707_100002434 3300005468 Bacteria 17732
138 Ga0070707_100003850 3300005468 Bacteria 14134
139 Ga0070707_100004673 3300005468 Bacteria 12824
140 Ga0070707_100009824 3300005468 Bacteria 8902
141 Ga0070707_100037020 3300005468 Bacteria 4656
142 Ga0070707_100059976 3300005468 Bacteria 3648
143 Ga0070707_100061151 3300005468 Bacteria 3612
144 Ga0070707_100138110 3300005468 Bacteria 2371
145 Ga0070707_100163236 3300005468 Bacteria 2171
146 Ga0070707_100170537 3300005468 Bacteria 2121
147 Ga0070707_100425967 3300005468 Bacteria 1287
148 Ga0070698_100000633 3300005471 Bacteria 37962
149 Ga0070698_100005815 3300005471 Bacteria 13491
150 Ga0070698_100012510 3300005471 Bacteria 8985
151 Ga0070698_100012693 3300005471 Bacteria 8917
152 Ga0070699_100041796 3300005518 Bacteria 3967
153 Ga0070699_100125134 3300005518 Bacteria 2262
154 Ga0070699_100173706 3300005518 Bacteria 1910
155 Ga0070699_100357833 3300005518 Bacteria 1316
156 Ga0070679_100069101 3300005530 Bacteria 3523
157 Ga0070684_100012957 3300005535 Bacteria 6705
158 Ga0070697_100001810 3300005536 Bacteria 16323
159 Ga0070697_100002571 3300005536 Bacteria 13959
160 Ga0070697_100013223 3300005536 Bacteria 6472
161 Ga0070697_100016290 3300005536 Bacteria 5845
162 Ga0070697_100045325 3300005536 Bacteria 3564
163 Ga0070697_100055129 3300005536 Bacteria 3232
164 Ga0070697_100061829 3300005536 Bacteria 3054
165 Ga0070697_100118307 3300005536 Bacteria 2214
166 Ga0070697_100126550 3300005536 Bacteria 2140
167 Ga0070697_100134417 3300005536 Bacteria 2076
168 Ga0070697_100174800 3300005536 Bacteria 1819
169 Ga0070697_100392020 3300005536 Bacteria 1204
170 Ga0070697_100411862 3300005536 Bacteria 1174
171 Ga0070672_100000936 3300005543 Bacteria 17547
172 Ga0070672_100032654 3300005543 Bacteria 3931
173 Ga0070672_100040404 3300005543 Bacteria 3579
174 Ga0070672_100349565 3300005543 Bacteria 1260
175 Ga0070686_100032779 3300005544 Bacteria 3187
176 Ga0070686_100444426 3300005544 Bacteria 995
177 Ga0070695_100223821 3300005545 Bacteria 1357
178 Ga0070696_100132054 3300005546 Bacteria 1818
179 Ga0070665_100021976 3300005548 Bacteria 6417
180 Ga0070665_100031612 3300005548 Bacteria 5329
181 Ga0070665_100061205 3300005548 Bacteria 3773
182 Ga0070665_100071367 3300005548 Bacteria 3479
183 Ga0070665_100124251 3300005548 Bacteria 2582
184 Ga0070665_100213689 3300005548 Bacteria 1929
185 Ga0070704_100103267 3300005549 Bacteria 2153
186 Ga0068855_100010617 3300005563 Bacteria 11103
187 Ga0068855_100215220 3300005563 Bacteria 2157
188 Ga0070664_100153798 3300005564 Bacteria 2032
189 Ga0068856_100016705 3300005614 Bacteria 7108
190 Ga0070702_100049016 3300005615 Bacteria 2407
191 Ga0068852_100393820 3300005616 Bacteria 1361
192 Ga0068859_100001677 3300005617 Bacteria 22553
193 Ga0068859_100291896 3300005617 Bacteria 1724
194 Ga0068859_100614161 3300005617 Bacteria 1180
195 Ga0068859_100951777 3300005617 Bacteria 942
196 Ga0068864_100074531 3300005618 Bacteria 2961
197 Ga0068864_100610574 3300005618 Bacteria 1059
198 Ga0068864_100780660 3300005618 Bacteria 938
199 Ga0068861_100175761 3300005719 Bacteria 1778
200 Ga0068863_100186300 3300005841 Bacteria 1994
201 Ga0068863_100242815 3300005841 Bacteria 1738
202 Ga0068863_100482961 3300005841 Bacteria 1219
203 Ga0068858_100000495 3300005842 Bacteria 41172
204 Ga0068858_100144346 3300005842 Bacteria 2235
205 Ga0068858_100487385 3300005842 Bacteria 1190
206 Ga0068860_100010463 3300005843 Bacteria 9171
207 Ga0068860_100316226 3300005843 Bacteria 1532
208 Ga0068862_100010680 3300005844 Bacteria 7585
209 Ga0081455_10001589 3300005937 Bacteria 27801
210 Ga0081455_10009403 3300005937 Bacteria 10056
211 Ga0081455_10016410 3300005937 Bacteria 7152
212 Ga0081455_10017446 3300005937 Bacteria 6882
213 Ga0081455_10097049 3300005937 Bacteria 2375
214 Ga0081540_1000111 3300005983 Bacteria 86926
215 Ga0081540_1027217 3300005983 Bacteria 3244
216 Ga0081539_10003102 3300005985 Bacteria 21316
217 Ga0081539_10021777 3300005985 Bacteria 4267
218 Ga0081539_10036787 3300005985 Bacteria 2924
219 Ga0070717_10001605 3300006028 Bacteria 15636
220 Ga0070717_10002951 3300006028 Bacteria 12085
221 Ga0070717_10009768 3300006028 Bacteria 7225
222 Ga0070717_10090361 3300006028 Bacteria 2584
223 Ga0070717_10644626 3300006028 Bacteria 961
224 Ga0070715_10013854 3300006163 Bacteria 2972
225 Ga0070715_10101019 3300006163 Bacteria 1345
226 Ga0070715_10177156 3300006163 Bacteria 1066
227 Ga0070716_100061518 3300006173 Bacteria 2173
228 Ga0070716_100118536 3300006173 Bacteria 1653
229 Ga0070716_100130635 3300006173 Bacteria 1587
230 Ga0070716_100281627 3300006173 Bacteria 1148
