F466232

General Info

Members Datasets Scaffolds Average Seq Length
582 330 1164 318

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006493962|3006499495
Length 351
Sequence TEDRSDRGRRQPGSGRGRRSSVPLMHAITISEPGGPEALVWAEVPDPVPGEGEVLVEVTASAVNRADIMQRQGFYDPPPGASPYPGLECAGRIAALGPGVSGWAVGDEVCALLAGGGYAQKVAVPSGQLLPVPEGVGLKQAAALPEVVCTVWSNVFMVAHLRPGETLLVHGGSSGIGTMAIQLAKAVGAKVAVTAGTKEKLERCAELGADILINYREQDFVAEIKEATGGAGADVILDNMGAKYLDRNVQALAVNGRLAIIGMQGGRKGELNIGTLLAKRAAVSATSLRARPLEEKAAIVAAVREHVWPLVAAGHVRPIVDRELPMSEAPAAHRVVEESGHIGKVLLTTAS

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
7 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
11 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
12 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
13 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
14 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
15 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
16 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
17 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
18 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
19 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
20 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
21 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
23 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
24 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
32 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
33 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
34 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
35 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
36 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
37 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
38 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
39 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
40 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
41 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
42 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
43 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
44 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
45 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
46 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
47 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
48 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
51 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
52 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
53 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
54 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
55 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
56 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
57 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
58 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
59 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
60 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
61 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
62 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
63 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
64 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
65 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
66 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
70 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
77 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
78 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
79 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
80 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
81 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
82 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
83 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
84 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
85 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
86 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
87 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
88 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
89 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
90 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
91 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
92 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
93 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
108 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
122 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
123 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
124 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
167 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
170 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
171 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
218 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
219 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
220 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
221 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
222 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
227 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
228 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
229 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
230 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
231 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
232 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
233 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
234 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
235 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
236 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
237 2643221548 Streptomyces sp. Root55 Isolate Unclassified
238 2643221578 Streptomyces sp. Root63 Isolate Unclassified
239 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
240 2643221647 Streptomyces sp. Root369 Isolate Unclassified
241 2643221670 Streptomyces sp. Root431 Isolate Unclassified