231 Ga0070712_100014980 3300006175 Bacteria 4985
232 Ga0070712_100064102 3300006175 Bacteria 2605
233 Ga0070712_100176362 3300006175 Bacteria 1662
234 Ga0070712_100399088 3300006175 Bacteria 1135
235 Ga0070712_100661812 3300006175 Bacteria 888
236 Ga0097621_100008282 3300006237 Bacteria 7483
237 Ga0097621_100175244 3300006237 Bacteria 1851
238 Ga0097621_100217090 3300006237 Bacteria 1665
239 Ga0097621_100229226 3300006237 Bacteria 1621
240 Ga0097621_100374494 3300006237 Bacteria 1271
241 Ga0097621_100517055 3300006237 Bacteria 1083
242 Ga0068871_100003596 3300006358 Bacteria 10651
243 Ga0068871_100059459 3300006358 Bacteria 3114
244 Ga0068871_100236458 3300006358 Bacteria 1587
245 Ga0075433_10547461 3300006852 Bacteria 1017
246 Ga0075434_100578251 3300006871 Bacteria 1143
247 Ga0068865_100040034 3300006881 Bacteria 3183
248 Ga0068865_100110391 3300006881 Bacteria 2028
249 Ga0068865_100170377 3300006881 Bacteria 1668
250 Ga0075436_100042634 3300006914 Bacteria 3130
251 Ga0075436_100176054 3300006914 Bacteria 1511
252 Ga0075436_100242563 3300006914 Bacteria 1282
253 Ga0097620_100001677 3300006931 Bacteria 22553
254 Ga0097620_100291881 3300006931 Bacteria 1724
255 Ga0097620_100614186 3300006931 Bacteria 1180
256 Ga0097620_100951732 3300006931 Bacteria 942
257 Ga0075435_100227047 3300007076 Bacteria 1586
258 Ga0075435_100329968 3300007076 Bacteria 1306
259 Ga0075435_100333990 3300007076 Bacteria 1298
260 Ga0099794_10146184 3300007265 Unclassified 1199
261 Ga0099795_10157091 3300007788 Bacteria 936
262 Ga0105240_10608323 3300009093 Bacteria 1202
263 Ga0111539_10004278 3300009094 Bacteria 18687
264 Ga0105245_10080513 3300009098 Bacteria 2976
265 Ga0105245_10092940 3300009098 Bacteria 2779
266 Ga0105245_10127376 3300009098 Bacteria 2385
267 Ga0105247_10569269 3300009101 Bacteria 835
268 Ga0105242_10093960 3300009176 Bacteria 2529
269 Ga0105248_10000791 3300009177 Bacteria 35518
270 Ga0105237_10165399 3300009545 Bacteria 2211
271 Ga0105237_10372804 3300009545 Bacteria 1432
272 Ga0105249_10002416 3300009553 Bacteria 16217
273 Ga0105249_10010363 3300009553 Bacteria 8192
274 Ga0105239_10039897 3300010375 Bacteria 5143
275 Ga0105239_10120516 3300010375 Bacteria 2913
276 Ga0105239_10349913 3300010375 Bacteria 1668
277 Ga0105239_10610209 3300010375 Bacteria 1245
278 Ga0105246_10052314 3300011119 Bacteria 2807
279 Ga0105246_10451139 3300011119 Bacteria 1081
280 Ga0157371_10086025 3300013102 Bacteria 2227
281 Ga0157370_10223689 3300013104 Bacteria 1743
282 Ga0157374_10005456 3300013296 Bacteria 10684
283 Ga0157374_10017490 3300013296 Bacteria 6314
284 Ga0157374_10019855 3300013296 Bacteria 5955
285 Ga0157374_10059970 3300013296 Bacteria 3560
286 Ga0157374_10117773 3300013296 Bacteria 2560
287 Ga0157374_10684165 3300013296 Bacteria 1038
288 Ga0157378_10048028 3300013297 Bacteria 3795
289 Ga0157378_10072928 3300013297 Bacteria 3085
290 Ga0157378_10075669 3300013297 Bacteria 3032
291 Ga0157378_10122499 3300013297 Bacteria 2399
292 Ga0157378_10223717 3300013297 Bacteria 1790
293 Ga0157378_10300238 3300013297 Bacteria 1554
294 Ga0157378_10326642 3300013297 Bacteria 1492
295 Ga0157378_10461689 3300013297 Bacteria 1262
296 Ga0157378_10485782 3300013297 Bacteria 1231
297 Ga0157378_10548853 3300013297 Bacteria 1161
298 Ga0163162_10001888 3300013306 Bacteria 19735
299 Ga0163162_10003372 3300013306 Bacteria 15287
300 Ga0163162_10026899 3300013306 Bacteria 5689
301 Ga0163162_10069839 3300013306 Bacteria 3564
302 Ga0163162_10088509 3300013306 Bacteria 3176
303 Ga0163162_10192495 3300013306 Bacteria 2167
304 Ga0163162_10358082 3300013306 Bacteria 1592
305 Ga0163162_10405292 3300013306 Bacteria 1496
306 Ga0157372_10060828 3300013307 Bacteria 4227
307 Ga0157375_10003309 3300013308 Bacteria 13957
308 Ga0157375_10008802 3300013308 Bacteria 8844
309 Ga0157375_10024323 3300013308 Bacteria 5603
310 Ga0157375_10090289 3300013308 Bacteria 3122
311 Ga0157375_10409767 3300013308 Bacteria 1522
312 Ga0163163_10232976 3300014325 Bacteria 1891
313 Ga0163163_10249291 3300014325 Bacteria 1826
314 Ga0182008_10015410 3300014497 Bacteria 3988
315 Ga0157377_10070072 3300014745 Bacteria 2025
316 Ga0157379_10062352 3300014968 Bacteria 3335
317 Ga0157379_10254133 3300014968 Bacteria 1596
318 Ga0157379_10273723 3300014968 Bacteria 1536
319 Ga0157379_10324238 3300014968 Bacteria 1407
320 Ga0157376_10004593 3300014969 Bacteria 9615
321 Ga0157376_10106560 3300014969 Bacteria 2459
322 Ga0157376_10120259 3300014969 Bacteria 2326
323 Ga0157376_10286799 3300014969 Bacteria 1553
324 Ga0157376_10454627 3300014969 Bacteria 1250
325 Ga0182006_1044630 3300015261 Bacteria 1728
326 Ga0163161_10563596 3300017792 Bacteria 935
327 Ga0207673_1002932 3300025290 Bacteria 1976
328 Ga0207697_10000010 3300025315 Bacteria 65144
329 Ga0207697_10000084 3300025315 Bacteria 41551
330 Ga0207697_10001492 3300025315 Bacteria 12749
331 Ga0207697_10007672 3300025315 Bacteria 4787
332 Ga0207697_10008006 3300025315 Bacteria 4666
333 Ga0207697_10009408 3300025315 Bacteria 4223
334 Ga0207697_10014522 3300025315 Bacteria 3265
335 Ga0207697_10023581 3300025315 Bacteria 2520
336 Ga0207697_10142844 3300025315 Bacteria 1039
337 Ga0207653_10029100 3300025885 Bacteria 1779
338 Ga0207692_10013171 3300025898 Bacteria 3580
339 Ga0207692_10073818 3300025898 Bacteria 1806
340 Ga0207642_10024912 3300025899 Bacteria 2412
341 Ga0207688_10002089 3300025901 Bacteria 10731
342 Ga0207688_10015820 3300025901 Bacteria 4092
343 Ga0207680_10014074 3300025903 Bacteria 4126
344 Ga0207680_10018176 3300025903 Bacteria 3730
345 Ga0207680_10033641 3300025903 Bacteria 2926
346 Ga0207680_10040259 3300025903 Bacteria 2718
347 Ga0207647_10153229 3300025904 Bacteria 1346
348 Ga0207685_10030211 3300025905 Bacteria 1927
349 Ga0207699_10020068 3300025906 Bacteria 3575
350 Ga0207699_10208422 3300025906 Bacteria 1328
351 Ga0207645_10000107 3300025907 Bacteria 61800
352 Ga0207645_10008262 3300025907 Bacteria 7278
353 Ga0207645_10024699 3300025907 Bacteria 3892
354 Ga0207645_10043935 3300025907 Bacteria 2860
355 Ga0207645_10172808 3300025907 Bacteria 1417
356 Ga0207705_10196655 3300025909 Bacteria 1527
357 Ga0207684_10000205 3300025910 Bacteria 91547
358 Ga0207684_10002196 3300025910 Bacteria 19945
359 Ga0207684_10046398 3300025910 Bacteria 3686
360 Ga0207684_10107973 3300025910 Bacteria 2381
361 Ga0207684_10367464 3300025910 Bacteria 1238
362 Ga0207684_10483328 3300025910 Bacteria 1062
363 Ga0207707_10101998 3300025912 Bacteria 2508
364 Ga0207693_10006639 3300025915 Bacteria 9560
365 Ga0207693_10024884 3300025915 Bacteria 4748
366 Ga0207693_10055478 3300025915 Bacteria 3109
367 Ga0207693_10123716 3300025915 Bacteria 2032
368 Ga0207693_10143868 3300025915 Bacteria 1875
369 Ga0207693_10352692 3300025915 Unclassified 1151
370 Ga0207663_10013027 3300025916 Bacteria 4510
371 Ga0207663_10016811 3300025916 Bacteria 4067
372 Ga0207663_10059844 3300025916 Bacteria 2412
373 Ga0207663_10177233 3300025916 Bacteria 1519
374 Ga0207660_10045722 3300025917 Bacteria 3085
375 Ga0207662_10002805 3300025918 Bacteria 8808
376 Ga0207662_10091963 3300025918 Bacteria 1867
377 Ga0207662_10100291 3300025918 Bacteria 1793
378 Ga0207662_10113372 3300025918 Bacteria 1693
379 Ga0207657_10204598 3300025919 Bacteria 1586
380 Ga0207657_10222437 3300025919 Bacteria 1512
381 Ga0207657_10298444 3300025919 Bacteria 1276
382 Ga0207652_10100494 3300025921 Bacteria 2553
383 Ga0207646_10003213 3300025922 Bacteria 18658
384 Ga0207646_10005702 3300025922 Bacteria 13058
385 Ga0207646_10010472 3300025922 Bacteria 9057
386 Ga0207646_10018415 3300025922 Bacteria 6515
387 Ga0207646_10035839 3300025922 Bacteria 4479
388 Ga0207646_10077274 3300025922 Bacteria 2976
389 Ga0207646_10105570 3300025922 Bacteria 2526
390 Ga0207646_10112145 3300025922 Bacteria 2448
391 Ga0207646_10123076 3300025922 Bacteria 2331
392 Ga0207646_10163442 3300025922 Bacteria 2009
393 Ga0207646_10198893 3300025922 Bacteria 1810
394 Ga0207681_10005670 3300025923 Bacteria 7663
395 Ga0207681_10024260 3300025923 Bacteria 3891
396 Ga0207681_10039069 3300025923 Bacteria 3148
397 Ga0207681_10192492 3300025923 Bacteria 1561
398 Ga0207681_10197055 3300025923 Bacteria 1544
399 Ga0207681_10436708 3300025923 Bacteria 1063
400 Ga0207650_10013082 3300025925 Bacteria 5740
401 Ga0207650_10014280 3300025925 Bacteria 5518
402 Ga0207659_10039863 3300025926 Bacteria 3280
403 Ga0207659_10054474 3300025926 Bacteria 2857
404 Ga0207659_10232291 3300025926 Bacteria 1488
405 Ga0207700_10057209 3300025928 Bacteria 2939
406 Ga0207644_10001213 3300025931 Bacteria 16602
407 Ga0207644_10077613 3300025931 Bacteria 2446
408 Ga0207690_10428542 3300025932 Bacteria 1059
409 Ga0207706_10001198 3300025933 Bacteria 26203
410 Ga0207706_10019356 3300025933 Bacteria 6123
411 Ga0207706_10134896 3300025933 Bacteria 2171
412 Ga0207706_10152709 3300025933 Bacteria 2031
413 Ga0207706_10175157 3300025933 Bacteria 1884
414 Ga0207686_10051653 3300025934 Bacteria 2562
415 Ga0207670_10064059 3300025936 Bacteria 2518
416 Ga0207670_10064623 3300025936 Bacteria 2509
417 Ga0207670_10083903 3300025936 Bacteria 2236
418 Ga0207670_10188710 3300025936 Bacteria 1558
419 Ga0207669_10008698 3300025937 Bacteria 4782
420 Ga0207704_10020312 3300025938 Bacteria 3511