242 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
243 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
244 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
245 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
246 2643221714 Streptomyces sp. Root264 Isolate Unclassified
247 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
248 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
249 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
250 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
251 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
252 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
253 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
254 2808606448 Streptomyces sp. 193411 Isolate Unclassified
255 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
256 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
257 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
258 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
259 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
260 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
261 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
262 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
263 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
264 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
265 2862574272 Streptomyces sp. AcE210 Isolate Nodule
266 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
267 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
268 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
269 2867369537 Streptomyces sp. Z26 Isolate Unclassified
270 2867428634 Streptomyces sp. RP5T Isolate Unclassified
271 2867475112 Streptomyces sp. TM32 Isolate Unclassified
272 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
273 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
274 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
275 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
276 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
277 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
278 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
279 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
280 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
281 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
282 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
283 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
284 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
285 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
286 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
287 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
288 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
289 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
290 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
291 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
292 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
293 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
294 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
295 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
296 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
297 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
298 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
299 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
300 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
301 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
302 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
303 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
304 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
305 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
306 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
307 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
308 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
309 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
310 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
311 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
312 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
313 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
314 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
315 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
316 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
317 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
318 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
319 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
320 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
321 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
322 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
323 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
324 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
325 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
326 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
327 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
328 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
329 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
330 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.93
Metatranscriptomes 1.03
Isolates 18.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 0.52
Rhizoplane 0.69
Rhizosphere 81.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10010447 3300001989 Bacteria 3447
2 JGI24738J21930_10008964 3300002075 Bacteria 2266
3 Ga0006562J51391_1040353 3300003578 Bacteria 3120
4 Ga0006562J51391_1040356 3300003578 Bacteria 1720
5 Ga0006562J51391_1048769 3300003578 Bacteria 8848
6 Ga0006562J51391_1048771 3300003578 Bacteria 4770
7 Ga0070682_100133479 3300005337 Bacteria 1683
8 Ga0070710_10000109 3300005437 Bacteria 38429
9 Ga0068856_100095757 3300005614 Bacteria 2957
10 Ga0081455_10001677 3300005937 Bacteria 26857