421 Ga0207704_10115278 3300025938 Bacteria 1826
422 Ga0207704_10660229 3300025938 Bacteria 862
423 Ga0207665_10022042 3300025939 Bacteria 4188
424 Ga0207665_10029586 3300025939 Bacteria 3620
425 Ga0207665_10056036 3300025939 Bacteria 2660
426 Ga0207665_10068219 3300025939 Bacteria 2423
427 Ga0207665_10128653 3300025939 Bacteria 1795
428 Ga0207665_10240389 3300025939 Bacteria 1334
429 Ga0207691_10000756 3300025940 Bacteria 31938
430 Ga0207691_10003900 3300025940 Bacteria 14486
431 Ga0207691_10010684 3300025940 Bacteria 8812
432 Ga0207691_10071118 3300025940 Bacteria 3141
433 Ga0207691_10087140 3300025940 Bacteria 2801
434 Ga0207711_10006824 3300025941 Bacteria 9594
435 Ga0207661_10003559 3300025944 Bacteria 10828
436 Ga0207661_10370814 3300025944 Bacteria 1294
437 Ga0207661_10487810 3300025944 Bacteria 1125
438 Ga0207679_10029934 3300025945 Bacteria 3796
439 Ga0207667_10002041 3300025949 Bacteria 25312
440 Ga0207667_10106888 3300025949 Bacteria 2887
441 Ga0207651_10012313 3300025960 Bacteria 4835
442 Ga0207651_10031098 3300025960 Bacteria 3408
443 Ga0207651_10144516 3300025960 Bacteria 1842
444 Ga0207651_10159511 3300025960 Bacteria 1766
445 Ga0207712_10625031 3300025961 Bacteria 934
446 Ga0207668_10002480 3300025972 Bacteria 10777
447 Ga0207668_10064559 3300025972 Bacteria 2588
448 Ga0207668_10189147 3300025972 Bacteria 1630
449 Ga0207668_10255153 3300025972 Bacteria 1426
450 Ga0207668_10494084 3300025972 Bacteria 1051
451 Ga0207658_10052418 3300025986 Bacteria 3010
452 Ga0207658_10062322 3300025986 Bacteria 2790
453 Ga0207658_10091266 3300025986 Bacteria 2363
454 Ga0207658_10133754 3300025986 Bacteria 1996
455 Ga0207658_10164826 3300025986 Bacteria 1819
456 Ga0207677_10230952 3300026023 Bacteria 1490
457 Ga0207677_10236032 3300026023 Bacteria 1476
458 Ga0207703_10121164 3300026035 Bacteria 2246
459 Ga0207703_10625779 3300026035 Bacteria 1019
460 Ga0207678_10037269 3300026067 Bacteria 4230
461 Ga0207678_10291243 3300026067 Bacteria 1402
462 Ga0207708_10108854 3300026075 Bacteria 2150
463 Ga0207702_10240395 3300026078 Bacteria 1696
464 Ga0207641_10182374 3300026088 Bacteria 1924
465 Ga0207641_10182806 3300026088 Bacteria 1922
466 Ga0207648_10059199 3300026089 Bacteria 3340
467 Ga0207648_10112314 3300026089 Bacteria 2393
468 Ga0207676_10398006 3300026095 Bacteria 1286
469 Ga0207675_100517411 3300026118 Bacteria 1189
470 Ga0207675_100667204 3300026118 Bacteria 1047
471 Ga0207683_10007763 3300026121 Bacteria 9181
472 Ga0207683_10028967 3300026121 Bacteria 4792
473 Ga0207683_10124164 3300026121 Bacteria 2319
474 Ga0207683_10195352 3300026121 Bacteria 1838
475 Ga0207698_10506304 3300026142 Bacteria 1176
476 Ga0209974_10152453 3300027876 Bacteria 835
477 Ga0207428_10106629 3300027907 Bacteria 2160
478 Ga0268266_10014084 3300028379 Bacteria 6884
479 Ga0268266_10046750 3300028379 Bacteria 3705
480 Ga0268266_10049352 3300028379 Bacteria 3610
481 Ga0268266_10069346 3300028379 Bacteria 3054
482 Ga0268266_10082369 3300028379 Bacteria 2807
483 Ga0268266_10207908 3300028379 Bacteria 1794
484 Ga0268266_10295295 3300028379 Bacteria 1510
485 Ga0268265_10073140 3300028380 Bacteria 2676
486 Ga0268264_10058642 3300028381 Bacteria 3224
487 Ga0268264_10090964 3300028381 Bacteria 2631
488 Ga0268264_10117754 3300028381 Bacteria 2337
489 Ga0265338_10325867 3300028800 Bacteria 1111
490 Ga0373953_0066031 3300035117 Bacteria 1486
491 Ga0373956_0058076 3300035119 Bacteria 1749
492 Ga0373943_0092547 3300035170 Bacteria 1568
493 Ga0373931_0316092 3300035691 Bacteria 968
494 Ga0373931_0475252 3300035691 Bacteria 803
495 Ga0373935_0019101 3300035692 Bacteria 4179
496 Ga0373927_0181217 3300035695 Bacteria 1382
497 Ga0373927_0368414 3300035695 Bacteria 947
498 Ga0373947_0048020 3300035725 Bacteria 2560
499 Ga0373947_0283447 3300035725 Bacteria 1102
500 Ga0373937_0007820 3300036401 Bacteria 9266
501 Ga0373937_0214802 3300036401 Bacteria 1810
502 Ga0373925_0059056 3300037068 Bacteria 2876
503 Ga0373925_0316733 3300037068 Bacteria 1262
504 Ga0373925_0354810 3300037068 Bacteria 1191
505 Ga0395899_0022242 3300037312 Bacteria 4809
506 Ga0395900_0006144 3300037418 Bacteria 12534
507 Ga0395900_0166032 3300037418 Bacteria 2250
508 Ga0395900_0306162 3300037418 Bacteria 1574
509 Ga0395898_0012753 3300037466 Bacteria 8681
510 Ga0395905_0024717 3300037471 Bacteria 5669
511 Ga0395901_0002547 3300038443 Bacteria 18467
512 Ga0395901_0082700 3300038443 Bacteria 3355
513 Ga0439455_0007732 3300042012 Bacteria 2283
514 Ga0439455_0010198 3300042012 Bacteria 2060
515 Ga0466967_0116580 3300045976 Bacteria 2461
516 Ga0495592_0010196 3300046454 Bacteria 7084