11 Ga0081539_10008925 3300005985 Bacteria 8548
12 Ga0075363_100006383 3300006048 Bacteria 5347
13 Ga0075431_100001341 3300006847 Bacteria 22523
14 Ga0099826_10078984 3300006948 Bacteria 2058
15 Ga0105251_10005321 3300009011 Bacteria 8461
16 Ga0105243_10279347 3300009148 Bacteria 1503
17 Ga0105239_10057311 3300010375 Bacteria 4273
18 Ga0105246_10053002 3300011119 Bacteria 2790
19 Ga0157372_10072759 3300013307 Bacteria 3874
20 Ga0157372_10084370 3300013307 Bacteria 3600
21 Ga0182008_10001312 3300014497 Bacteria 16986
22 Ga0157379_10000033 3300014968 Bacteria 83512
23 Ga0182007_10001652 3300015262 Bacteria 11807
24 Ga0183367_1008 3300015688 Bacteria 490626
25 Ga0206353_10624330 3300020082 Bacteria 1210
26 Ga0206353_11286074 3300020082 Bacteria 1910
27 Ga0213875_10007912 3300021388 Bacteria 5464
28 Ga0207426_1008528 3300025302 Bacteria 4124
29 Ga0207713_1031153 3300025735 Bacteria 2362
30 Ga0207692_10003141 3300025898 Bacteria 6408
31 Ga0207647_10012368 3300025904 Bacteria 5942
32 Ga0207687_10101063 3300025927 Bacteria 2122
33 Ga0207709_10028364 3300025935 Bacteria 3236
34 Ga0207665_10012250 3300025939 Bacteria 5631
35 Ga0268266_10301141 3300028379 Bacteria 1496
36 Ga0307515_10003050 3300028794 Bacteria 35485
37 Ga0307515_10014752 3300028794 Bacteria 14455
38 Ga0265338_10001945 3300028800 Bacteria 32263
39 Ga0307511_10004073 3300030521 Bacteria 14945
40 Ga0307511_10096555 3300030521 Bacteria 1968
41 Ga0307512_10001246 3300030522 Bacteria 36723
42 Ga0316177_1197593 3300030731 Bacteria 2275
43 Ga0316176_1142576 3300030732 Bacteria 3011
44 Ga0314311_1199289 3300030733 Bacteria 4016
45 Ga0316180_1118571 3300030736 Bacteria 2229
46 Ga0307513_10002997 3300031456 Bacteria 23028
47 Ga0307513_10041728 3300031456 Bacteria 5060
48 Ga0307509_10016499 3300031507 Bacteria 8542
49 Ga0307509_10023649 3300031507 Bacteria 6892
50 Ga0307509_10051127 3300031507 Bacteria 4422
51 Ga0307508_10009392 3300031616 Bacteria 8995
52 Ga0307508_10062200 3300031616 Bacteria 3296
53 Ga0307514_10002693 3300031649 Bacteria 17986
54 Ga0307514_10056397 3300031649 Bacteria 3015
55 Ga0307514_10094857 3300031649 Bacteria 2161
56 Ga0307514_10174004 3300031649 Bacteria 1400
57 Ga0316575_10003103 3300031665 Bacteria 5678
58 Ga0316579_10003855 3300031691 Bacteria 5907
59 Ga0316579_10017809 3300031691 Bacteria 3120
60 Ga0316576_10002291 3300031727 Bacteria 10848
61 Ga0316576_10089715 3300031727 Bacteria 2289
62 Ga0316576_10144894 3300031727 Bacteria 1789
63 Ga0316578_10010414 3300031728 Bacteria 4825
64 Ga0316578_10013319 3300031728 Bacteria 4359
65 Ga0307516_10007466 3300031730 Bacteria 12572
66 Ga0307516_10016086 3300031730 Bacteria 7841
67 Ga0307516_10091955 3300031730 Bacteria 2861
68 Ga0316577_10012281 3300031733 Bacteria 4664
69 Ga0307409_100030420 3300031995 Bacteria 3879
70 Ga0307409_100052528 3300031995 Bacteria 3126
71 Ga0307415_100222879 3300032126 Bacteria 1513
72 Ga0316585_10008209 3300032137 Bacteria 3024
73 Ga0316580_10002557 3300032139 Bacteria 5030
74 Ga0316580_10015236 3300032139 Bacteria 2351
75 Ga0307507_10020931 3300033179 Bacteria 7303
76 Ga0307507_10022851 3300033179 Bacteria 6888
77 Ga0307507_10073202 3300033179 Bacteria 3081
78 Ga0307510_10009192 3300033180 Bacteria 11769
79 Ga0307510_10014521 3300033180 Bacteria 9320
80 Ga0307510_10025624 3300033180 Bacteria 6796
81 Ga0373944_0001447 3300035089 Bacteria 5991
82 Ga0373951_0000043 3300035091 Bacteria 49665
83 Ga0373936_0003933 3300035113 Bacteria 5594
84 Ga0373945_0000238 3300035116 Bacteria 15194
85 Ga0373953_0112018 3300035117 Bacteria 1154
86 Ga0373956_0093317 3300035119 Bacteria 1390
87 Ga0373957_0071281 3300035120 Bacteria 1359
88 Ga0373943_0000802 3300035170 Bacteria 13772
89 Ga0373955_0011789 3300035172 Bacteria 4181
90 Ga0373955_0017178 3300035172 Bacteria 3575
91 Ga0373935_0001253 3300035692 Bacteria 14047
92 Ga0373935_0217352 3300035692 Bacteria 1326
93 Ga0373927_0002383 3300035695 Bacteria 13700
94 Ga0373933_0089983 3300035724 Bacteria 1892
95 Ga0373947_0101272 3300035725 Bacteria 1810
96 Ga0373937_0082405 3300036401 Bacteria 2976
97 Ga0373937_0109143 3300036401 Bacteria 2573
98 Ga0316582_0011974 3300036647 Bacteria 4823
99 Ga0316582_0020250 3300036647 Bacteria 3908
100 Ga0316584_0024409 3300036712 Bacteria 4424
101 Ga0373925_0004733 3300037068 Bacteria 10262
102 Ga0373925_0008941 3300037068 Bacteria 7297
103 Ga0395898_0018072 3300037466 Bacteria 7193
104 Ga0395898_0347498 3300037466 Bacteria 1414
105 Ga0395905_0287199 3300037471 Bacteria 1532
106 Ga0316581_0034774 3300037588 Bacteria 1525
107 Ga0436364_0388132 3300037853 Bacteria 5740
108 Ga0400486_10710 3300038742 Bacteria 19778
109 Ga0439436_0000983 3300041404 Bacteria 7909
110 Ga0439436_0012274 3300041404 Bacteria 2600
111 Ga0439439_0008482 3300041406 Bacteria 2428
112 Ga0451833_0577864 3300041491 Bacteria 3801
113 Ga0451837_0384653 3300041494 Bacteria 1431
114 Ga0451837_1279266 3300041494 Bacteria 10695
115 Ga0451839_0707163 3300041496 Bacteria 1190
116 Ga0451853_0523210 3300041512 Bacteria 3358
117 Ga0451853_2316153 3300041512 Bacteria 1556
118 Ga0439433_0000050 3300041999 Bacteria 14628
119 Ga0439448_0008481 3300042005 Bacteria 3010
120 Ga0439449_0011239 3300042007 Bacteria 3370
121 Ga0439449_0020099 3300042007 Bacteria 2502
122 Ga0439449_0053976 3300042007 Bacteria 1485
123 Ga0439457_000139 3300042014 Bacteria 18414
124 Ga0439457_010482 3300042014 Bacteria 2129
125 Ga0450894_000061 3300042131 Bacteria 17057
126 Ga0450903_000287 3300042138 Bacteria 11153
127 Ga0450906_018643 3300042145 Bacteria 1244
128 Ga0439458_0002128 3300042157 Bacteria 4896
129 Ga0439458_0012643 3300042157 Bacteria 1897
130 Ga0466969_0003717 3300044656 Bacteria 8111
131 Ga0466969_0008105 3300044656 Bacteria 5577
132 Ga0466969_0024880 3300044656 Bacteria 3079
133 Ga0466972_0005936 3300044658 Bacteria 6131
134 Ga0466972_0016449 3300044658 Bacteria 3699