517 Ga0495592_0114611 3300046454 Bacteria 1903
518 Ga0495629_0177931 3300046459 Bacteria 1475
519 Ga0495651_0056413 3300046462 Bacteria 3018
520 Ga0495651_0110129 3300046462 Bacteria 2038
521 Ga0495580_0136024 3300046472 Bacteria 1704
522 Ga0495608_0106894 3300046511 Bacteria 1801
523 Ga0495618_0084004 3300046514 Bacteria 2034
524 Ga0495628_0034690 3300046516 Bacteria 4057
525 Ga0495630_0036480 3300046517 Bacteria 3675
526 Ga0495666_0115583 3300046526 Unclassified 1259
527 Ga0495652_0014157 3300046529 Bacteria 7165
528 Ga0495640_0052799 3300046533 Bacteria 2789
529 Ga0495587_0165148 3300046536 Bacteria 1259
530 Ga0495645_0019967 3300046543 Bacteria 4830
531 Ga0495645_0068945 3300046543 Bacteria 2553
532 Ga0495634_0025214 3300046642 Bacteria 4166
533 Ga0495634_0042203 3300046642 Bacteria 3095
534 Ga0495588_0246262 3300046674 Bacteria 943
535 Ga0495599_0030529 3300046678 Bacteria 3381
536 Ga0495646_0009359 3300046680 Bacteria 6215
537 Ga0495669_0130381 3300046684 Bacteria 1183
538 Ga0495600_0390151 3300046809 Bacteria 868
539 Ga0495674_0459821 3300047319 Bacteria 1022
540 Ga0495676_0257982 3300047321 Bacteria 1187
541 Ga0495680_0197601 3300047322 Bacteria 1444
542 Ga0495675_0013910 3300047444 Bacteria 5088
543 Ga0495684_0001358 3300047471 Bacteria 19660
544 Ga0495684_0022341 3300047471 Bacteria 4869
545 Ga0496100_0023306 3300048903 Bacteria 3759
546 Ga0496100_0057475 3300048903 Bacteria 2548
547 Ga0496101_0008937 3300048904 Bacteria 6566
548 Ga0496102_0083496 3300048905 Bacteria 2947
549 Ga0496102_0171727 3300048905 Bacteria 2041
550 Ga0496104_0605027 3300048907 Bacteria 1006
551 Ga0496105_0015373 3300048908 Bacteria 6098
552 Ga0496105_0174355 3300048908 Bacteria 1762
553 Ga0496106_0010517 3300048909 Bacteria 6835
554 Ga0496107_0018262 3300048910 Bacteria 4936
555 Ga0496107_0023770 3300048910 Bacteria 4332
556 Ga0496108_0228573 3300048911 Bacteria 1617
557 Ga0496108_0484338 3300048911 Bacteria 1081
558 Ga0496109_0067989 3300048912 Bacteria 3265
559 Ga0496109_0136132 3300048912 Bacteria 2295
560 Ga0496109_0696969 3300048912 Bacteria 953
561 Ga0496110_0036948 3300048913 Bacteria 4244
562 Ga0496110_0872617 3300048913 Bacteria 805
563 Ga0496112_0033455 3300048915 Bacteria 4998
564 Ga0496112_0041297 3300048915 Bacteria 4513
565 Ga0496112_0089965 3300048915 Bacteria 3038
566 Ga0496112_0794360 3300048915 Bacteria 871
567 Ga0496113_0139731 3300048916 Bacteria 1905
568 Ga0496113_0182061 3300048916 Bacteria 1666
569 Ga0496114_0487111 3300048917 Bacteria 1091
570 Ga0496115_0003866 3300048918 Bacteria 10797
571 Ga0496115_0008351 3300048918 Bacteria 7660
572 Ga0496115_0010133 3300048918 Bacteria 7032
573 Ga0496115_0306707 3300048918 Bacteria 1300
574 nmdc:mga05p37_200803_c1 3300050507 Bacteria 2415
575 nmdc:mga08y16_26059_c1 3300050511 Bacteria 6167
576 nmdc:mga08y16_400244_c1 3300050511 Bacteria 1405
577 nmdc:mga0n895_754546_c1 3300050512 Bacteria 966
578 nmdc:mga0rr50_185097_c1 3300050513 Bacteria 1704
579 Ga0495601_0045020 3300053077 Bacteria 2774
580 Ga0495601_0096227 3300053077 Bacteria 1909
581 Ga0495601_0249262 3300053077 Bacteria 1160
582 Ga0495595_0054997 3300053084 Bacteria 1852
583 Ga0495619_0365886 3300053085 Bacteria 997
584 Ga0070670_100145061
585 SwRhRL2b_contig_2214706
586 SwRhRL2b_contig_3701656
587 CNXas_1000508
588 JGI24035J26624_1005974
589 JGI25405J52794_10019727
590 Ga0065704_10009905
591 Ga0065704_10077488
592 Ga0065704_10101015
593 Ga0065712_10005429
594 Ga0065712_10022400
595 Ga0065715_10001582
596 Ga0065715_10004793
597 Ga0065715_10007093
598 Ga0065715_10089054
599 Ga0065715_10110257
600 Ga0065707_10014983
601 Ga0065707_10095476
602 Ga0065707_10136931
603 Ga0070676_10000496
604 Ga0070676_10044107
605 Ga0070676_10045286
606 Ga0070676_10089140
607 Ga0070683_100533998
608 Ga0070690_100018419
609 Ga0070690_100080820
610 Ga0070690_100456719
611 Ga0070670_100006925
612 Ga0070670_100013638
613 Ga0070670_100115023
614 Ga0070670_100194137
615 Ga0068869_100014248
616 Ga0070666_10007304
617 Ga0070666_10025550
618 Ga0070666_10067046
619 Ga0070666_10173774
620 Ga0070666_10280414
621 Ga0070682_100114427
622 Ga0068868_100045879
623 Ga0070660_100173776
624 Ga0070660_100298655
625 Ga0070689_100058258
626 Ga0070689_100100390
627 Ga0070689_100531825
628 Ga0070689_100534959
629 Ga0070687_100000738
630 Ga0070687_100128789
631 Ga0070661_100013802
632 Ga0070661_100158283
633 Ga0070668_100001819
634 Ga0070668_100002809
635 Ga0070668_100021147
636 Ga0070668_100046273
637 Ga0070668_100140625
638 Ga0070669_100005824
639 Ga0070669_100016767
640 Ga0070669_100025343
641 Ga0070669_100095311
642 Ga0070669_100327742
643 Ga0070675_100002308
644 Ga0070675_100003019
645 Ga0070675_100008865
646 Ga0070675_100061899
647 Ga0070675_100073631
648 Ga0070675_100328814
649 Ga0070671_100015314
650 Ga0070671_100022984
651 Ga0070671_100206543
652 Ga0070671_100214457
653 Ga0070674_100005959
654 Ga0070674_100006717
655 Ga0070674_100085233
656 Ga0070673_100002956
657 Ga0070673_100084089
658 Ga0070673_100117067
659 Ga0070673_100329432
660 Ga0070688_100017922
661 Ga0070688_100026176
662 Ga0070688_100047853
663 Ga0070688_100054302
664 Ga0070688_100064629
665 Ga0070688_100226686
666 Ga0070659_100062155
667 Ga0070667_100003185
668 Ga0070667_100034041
669 Ga0070667_100053628
670 Ga0070667_100076588
671 Ga0070667_100097116
672 Ga0070709_10082679
673 Ga0070714_100125449
674 Ga0070713_100046276
675 Ga0070713_100077868
676 Ga0070713_100275285
677 Ga0070713_100549141
678 Ga0070710_10347761
679 Ga0070711_100011273
680 Ga0070711_100027569
681 Ga0070711_100107047
682 Ga0070711_100217713
683 Ga0070705_100035650
684 Ga0070705_100157440
685 Ga0070705_100187360
686 Ga0070705_100312624
687 Ga0070694_100200153
688 Ga0070708_100027263
689 Ga0070708_100044586
690 Ga0070708_100096253
691 Ga0070708_100139698
692 Ga0070708_100236715
693 Ga0070708_100599475
694 Ga0070663_100056901
695 Ga0070678_100033705
696 Ga0070678_100080976
697 Ga0070678_100090002
698 Ga0070678_100117381
699 Ga0070678_100129523
700 Ga0070678_100356982
701 Ga0070662_100000628
702 Ga0070662_100122484
703 Ga0070662_100138939
704 Ga0070662_100330542
705 Ga0070662_100449116
706 Ga0070681_10021741
707 Ga0068867_100127097
708 Ga0070685_10064872
709 Ga0070685_10089537
710 Ga0070706_100000227
711 Ga0070706_100001453
712 Ga0070706_100012520
713 Ga0070706_100019455
714 Ga0070706_100042611
715 Ga0070706_100077475
716 Ga0070706_100241992
717 Ga0070706_100263151
718 Ga0070706_100335442
719 Ga0070706_100454739
720 Ga0070707_100002434
721 Ga0070707_100003850
722 Ga0070707_100004673
723 Ga0070707_100009824
724 Ga0070707_100037020
725 Ga0070707_100059976
726 Ga0070707_100061151
727 Ga0070707_100138110
728 Ga0070707_100163236
729 Ga0070707_100170537
730 Ga0070707_100425967
731 Ga0070698_100000633
732 Ga0070698_100005815
733 Ga0070698_100012510
734 Ga0070698_100012693
735 Ga0070699_100041796
736 Ga0070699_100125134
737 Ga0070699_100173706
738 Ga0070699_100357833
739 Ga0070679_100069101
740 Ga0070684_100012957
741 Ga0070697_100001810
742 Ga0070697_100002571
743 Ga0070697_100013223
744 Ga0070697_100016290
745 Ga0070697_100045325
746 Ga0070697_100055129
747 Ga0070697_100061829
748 Ga0070697_100118307
749 Ga0070697_100126550
750 Ga0070697_100134417
751 Ga0070697_100174800
752 Ga0070697_100392020
753 Ga0070697_100411862
754 Ga0070672_100000936
755 Ga0070672_100032654
756 Ga0070672_100040404
757 Ga0070672_100349565
758 Ga0070686_100032779
759 Ga0070686_100444426
760 Ga0070695_100223821
761 Ga0070696_100132054
762 Ga0070665_100021976
763 Ga0070665_100031612
764 Ga0070665_100061205
765 Ga0070665_100071367
766 Ga0070665_100124251
767 Ga0070665_100213689
768 Ga0070704_100103267
769 Ga0068855_100010617
770 Ga0068855_100215220
771 Ga0070664_100153798
772 Ga0068856_100016705
773 Ga0070702_100049016
774 Ga0068852_100393820
775 Ga0068859_100001677
776 Ga0068859_100291896
777 Ga0068859_100614161
778 Ga0068859_100951777
779 Ga0068864_100074531
780 Ga0068864_100610574
781 Ga0068864_100780660
782 Ga0068861_100175761
783 Ga0068863_100186300
784 Ga0068863_100242815
785 Ga0068863_100482961
786 Ga0068858_100000495
787 Ga0068858_100144346
788 Ga0068858_100487385
789 Ga0068860_100010463
790 Ga0068860_100316226
791 Ga0068862_100010680
792 Ga0081455_10001589
793 Ga0081455_10009403
794 Ga0081455_10016410
795 Ga0081455_10017446
796 Ga0081455_10097049
797 Ga0081540_1000111
798 Ga0081540_1027217
799 Ga0081539_10003102
800 Ga0081539_10021777
801 Ga0081539_10036787
802 Ga0070717_10001605
803 Ga0070717_10002951
804 Ga0070717_10009768
805 Ga0070717_10090361
806 Ga0070717_10644626
807 Ga0070715_10013854
808 Ga0070715_10101019
809 Ga0070715_10177156
810 Ga0070716_100061518
811 Ga0070716_100118536
812 Ga0070716_100130635
813 Ga0070716_100281627
814 Ga0070712_100014980
815 Ga0070712_100064102
816 Ga0070712_100176362
817 Ga0070712_100399088
818 Ga0070712_100661812
819 Ga0097621_100008282
820 Ga0097621_100175244
821 Ga0097621_100217090
822 Ga0097621_100229226
823 Ga0097621_100374494
824 Ga0097621_100517055
825 Ga0068871_100003596
826 Ga0068871_100059459
827 Ga0068871_100236458
828 Ga0075433_10547461
829 Ga0075434_100578251
830 Ga0068865_100040034
831 Ga0068865_100110391
832 Ga0068865_100170377
833 Ga0075436_100042634
834 Ga0075436_100176054