135 Ga0466972_0016745 3300044658 Bacteria 3665
136 Ga0466972_0034114 3300044658 Bacteria 2495
137 Ga0466965_0000060 3300044683 Bacteria 34483
138 Ga0466965_0001194 3300044683 Bacteria 10265
139 Ga0466965_0038519 3300044683 Bacteria 2349
140 Ga0466966_0001375 3300044684 Bacteria 15650
141 Ga0466966_0015878 3300044684 Bacteria 4977
142 Ga0466961_0000532 3300044693 Bacteria 24186
143 Ga0466961_0003958 3300044693 Bacteria 9268
144 Ga0466961_0015124 3300044693 Bacteria 4954
145 Ga0466961_0030113 3300044693 Bacteria 3488
146 Ga0466963_0000553 3300044694 Bacteria 17596
147 Ga0466963_0021872 3300044694 Bacteria 4041
148 Ga0466963_0029161 3300044694 Bacteria 3549
149 Ga0466963_0074946 3300044694 Bacteria 2283
150 Ga0466963_0370628 3300044694 Bacteria 1009
151 Ga0466964_0002316 3300044706 Bacteria 6756
152 Ga0466971_0000435 3300044719 Bacteria 16354
153 Ga0466971_0006178 3300044719 Bacteria 5206
154 Ga0466971_0015558 3300044719 Bacteria 3350
155 Ga0466971_0059083 3300044719 Bacteria 1732
156 Ga0466968_0030386 3300044735 Bacteria 2238
157 Ga0466970_0006653 3300044765 Bacteria 5778
158 Ga0466970_0007692 3300044765 Bacteria 5406
159 Ga0466970_0019908 3300044765 Bacteria 3482
160 Ga0466957_0001608 3300044842 Bacteria 11845
161 Ga0466957_0188868 3300044842 Bacteria 1349
162 Ga0466960_0001244 3300044901 Bacteria 9222
163 Ga0466960_0008529 3300044901 Bacteria 4200
164 Ga0466960_0023713 3300044901 Bacteria 2758
165 Ga0466960_0042969 3300044901 Bacteria 2148
166 Ga0466959_0056608 3300045049 Bacteria 2861
167 Ga0466959_0060787 3300045049 Bacteria 2748
168 Ga0451576_0051309 3300045051 Bacteria 4325
169 Ga0466958_0000503 3300045836 Bacteria 16423
170 Ga0466958_0007323 3300045836 Bacteria 6063
171 Ga0466967_0002502 3300045976 Bacteria 11483
172 Ga0466967_0143939 3300045976 Bacteria 2222
173 Ga0466967_0146702 3300045976 Bacteria 2201
174 Ga0466967_0213609 3300045976 Bacteria 1830
175 Ga0466967_0292471 3300045976 Bacteria 1565
176 Ga0495617_054639 3300046452 Bacteria 1325
177 Ga0495627_045242 3300046453 Bacteria 1341
178 Ga0495592_0007783 3300046454 Bacteria 8031
179 Ga0495592_0020264 3300046454 Bacteria 5059
180 Ga0495603_0000510 3300046455 Bacteria 21610
181 Ga0495603_0020287 3300046455 Bacteria 4027
182 Ga0495603_0208287 3300046455 Bacteria 1129
183 Ga0495590_0100900 3300046457 Bacteria 1025
184 Ga0495629_0002110 3300046459 Bacteria 15420
185 Ga0495629_0003170 3300046459 Bacteria 12462
186 Ga0495629_0004900 3300046459 Bacteria 10049
187 Ga0495629_0009168 3300046459 Bacteria 7244
188 Ga0495629_0013852 3300046459 Bacteria 5818
189 Ga0495629_0056898 3300046459 Bacteria 2734
190 Ga0495629_0088126 3300046459 Bacteria 2165
191 Ga0495629_0090226 3300046459 Bacteria 2138
192 Ga0495629_0101503 3300046459 Bacteria 2007
193 Ga0495629_0226655 3300046459 Bacteria 1288
194 Ga0495638_0057090 3300046460 Bacteria 2422
195 Ga0495641_0023354 3300046461 Bacteria 3074
196 Ga0495641_0051609 3300046461 Bacteria 1877
197 Ga0495651_0007478 3300046462 Bacteria 8355
198 Ga0495651_0057776 3300046462 Bacteria 2978
199 Ga0495651_0176663 3300046462 Bacteria 1515
200 Ga0495651_0179142 3300046462 Bacteria 1501
201 Ga0495653_0004745 3300046463 Bacteria 11008
202 Ga0495653_0032959 3300046463 Bacteria 4108
203 Ga0495653_0046682 3300046463 Bacteria 3353
204 Ga0495582_0148492 3300046473 Bacteria 1330
205 Ga0495605_0002356 3300046474 Bacteria 11759
206 Ga0495662_0000389 3300046476 Bacteria 19593
207 Ga0495662_0006812 3300046476 Bacteria 5686
208 Ga0495662_0009969 3300046476 Bacteria 4666
209 Ga0495662_0039773 3300046476 Bacteria 2272
210 Ga0495662_0116281 3300046476 Bacteria 1311
211 Ga0495664_0010024 3300046477 Bacteria 5315
212 Ga0495664_0050824 3300046477 Bacteria 2461
213 Ga0495664_0151564 3300046477 Bacteria 1406
214 Ga0495664_0153583 3300046477 Bacteria 1396
215 Ga0495585_0099462 3300046492 Bacteria 1557
216 Ga0495594_0014576 3300046499 Bacteria 4121
217 Ga0495594_0036858 3300046499 Bacteria 2668
218 Ga0495594_0039455 3300046499 Bacteria 2582
219 Ga0495594_0078149 3300046499 Bacteria 1846
220 Ga0495596_0078082 3300046500 Bacteria 1285
221 Ga0495607_0029734 3300046501 Bacteria 3361
222 Ga0495607_0087960 3300046501 Bacteria 1689
223 Ga0495583_0013771 3300046506 Bacteria 4492
224 Ga0495606_0025681 3300046507 Bacteria 4213
225 Ga0495608_0001041 3300046511 Bacteria 19510
226 Ga0495608_0141006 3300046511 Bacteria 1538
227 Ga0495608_0241485 3300046511 Bacteria 1128
228 Ga0495610_0025319 3300046512 Bacteria 3186
229 Ga0495618_0009600 3300046514 Bacteria 5844
230 Ga0495618_0012441 3300046514 Bacteria 5169
231 Ga0495618_0032708 3300046514 Bacteria 3258
232 Ga0495618_0055114 3300046514 Bacteria 2517
233 Ga0495620_0004995 3300046515 Bacteria 7436
234 Ga0495628_0026827 3300046516 Bacteria 4689
235 Ga0495628_0031386 3300046516 Bacteria 4298
236 Ga0495630_0034461 3300046517 Bacteria 3780
237 Ga0495630_0227335 3300046517 Bacteria 1425
238 Ga0495637_0031059 3300046520 Bacteria 2365
239 Ga0495643_0004721 3300046522 Bacteria 9438
240 Ga0495643_0065707 3300046522 Bacteria 1915
241 Ga0495648_0038341 3300046524 Bacteria 3066
242 Ga0495666_0000261 3300046526 Bacteria 22812
243 Ga0495666_0006347 3300046526 Bacteria 5951
244 Ga0495652_0035225 3300046529 Bacteria 4357
245 Ga0495652_0093451 3300046529 Bacteria 2455
246 Ga0495652_0166381 3300046529 Bacteria 1706
247 Ga0495640_0002592 3300046533 Bacteria 14530
248 Ga0495640_0007457 3300046533 Bacteria 8592
249 Ga0495640_0018760 3300046533 Bacteria 5120
250 Ga0495640_0047196 3300046533 Bacteria 2981
251 Ga0495586_0023524 3300046535 Bacteria 3291
252 Ga0495586_0028243 3300046535 Bacteria 3003
253 Ga0495587_0005116 3300046536 Bacteria 8574
254 Ga0495587_0048191 3300046536 Bacteria 2523
255 Ga0495609_0032614 3300046538 Bacteria 2365
256 Ga0495645_0003947 3300046543 Bacteria 10120
257 Ga0495645_0026841 3300046543 Bacteria 4182
258 Ga0495645_0129744 3300046543 Bacteria 1768