835 Ga0075436_100242563
836 Ga0097620_100001677
837 Ga0097620_100291881
838 Ga0097620_100614186
839 Ga0097620_100951732
840 Ga0075435_100227047
841 Ga0075435_100329968
842 Ga0075435_100333990
843 Ga0099794_10146184
844 Ga0099795_10157091
845 Ga0105240_10608323
846 Ga0111539_10004278
847 Ga0105245_10080513
848 Ga0105245_10092940
849 Ga0105245_10127376
850 Ga0105247_10569269
851 Ga0105242_10093960
852 Ga0105248_10000791
853 Ga0105237_10165399
854 Ga0105237_10372804
855 Ga0105249_10002416
856 Ga0105249_10010363
857 Ga0105239_10039897
858 Ga0105239_10120516
859 Ga0105239_10349913
860 Ga0105239_10610209
861 Ga0105246_10052314
862 Ga0105246_10451139
863 Ga0157371_10086025
864 Ga0157370_10223689
865 Ga0157374_10005456
866 Ga0157374_10017490
867 Ga0157374_10019855
868 Ga0157374_10059970
869 Ga0157374_10117773
870 Ga0157374_10684165
871 Ga0157378_10048028
872 Ga0157378_10072928
873 Ga0157378_10075669
874 Ga0157378_10122499
875 Ga0157378_10223717
876 Ga0157378_10300238
877 Ga0157378_10326642
878 Ga0157378_10461689
879 Ga0157378_10485782
880 Ga0157378_10548853
881 Ga0163162_10001888
882 Ga0163162_10003372
883 Ga0163162_10026899
884 Ga0163162_10069839
885 Ga0163162_10088509
886 Ga0163162_10192495
887 Ga0163162_10358082
888 Ga0163162_10405292
889 Ga0157372_10060828
890 Ga0157375_10003309
891 Ga0157375_10008802
892 Ga0157375_10024323
893 Ga0157375_10090289
894 Ga0157375_10409767
895 Ga0163163_10232976
896 Ga0163163_10249291
897 Ga0182008_10015410
898 Ga0157377_10070072
899 Ga0157379_10062352
900 Ga0157379_10254133
901 Ga0157379_10273723
902 Ga0157379_10324238
903 Ga0157376_10004593
904 Ga0157376_10106560
905 Ga0157376_10120259
906 Ga0157376_10286799
907 Ga0157376_10454627
908 Ga0182006_1044630
909 Ga0163161_10563596
910 Ga0207673_1002932
911 Ga0207697_10000010
912 Ga0207697_10000084
913 Ga0207697_10001492
914 Ga0207697_10007672
915 Ga0207697_10008006
916 Ga0207697_10009408
917 Ga0207697_10014522
918 Ga0207697_10023581
919 Ga0207697_10142844
920 Ga0207653_10029100
921 Ga0207692_10013171
922 Ga0207692_10073818
923 Ga0207642_10024912
924 Ga0207688_10002089
925 Ga0207688_10015820
926 Ga0207680_10014074
927 Ga0207680_10018176
928 Ga0207680_10033641
929 Ga0207680_10040259
930 Ga0207647_10153229
931 Ga0207685_10030211
932 Ga0207699_10020068
933 Ga0207699_10208422
934 Ga0207645_10000107
935 Ga0207645_10008262
936 Ga0207645_10024699
937 Ga0207645_10043935
938 Ga0207645_10172808
939 Ga0207705_10196655
940 Ga0207684_10000205
941 Ga0207684_10002196
942 Ga0207684_10046398
943 Ga0207684_10107973
944 Ga0207684_10367464
945 Ga0207684_10483328
946 Ga0207707_10101998
947 Ga0207693_10006639
948 Ga0207693_10024884
949 Ga0207693_10055478
950 Ga0207693_10123716
951 Ga0207693_10143868
952 Ga0207693_10352692
953 Ga0207663_10013027
954 Ga0207663_10016811
955 Ga0207663_10059844
956 Ga0207663_10177233
957 Ga0207660_10045722
958 Ga0207662_10002805
959 Ga0207662_10091963
960 Ga0207662_10100291
961 Ga0207662_10113372
962 Ga0207657_10204598
963 Ga0207657_10222437
964 Ga0207657_10298444
965 Ga0207652_10100494
966 Ga0207646_10003213
967 Ga0207646_10005702
968 Ga0207646_10010472
969 Ga0207646_10018415
970 Ga0207646_10035839
971 Ga0207646_10077274
972 Ga0207646_10105570
973 Ga0207646_10112145
974 Ga0207646_10123076
975 Ga0207646_10163442
976 Ga0207646_10198893
977 Ga0207681_10005670
978 Ga0207681_10024260
979 Ga0207681_10039069
980 Ga0207681_10192492
981 Ga0207681_10197055
982 Ga0207681_10436708
983 Ga0207650_10013082
984 Ga0207650_10014280
985 Ga0207659_10039863
986 Ga0207659_10054474
987 Ga0207659_10232291
988 Ga0207700_10057209
989 Ga0207644_10001213
990 Ga0207644_10077613
991 Ga0207690_10428542
992 Ga0207706_10001198
993 Ga0207706_10019356
994 Ga0207706_10134896
995 Ga0207706_10152709
996 Ga0207706_10175157
997 Ga0207686_10051653
998 Ga0207670_10064059
999 Ga0207670_10064623
1000 Ga0207670_10083903
1001 Ga0207670_10188710
1002 Ga0207669_10008698
1003 Ga0207704_10020312
1004 Ga0207704_10115278
1005 Ga0207704_10660229
1006 Ga0207665_10022042
1007 Ga0207665_10029586
1008 Ga0207665_10056036
1009 Ga0207665_10068219
1010 Ga0207665_10128653
1011 Ga0207665_10240389
1012 Ga0207691_10000756
1013 Ga0207691_10003900
1014 Ga0207691_10010684
1015 Ga0207691_10071118
1016 Ga0207691_10087140
1017 Ga0207711_10006824
1018 Ga0207661_10003559
1019 Ga0207661_10370814
1020 Ga0207661_10487810
1021 Ga0207679_10029934
1022 Ga0207667_10002041
1023 Ga0207667_10106888
1024 Ga0207651_10012313
1025 Ga0207651_10031098
1026 Ga0207651_10144516
1027 Ga0207651_10159511
1028 Ga0207712_10625031
1029 Ga0207668_10002480
1030 Ga0207668_10064559
1031 Ga0207668_10189147