259 Ga0495622_0002212 3300046557 Bacteria 9479
260 Ga0495622_0002507 3300046557 Bacteria 8879
261 Ga0495622_0052659 3300046557 Bacteria 1888
262 Ga0495622_0157740 3300046557 Bacteria 1024
263 Ga0495667_0028618 3300046559 Bacteria 3753
264 Ga0495667_0057270 3300046559 Bacteria 2562
265 Ga0495667_0084698 3300046559 Bacteria 2057
266 Ga0495667_0096605 3300046559 Bacteria 1912
267 Ga0495634_0010135 3300046642 Bacteria 6914
268 Ga0495634_0021703 3300046642 Bacteria 4533
269 Ga0495634_0022514 3300046642 Bacteria 4439
270 Ga0495634_0093252 3300046642 Bacteria 1953
271 Ga0495611_0019513 3300046648 Bacteria 2912
272 Ga0495611_0049509 3300046648 Bacteria 1891
273 Ga0495635_0001446 3300046663 Bacteria 15877
274 Ga0495635_0026875 3300046663 Bacteria 4002
275 Ga0495635_0052889 3300046663 Bacteria 2797
276 Ga0495635_0053749 3300046663 Bacteria 2774
277 Ga0495635_0053999 3300046663 Bacteria 2767
278 Ga0495661_0019702 3300046665 Bacteria 4416
279 Ga0495657_0004061 3300046675 Bacteria 11738
280 Ga0495657_0015661 3300046675 Bacteria 5541
281 Ga0495657_0016684 3300046675 Bacteria 5344
282 Ga0495657_0016874 3300046675 Bacteria 5308
283 Ga0495657_0057784 3300046675 Bacteria 2578
284 Ga0495657_0064398 3300046675 Bacteria 2415
285 Ga0495657_0080981 3300046675 Bacteria 2100
286 Ga0495599_0040297 3300046678 Bacteria 2933
287 Ga0495599_0041328 3300046678 Bacteria 2895
288 Ga0495599_0196655 3300046678 Bacteria 1239
289 Ga0495623_0091836 3300046679 Bacteria 1862
290 Ga0495646_0017152 3300046680 Bacteria 4596
291 Ga0495646_0056544 3300046680 Bacteria 2352
292 Ga0495646_0157259 3300046680 Bacteria 1260
293 Ga0495613_0001142 3300046689 Bacteria 20232
294 Ga0495613_0013435 3300046689 Bacteria 6082
295 Ga0495613_0013652 3300046689 Bacteria 6027
296 Ga0495613_0014945 3300046689 Bacteria 5761
297 Ga0495613_0021705 3300046689 Bacteria 4783
298 Ga0495613_0148211 3300046689 Bacteria 1674
299 Ga0495624_0019684 3300046690 Bacteria 4499
300 Ga0495624_0028204 3300046690 Bacteria 3670
301 Ga0495624_0053175 3300046690 Bacteria 2557
302 Ga0495624_0068445 3300046690 Bacteria 2213
303 Ga0495671_0022831 3300046692 Bacteria 3273
304 Ga0495671_0208414 3300046692 Bacteria 947
305 Ga0495649_0011047 3300046694 Bacteria 5319
306 Ga0495649_0087906 3300046694 Bacteria 1658
307 Ga0495589_0014508 3300046794 Bacteria 4055
308 Ga0495589_0019101 3300046794 Bacteria 3516
309 Ga0495589_0029311 3300046794 Bacteria 2774
310 Ga0495589_0038124 3300046794 Bacteria 2407
311 Ga0495589_0059021 3300046794 Bacteria 1886
312 Ga0495589_0076459 3300046794 Bacteria 1632
313 Ga0495600_0010471 3300046809 Bacteria 5759
314 Ga0495600_0010729 3300046809 Bacteria 5695
315 Ga0495600_0056281 3300046809 Bacteria 2569
316 Ga0495600_0100079 3300046809 Bacteria 1889
317 Ga0495600_0127345 3300046809 Bacteria 1656
318 Ga0495660_0014919 3300046810 Bacteria 4494
319 Ga0495581_0049681 3300047315 Bacteria 2422
320 Ga0495581_0088387 3300047315 Bacteria 1797
321 Ga0495581_0092966 3300047315 Bacteria 1750
322 Ga0495581_0172717 3300047315 Bacteria 1264
323 Ga0495581_0176371 3300047315 Bacteria 1249
324 Ga0495581_0200240 3300047315 Bacteria 1168
325 Ga0495604_0000211 3300047317 Bacteria 53509
326 Ga0495604_0010806 3300047317 Bacteria 7250
327 Ga0495604_0026440 3300047317 Bacteria 4619
328 Ga0495604_0057788 3300047317 Bacteria 2981
329 Ga0495604_0095141 3300047317 Bacteria 2200
330 Ga0495636_0010498 3300047318 Bacteria 3658
331 Ga0495636_0037577 3300047318 Bacteria 2000
332 Ga0495674_0000163 3300047319 Bacteria 51636
333 Ga0495674_0113684 3300047319 Bacteria 2293
334 Ga0495674_0142382 3300047319 Bacteria 2015
335 Ga0495674_0239008 3300047319 Bacteria 1497
336 Ga0495676_0000599 3300047321 Bacteria 29838
337 Ga0495676_0001779 3300047321 Bacteria 18823
338 Ga0495676_0003611 3300047321 Bacteria 14038
339 Ga0495676_0004226 3300047321 Bacteria 13116
340 Ga0495676_0006330 3300047321 Bacteria 10900
341 Ga0495676_0014188 3300047321 Bacteria 7133
342 Ga0495676_0020993 3300047321 Bacteria 5715
343 Ga0495680_0004104 3300047322 Bacteria 14008
344 Ga0495680_0007429 3300047322 Bacteria 10048
345 Ga0495683_0001255 3300047323 Bacteria 17202
346 Ga0495683_0104040 3300047323 Bacteria 1362
347 Ga0495687_001757 3300047443 Bacteria 19154
348 Ga0495687_013559 3300047443 Bacteria 4245
349 Ga0495675_0004344 3300047444 Bacteria 8576
350 Ga0495675_0004704 3300047444 Bacteria 8293
351 Ga0495675_0005542 3300047444 Bacteria 7699
352 Ga0495675_0010785 3300047444 Bacteria 5726
353 Ga0495675_0015627 3300047444 Bacteria 4798
354 Ga0495675_0069793 3300047444 Bacteria 2218
355 Ga0495677_0022305 3300047445 Bacteria 2296
356 Ga0495685_002009 3300047447 Bacteria 6313
357 Ga0495685_006468 3300047447 Bacteria 3836
358 Ga0495685_013068 3300047447 Bacteria 2816
359 Ga0495685_022296 3300047447 Bacteria 2179
360 Ga0495685_036234 3300047447 Bacteria 1694
361 Ga0495681_0001653 3300047470 Bacteria 16549
362 Ga0495684_0040459 3300047471 Bacteria 3573
363 Ga0495684_0073828 3300047471 Bacteria 2591
364 Ga0495684_0084205 3300047471 Bacteria 2412
365 Ga0495686_0028121 3300047472 Bacteria 3663
366 Ga0495593_0006827 3300047673 Bacteria 6680
367 Ga0495593_0014457 3300047673 Bacteria 4486
368 Ga0495593_0036113 3300047673 Bacteria 2681
369 Ga0495593_0036266 3300047673 Bacteria 2674
370 Ga0495614_0000179 3300048089 Bacteria 23615
371 Ga0495614_0008694 3300048089 Bacteria 4515
372 Ga0495614_0036689 3300048089 Bacteria 2104
373 Ga0495614_0070436 3300048089 Bacteria 1506
374 Ga0495626_0002880 3300048091 Bacteria 11472
375 Ga0496105_0041670 3300048908 Bacteria 3784
376 Ga0496109_0015129 3300048912 Bacteria 6717
377 Ga0496110_0134887 3300048913 Bacteria 2230
378 Ga0496119_0055334 3300048922 Bacteria 2410
379 Ga0496121_0001882 3300048924 Bacteria 33689
380 Ga0495678_019975 3300049459 Bacteria 2976
381 Ga0501032_0004468 3300049569 Bacteria 10537
382 Ga0501032_0020811 3300049569 Bacteria 4567
383 Ga0501032_0021669 3300049569 Bacteria 4465
384 Ga0501033_0001480 3300049570 Bacteria 20793
385 Ga0501033_0014896 3300049570 Bacteria 5902
386 Ga0501033_0147805 3300049570 Bacteria 1696
387 Ga0501034_0018163 3300049571 Bacteria 7214
388 Ga0501034_0040894 3300049571 Bacteria 4690
389 Ga0501034_0060333 3300049571 Bacteria 3810
390 Ga0501034_0180722 3300049571 Bacteria 2074
391 Ga0501034_0199911 3300049571 Bacteria 1957
392 Ga0501034_0351370 3300049571 Bacteria 1402
393 Ga0501036_0002034 3300049572 Bacteria 15749
394 Ga0501036_0030530 3300049572 Bacteria 4551
395 Ga0501037_0076504 3300049573 Bacteria 2430
396 Ga0501037_0089911 3300049573 Bacteria 2221
397 Ga0501037_0109210 3300049573 Bacteria 1993
398 Ga0501037_0127409 3300049573 Bacteria 1827
399 Ga0501038_0008108 3300049574 Bacteria 9666
400 Ga0501038_0020864 3300049574 Bacteria 5888
401 Ga0501038_0026228 3300049574 Bacteria 5191
402 Ga0501038_0078133 3300049574 Bacteria 2793
403 Ga0501038_0080456 3300049574 Bacteria 2746
404 Ga0501038_0352853 3300049574 Bacteria 1145
405 Ga0501039_0003937 3300049575 Bacteria 11160
406 Ga0501039_0063405 3300049575 Bacteria 2863
407 Ga0501040_0016871 3300049576 Bacteria 4839
408 Ga0501041_0007626 3300049577 Bacteria 6357
409 Ga0501042_0038359 3300049578 Bacteria 3403
410 Ga0501042_0166666 3300049578 Bacteria 1589
411 Ga0501043_0010098 3300049579 Bacteria 7401
412 Ga0501043_0010802 3300049579 Bacteria 7147
413 Ga0501043_0042693 3300049579 Bacteria 3563
414 Ga0501043_0096135 3300049579 Bacteria 2328
415 Ga0501043_0359964 3300049579 Bacteria 1104
416 Ga0501046_0143169 3300049580 Bacteria 1807
417 Ga0501046_0178842 3300049580 Bacteria 1587
418 Ga0501047_0000075 3300049581 Bacteria 124995
419 Ga0501047_0010008 3300049581 Bacteria 8964
420 Ga0501047_0019563 3300049581 Bacteria 6496
421 Ga0501047_0026242 3300049581 Bacteria 5604
422 Ga0501047_0029538 3300049581 Bacteria 5285
423 Ga0501047_0035891 3300049581 Bacteria 4790
424 Ga0501047_0050759 3300049581 Bacteria 4006
425 Ga0501047_0061426 3300049581 Bacteria 3625
426 Ga0501067_0008093 3300049583 Bacteria 5840
427 Ga0501068_0001012 3300049584 Bacteria 14818
428 Ga0501069_0041993 3300049585 Bacteria 2528
429 Ga0501070_0020288 3300049586 Bacteria 5575
430 Ga0501070_0024944 3300049586 Bacteria 5014
431 Ga0501070_0057670 3300049586 Bacteria 3219
432 Ga0501070_0084559 3300049586 Bacteria 2627
433 Ga0501070_0383418 3300049586 Bacteria 1138
434 Ga0501071_0015784 3300049587 Bacteria 5187
435 Ga0501072_0002416 3300049588 Bacteria 13994
436 Ga0501073_0027817 3300049589 Bacteria 4040
437 Ga0501074_0000911 3300049590 Bacteria 18917
438 Ga0501074_0103364 3300049590 Bacteria 2039
439 Ga0501076_0004866 3300049592 Bacteria 9599
440 Ga0501077_0031507 3300049593 Bacteria 3374
441 Ga0501079_0172122 3300049741 Bacteria 1688
442 Ga0501080_0017719 3300049742 Bacteria 6590
443 Ga0501083_0098323 3300049744 Bacteria 1930
444 Ga0501035_0002359 3300049822 Bacteria 18572
445 Ga0501035_0003374 3300049822 Bacteria 15284
446 Ga0501035_0028467 3300049822 Bacteria 5099
447 Ga0501035_0055243 3300049822 Bacteria 3545
448 Ga0501035_0109706 3300049822 Bacteria 2419
449 Ga0501044_0008982 3300049823 Bacteria 10928
450 Ga0501044_0015827 3300049823 Bacteria 8115
451 Ga0501044_0016471 3300049823 Bacteria 7933
452 Ga0501044_0021020 3300049823 Bacteria 6968
453 Ga0501044_0146169 3300049823 Bacteria 2349
454 Ga0501044_0182729 3300049823 Bacteria 2063
455 Ga0501044_0237307 3300049823 Bacteria 1768
456 Ga0501044_0291702 3300049823 Bacteria 1562
457 Ga0501045_0074721 3300049824 Bacteria 2496
458 Ga0501045_0146017 3300049824 Bacteria 1759
459 nmdc:mga04h51_74699_c1 3300050495 Bacteria 1191
460 nmdc:mga06r32_38010_c1 3300050510 Bacteria 4557
461 Ga0495601_0183316 3300053077 Bacteria 1368
462 Ga0495655_0056829 3300053083 Bacteria 1054
463 Ga0495619_0158557 3300053085 Bacteria 1562
464 Ga0500583_0118245 3300053092 Bacteria 1310
465 Ga0500640_103110 3300053095 Bacteria 1175
466 Ga0500650_0045552 3300053098 Bacteria 2032
467 Ga0500560_002145 3300053107 Bacteria 3689
468 Ga0500560_020314 3300053107 Bacteria 1882
469 Ga0500573_0047754 3300053140 Bacteria 2465
470 Ga0500573_0109195 3300053140 Bacteria 1549
471 Ga0500624_003049 3300053157 Bacteria 2212
472 Ga0501084_0018193 3300054114 Bacteria 5850
473 Ga0501082_0001998 3300060353 Bacteria 17925
474 Ga0466962_0003105 3300061719 Bacteria 7890
475 Ga0466962_0003196 3300061719 Bacteria 7779
476 Ga0466962_0041391 3300061719 Bacteria 2204
477 Ga0530510_0202921 3300061734 Bacteria 1473
478 3006499495 3006493962 Bacteria 8825450
479 2515721074 2515154129 Bacteria 5584369
480 2516084315 2515154202 Bacteria 5471270
481 2547406189 2547132111 Bacteria 8013147
482 2554257436 2554235005 Bacteria 6457341
483 2585298367 2582581312 Bacteria 7308206
484 2585305670 2582581313 Bacteria 10042643
485 2585312626 2582581314 Bacteria 11452267
486 2616702752 2616644814 Bacteria 11555299
487 2616904113 2616644941 Bacteria 8510691
488 2643763228 2643221548 Bacteria 8053412
489 2643900271 2643221578 Bacteria 9213798
490 2643948014 2643221587 Bacteria 7586415
491 2644262785 2643221647 Bacteria 10741251
492 2644390564 2643221670 Bacteria 6497041
493 2644405505 2643221673 Bacteria 9196637
494 2644433880 2643221677 Bacteria 7584031
495 2644442995 2643221678 Bacteria 9540101
496 2644463902 2643221682 Bacteria 6743283
497 2644628367 2643221714 Bacteria 9015452
498 2784589113 2784132148 Bacteria 8627943
499 2785342735 2784746763 Bacteria 9783172
500 2785370160 2784746768 Bacteria 10036182
501 2786671146 2786546132 Bacteria 10419719
502 2793985115 2791355406 Bacteria 11364898
503 2808842582 2808606359 Bacteria 9866990
504 2808921085 2808606375 Bacteria 9466072
505 2809232715 2808606448 Bacteria 8656184
506 2811845656 2808606982 Bacteria 7791042
507 2812357534 2811994879 Bacteria 9313447
508 2812480044 2811994917 Bacteria 7761064
509 2819697472 2818991463 Bacteria 7948711