1032 Ga0207668_10255153
1033 Ga0207668_10494084
1034 Ga0207658_10052418
1035 Ga0207658_10062322
1036 Ga0207658_10091266
1037 Ga0207658_10133754
1038 Ga0207658_10164826
1039 Ga0207677_10230952
1040 Ga0207677_10236032
1041 Ga0207703_10121164
1042 Ga0207703_10625779
1043 Ga0207678_10037269
1044 Ga0207678_10291243
1045 Ga0207708_10108854
1046 Ga0207702_10240395
1047 Ga0207641_10182374
1048 Ga0207641_10182806
1049 Ga0207648_10059199
1050 Ga0207648_10112314
1051 Ga0207676_10398006
1052 Ga0207675_100517411
1053 Ga0207675_100667204
1054 Ga0207683_10007763
1055 Ga0207683_10028967
1056 Ga0207683_10124164
1057 Ga0207683_10195352
1058 Ga0207698_10506304
1059 Ga0209974_10152453
1060 Ga0207428_10106629
1061 Ga0268266_10014084
1062 Ga0268266_10046750
1063 Ga0268266_10049352
1064 Ga0268266_10069346
1065 Ga0268266_10082369
1066 Ga0268266_10207908
1067 Ga0268266_10295295
1068 Ga0268265_10073140
1069 Ga0268264_10058642
1070 Ga0268264_10090964
1071 Ga0268264_10117754
1072 Ga0265338_10325867
1073 Ga0373953_0066031
1074 Ga0373956_0058076
1075 Ga0373943_0092547
1076 Ga0373931_0316092
1077 Ga0373931_0475252
1078 Ga0373935_0019101
1079 Ga0373927_0181217
1080 Ga0373927_0368414
1081 Ga0373947_0048020
1082 Ga0373947_0283447
1083 Ga0373937_0007820
1084 Ga0373937_0214802
1085 Ga0373925_0059056
1086 Ga0373925_0316733
1087 Ga0373925_0354810
1088 Ga0395899_0022242
1089 Ga0395900_0006144
1090 Ga0395900_0166032
1091 Ga0395900_0306162
1092 Ga0395898_0012753
1093 Ga0395905_0024717
1094 Ga0395901_0002547
1095 Ga0395901_0082700
1096 Ga0439455_0007732
1097 Ga0439455_0010198
1098 Ga0466967_0116580
1099 Ga0495592_0010196
1100 Ga0495592_0114611
1101 Ga0495629_0177931
1102 Ga0495651_0056413
1103 Ga0495651_0110129
1104 Ga0495580_0136024
1105 Ga0495608_0106894
1106 Ga0495618_0084004
1107 Ga0495628_0034690
1108 Ga0495630_0036480
1109 Ga0495666_0115583
1110 Ga0495652_0014157
1111 Ga0495640_0052799
1112 Ga0495587_0165148
1113 Ga0495645_0019967
1114 Ga0495645_0068945
1115 Ga0495634_0025214
1116 Ga0495634_0042203
1117 Ga0495588_0246262
1118 Ga0495599_0030529
1119 Ga0495646_0009359
1120 Ga0495669_0130381
1121 Ga0495600_0390151
1122 Ga0495674_0459821
1123 Ga0495676_0257982
1124 Ga0495680_0197601
1125 Ga0495675_0013910
1126 Ga0495684_0001358
1127 Ga0495684_0022341
1128 Ga0496100_0023306
1129 Ga0496100_0057475
1130 Ga0496101_0008937
1131 Ga0496102_0083496
1132 Ga0496102_0171727
1133 Ga0496104_0605027
1134 Ga0496105_0015373
1135 Ga0496105_0174355
1136 Ga0496106_0010517
1137 Ga0496107_0018262
1138 Ga0496107_0023770
1139 Ga0496108_0228573
1140 Ga0496108_0484338
1141 Ga0496109_0067989
1142 Ga0496109_0136132
1143 Ga0496109_0696969
1144 Ga0496110_0036948
1145 Ga0496110_0872617
1146 Ga0496112_0033455
1147 Ga0496112_0041297
1148 Ga0496112_0089965
1149 Ga0496112_0794360
1150 Ga0496113_0139731
1151 Ga0496113_0182061
1152 Ga0496114_0487111
1153 Ga0496115_0003866
1154 Ga0496115_0008351
1155 Ga0496115_0010133
1156 Ga0496115_0306707
1157 nmdc:mga05p37_200803_c1
1158 nmdc:mga08y16_26059_c1
1159 nmdc:mga08y16_400244_c1
1160 nmdc:mga0n895_754546_c1
1161 nmdc:mga0rr50_185097_c1
1162 Ga0495601_0045020
1163 Ga0495601_0096227
1164 Ga0495601_0249262
1165 Ga0495595_0054997
1166 Ga0495619_0365886

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

20

161

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahe-assembly1.cif.gz_C opua inhibited inward facing 0.9583 5 239
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.957 3 237
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.9565 5 237
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9551 4 240
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9529 5 235
ID Description Score Start End Superfamily
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9794 5 240 3.40.50.300
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9686 5 237 3.40.50.300
af_O69724_1_242_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9673 5 238 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9633 5 240 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9618 17 237 3.40.50.300
ID Description Score Start End GO Terms
AF-R4K7S1-F1-model_v4 ABC-type spermidine/putrescine transport system, ATPase component 0.9728 5 237 GO:0005524
GO:0016887
AF-A0A7X2N570-F1-model_v4 deleted 0.9716 5 237
AF-A0A7C3IAS6-F1-model_v4 ABC transporter ATP-binding protein 0.9699 5 238 GO:0005524
GO:0016887
AF-A0A6S4QEL6-F1-model_v4 ABC transporter ATP-binding protein 0.9695 1 237 GO:0005524
GO:0008643
GO:0016887
GO:0055052
GO:0140359
AF-A0A660UYW6-F1-model_v4 Molybdenum ABC transporter ATP-binding protein 0.9677 5 238 GO:0005524
GO:0015689
GO:0016887

Map