510 2852637392 2852635781 Bacteria 8251373
511 2862178857 2862178590 Bacteria 8583590
512 2862286175 2862281513 Bacteria 9621493
513 2862292040 2862290372 Bacteria 7471434
514 2862389725 2862382967 Bacteria 10317375
515 2862516415 2862507626 Bacteria 9425308
516 2862578743 2862574272 Bacteria 10567477
517 2862707713 2862705112 Bacteria 6563286
518 2863412629 2863404153 Bacteria 9672205
519 2867347589 2867346516 Bacteria 7608576
520 2867372370 2867369537 Bacteria 6501581
521 2867435531 2867428634 Bacteria 9590268
522 2867478226 2867475112 Bacteria 6909112
523 2867509762 2867507094 Bacteria 6506033
524 2873155239 2873151551 Bacteria 8625867
525 2875395090 2875391855 Bacteria 7600475
526 2877680556 2877676314 Bacteria 9512378
527 2884694025 2884693830 Bacteria 11273186
528 2895439119 2895427314 Bacteria 13147766
529 2895448140 2895442618 Bacteria 11027144
530 2912719206 2912715099 Bacteria 9460473
531 2912724042 2912723979 Bacteria 8557534
532 2912731487 2912723979 Bacteria 8557534
533 2912761425 2912757875 Bacteria 7940295
534 2918504989 2918501144 Bacteria 8668083
535 2919475538 2919468124 Bacteria 9133025
536 2935390700 2935390628 Bacteria 7043367
537 2946049391 2946045630 Bacteria 8527308
538 2946068342 2946064051 Bacteria 8957905
539 2946076462 2946072368 Bacteria 8999607
540 2947228566 2947224130 Bacteria 9938529
541 2954006957 2954002825 Bacteria 9173742
542 2954385672 2954380949 Bacteria 10050426
543 2954677478 2954673503 Bacteria 9685905
544 2954686676 2954682443 Bacteria 9862841
545 2954696322 2954691527 Bacteria 10720516
546 2954711485 2954701450 Bacteria 10834262
547 2954715688 2954711539 Bacteria 10867210
548 2954725625 2954721474 Bacteria 10456478
549 2954736187 2954731030 Bacteria 10243860
550 2954744564 2954740390 Bacteria 10229294
551 2954755034 2954749733 Bacteria 10366972
552 2954763547 2954759201 Bacteria 9358192
553 2964329426 2964326757 Bacteria 3290868
554 2966602194 2966598605 Bacteria 7676064
555 2990050034 2990044586 Bacteria 6603797
556 2990061533 2990059506 Bacteria 9321252
557 2990091141 2990088156 Bacteria 6657676
558 2995468852 2995463766 Bacteria 8577691
559 2997458943 2997451912 Bacteria 8492419
560 2997604569 2997600082 Bacteria 9896405
561 3006325826 3006321560 Bacteria 8247479
562 3006399203 3006393351 Bacteria 6615579
563 3006425833 3006425503 Bacteria 6491253
564 3006487712 3006486233 Bacteria 8157040
565 8008488646 8008485437 Bacteria 7198341
566 8008578394 8008574985 Bacteria 7815457
567 8023625818 8023623736 Bacteria 8593882
568 8025482216 8025478263 Bacteria 8209203
569 8025527494 8025524527 Bacteria 7197316
570 8025534526 8025530807 Bacteria 8495698
571 8033691366 8033684223 Bacteria 6906479
572 8047718951 8047710418 Bacteria 11023148
573 8047897497 8047893842 Bacteria 11723082
574 8048127915 8048127548 Bacteria 11053136
575 8048361373 8048356638 Bacteria 11044339
576 8048374484 8048369669 Bacteria 11666822
577 8048383738 8048379754 Bacteria 11877923
578 8048410313 8048406513 Bacteria 8936924
579 8054160948 8054160619 Bacteria 7783213
580 8056452880 8056447290 Bacteria 7680491
581 8056671348 8056667051 Bacteria 6953971
582 8056837953 8056829672 Bacteria 9045328
583 JGI24739J22299_10010447
584 JGI24738J21930_10008964
585 Ga0006562J51391_1040353
586 Ga0006562J51391_1040356
587 Ga0006562J51391_1048769
588 Ga0006562J51391_1048771
589 Ga0070682_100133479
590 Ga0070710_10000109
591 Ga0068856_100095757
592 Ga0081455_10001677
593 Ga0081539_10008925
594 Ga0075363_100006383
595 Ga0075431_100001341
596 Ga0099826_10078984
597 Ga0105251_10005321
598 Ga0105243_10279347
599 Ga0105239_10057311
600 Ga0105246_10053002
601 Ga0157372_10072759
602 Ga0157372_10084370
603 Ga0182008_10001312
604 Ga0157379_10000033
605 Ga0182007_10001652
606 Ga0183367_1008
607 Ga0206353_10624330
608 Ga0206353_11286074
609 Ga0213875_10007912
610 Ga0207426_1008528
611 Ga0207713_1031153
612 Ga0207692_10003141
613 Ga0207647_10012368
614 Ga0207687_10101063
615 Ga0207709_10028364
616 Ga0207665_10012250
617 Ga0268266_10301141
618 Ga0307515_10003050
619 Ga0307515_10014752
620 Ga0265338_10001945
621 Ga0307511_10004073
622 Ga0307511_10096555
623 Ga0307512_10001246
624 Ga0316177_1197593
625 Ga0316176_1142576
626 Ga0314311_1199289
627 Ga0316180_1118571
628 Ga0307513_10002997
629 Ga0307513_10041728
630 Ga0307509_10016499
631 Ga0307509_10023649
632 Ga0307509_10051127
633 Ga0307508_10009392
634 Ga0307508_10062200
635 Ga0307514_10002693
636 Ga0307514_10056397
637 Ga0307514_10094857
638 Ga0307514_10174004
639 Ga0316575_10003103
640 Ga0316579_10003855
641 Ga0316579_10017809
642 Ga0316576_10002291
643 Ga0316576_10089715
644 Ga0316576_10144894
645 Ga0316578_10010414
646 Ga0316578_10013319
647 Ga0307516_10007466
648 Ga0307516_10016086
649 Ga0307516_10091955
650 Ga0316577_10012281
651 Ga0307409_100030420
652 Ga0307409_100052528
653 Ga0307415_100222879
654 Ga0316585_10008209
655 Ga0316580_10002557
656 Ga0316580_10015236
657 Ga0307507_10020931
658 Ga0307507_10022851
659 Ga0307507_10073202
660 Ga0307510_10009192
661 Ga0307510_10014521
662 Ga0307510_10025624
663 Ga0373944_0001447
664 Ga0373951_0000043
665 Ga0373936_0003933
666 Ga0373945_0000238
667 Ga0373953_0112018
668 Ga0373956_0093317
669 Ga0373957_0071281
670 Ga0373943_0000802
671 Ga0373955_0011789
672 Ga0373955_0017178
673 Ga0373935_0001253
674 Ga0373935_0217352
675 Ga0373927_0002383
676 Ga0373933_0089983
677 Ga0373947_0101272
678 Ga0373937_0082405
679 Ga0373937_0109143
680 Ga0316582_0011974
681 Ga0316582_0020250
682 Ga0316584_0024409
683 Ga0373925_0004733
684 Ga0373925_0008941
685 Ga0395898_0018072
686 Ga0395898_0347498
687 Ga0395905_0287199
688 Ga0316581_0034774
689 Ga0436364_0388132
690 Ga0400486_10710
691 Ga0439436_0000983
692 Ga0439436_0012274
693 Ga0439439_0008482
694 Ga0451833_0577864
695 Ga0451837_0384653
696 Ga0451837_1279266
697 Ga0451839_0707163
698 Ga0451853_0523210
699 Ga0451853_2316153
700 Ga0439433_0000050
701 Ga0439448_0008481
702 Ga0439449_0011239
703 Ga0439449_0020099
704 Ga0439449_0053976
705 Ga0439457_000139
706 Ga0439457_010482
707 Ga0450894_000061
708 Ga0450903_000287
709 Ga0450906_018643
710 Ga0439458_0002128
711 Ga0439458_0012643
712 Ga0466969_0003717
713 Ga0466969_0008105
714 Ga0466969_0024880
715 Ga0466972_0005936
716 Ga0466972_0016449
717 Ga0466972_0016745
718 Ga0466972_0034114
719 Ga0466965_0000060
720 Ga0466965_0001194
721 Ga0466965_0038519
722 Ga0466966_0001375
723 Ga0466966_0015878
724 Ga0466961_0000532
725 Ga0466961_0003958
726 Ga0466961_0015124
727 Ga0466961_0030113
728 Ga0466963_0000553
729 Ga0466963_0021872
730 Ga0466963_0029161
731 Ga0466963_0074946
732 Ga0466963_0370628
733 Ga0466964_0002316
734 Ga0466971_0000435
735 Ga0466971_0006178
736 Ga0466971_0015558
737 Ga0466971_0059083
738 Ga0466968_0030386
739 Ga0466970_0006653
740 Ga0466970_0007692
741 Ga0466970_0019908
742 Ga0466957_0001608
743 Ga0466957_0188868
744 Ga0466960_0001244
745 Ga0466960_0008529
746 Ga0466960_0023713
747 Ga0466960_0042969
748 Ga0466959_0056608
749 Ga0466959_0060787
750 Ga0451576_0051309
751 Ga0466958_0000503
752 Ga0466958_0007323
753 Ga0466967_0002502
754 Ga0466967_0143939
755 Ga0466967_0146702
756 Ga0466967_0213609
757 Ga0466967_0292471
758 Ga0495617_054639
759 Ga0495627_045242
760 Ga0495592_0007783
761 Ga0495592_0020264
762 Ga0495603_0000510
763 Ga0495603_0020287
764 Ga0495603_0208287
765 Ga0495590_0100900
766 Ga0495629_0002110
767 Ga0495629_0003170
768 Ga0495629_0004900
769 Ga0495629_0009168
770 Ga0495629_0013852
771 Ga0495629_0056898
772 Ga0495629_0088126
773 Ga0495629_0090226
774 Ga0495629_0101503
775 Ga0495629_0226655
776 Ga0495638_0057090
777 Ga0495641_0023354
778 Ga0495641_0051609
779 Ga0495651_0007478
780 Ga0495651_0057776
781 Ga0495651_0176663
782 Ga0495651_0179142
783 Ga0495653_0004745
784 Ga0495653_0032959
785 Ga0495653_0046682
786 Ga0495582_0148492
787 Ga0495605_0002356
788 Ga0495662_0000389
789 Ga0495662_0006812
790 Ga0495662_0009969
791 Ga0495662_0039773
792 Ga0495662_0116281
793 Ga0495664_0010024
794 Ga0495664_0050824
795 Ga0495664_0151564
796 Ga0495664_0153583
797 Ga0495585_0099462
798 Ga0495594_0014576
799 Ga0495594_0036858
800 Ga0495594_0039455
801 Ga0495594_0078149
802 Ga0495596_0078082
803 Ga0495607_0029734
804 Ga0495607_0087960
805 Ga0495583_0013771
806 Ga0495606_0025681
807 Ga0495608_0001041
808 Ga0495608_0141006
809 Ga0495608_0241485
810 Ga0495610_0025319
811 Ga0495618_0009600
812 Ga0495618_0012441
813 Ga0495618_0032708
814 Ga0495618_0055114
815 Ga0495620_0004995
816 Ga0495628_0026827
817 Ga0495628_0031386
818 Ga0495630_0034461
819 Ga0495630_0227335
820 Ga0495637_0031059
821 Ga0495643_0004721
822 Ga0495643_0065707
823 Ga0495648_0038341
824 Ga0495666_0000261
825 Ga0495666_0006347
826 Ga0495652_0035225
827 Ga0495652_0093451
828 Ga0495652_0166381
829 Ga0495640_0002592
830 Ga0495640_0007457
831 Ga0495640_0018760
832 Ga0495640_0047196
833 Ga0495586_0023524
834 Ga0495586_0028243
835 Ga0495587_0005116
836 Ga0495587_0048191
837 Ga0495609_0032614
838 Ga0495645_0003947
839 Ga0495645_0026841
840 Ga0495645_0129744
841 Ga0495622_0002212
842 Ga0495622_0002507
843 Ga0495622_0052659
844 Ga0495622_0157740
845 Ga0495667_0028618
846 Ga0495667_0057270
847 Ga0495667_0084698
848 Ga0495667_0096605
849 Ga0495634_0010135
850 Ga0495634_0021703
851 Ga0495634_0022514
852 Ga0495634_0093252
853 Ga0495611_0019513
854 Ga0495611_0049509
855 Ga0495635_0001446
856 Ga0495635_0026875
857 Ga0495635_0052889
858 Ga0495635_0053749
859 Ga0495635_0053999
860 Ga0495661_0019702
861 Ga0495657_0004061
862 Ga0495657_0015661
863 Ga0495657_0016684
864 Ga0495657_0016874
865 Ga0495657_0057784
866 Ga0495657_0064398
867 Ga0495657_0080981
868 Ga0495599_0040297
869 Ga0495599_0041328
870 Ga0495599_0196655
871 Ga0495623_0091836
872 Ga0495646_0017152
873 Ga0495646_0056544
874 Ga0495646_0157259
875 Ga0495613_0001142
876 Ga0495613_0013435
877 Ga0495613_0013652
878 Ga0495613_0014945
879 Ga0495613_0021705
880 Ga0495613_0148211
881 Ga0495624_0019684
882 Ga0495624_0028204
883 Ga0495624_0053175
884 Ga0495624_0068445
885 Ga0495671_0022831
886 Ga0495671_0208414
887 Ga0495649_0011047
888 Ga0495649_0087906
889 Ga0495589_0014508
890 Ga0495589_0019101
891 Ga0495589_0029311
892 Ga0495589_0038124
893 Ga0495589_0059021
894 Ga0495589_0076459
895 Ga0495600_0010471
896 Ga0495600_0010729
897 Ga0495600_0056281
898 Ga0495600_0100079
899 Ga0495600_0127345
900 Ga0495660_0014919
901 Ga0495581_0049681
902 Ga0495581_0088387
903 Ga0495581_0092966
904 Ga0495581_0172717
905 Ga0495581_0176371
906 Ga0495581_0200240
907 Ga0495604_0000211
908 Ga0495604_0010806
909 Ga0495604_0026440
910 Ga0495604_0057788
911 Ga0495604_0095141
912 Ga0495636_0010498
913 Ga0495636_0037577
914 Ga0495674_0000163
915 Ga0495674_0113684
916 Ga0495674_0142382
917 Ga0495674_0239008
918 Ga0495676_0000599
919 Ga0495676_0001779
920 Ga0495676_0003611
921 Ga0495676_0004226
922 Ga0495676_0006330
923 Ga0495676_0014188
924 Ga0495676_0020993
925 Ga0495680_0004104
926 Ga0495680_0007429
927 Ga0495683_0001255
928 Ga0495683_0104040
929 Ga0495687_001757
930 Ga0495687_013559
931 Ga0495675_0004344
932 Ga0495675_0004704
933 Ga0495675_0005542
934 Ga0495675_0010785
935 Ga0495675_0015627
936 Ga0495675_0069793
937 Ga0495677_0022305
938 Ga0495685_002009
939 Ga0495685_006468
940 Ga0495685_013068
941 Ga0495685_022296
942 Ga0495685_036234
943 Ga0495681_0001653
944 Ga0495684_0040459
945 Ga0495684_0073828
946 Ga0495684_0084205
947 Ga0495686_0028121
948 Ga0495593_0006827
949 Ga0495593_0014457
950 Ga0495593_0036113
951 Ga0495593_0036266
952 Ga0495614_0000179
953 Ga0495614_0008694
954 Ga0495614_0036689
955 Ga0495614_0070436
956 Ga0495626_0002880
957 Ga0496105_0041670
958 Ga0496109_0015129
959 Ga0496110_0134887
960 Ga0496119_0055334
961 Ga0496121_0001882
962 Ga0495678_019975
963 Ga0501032_0004468
964 Ga0501032_0020811
965 Ga0501032_0021669
966 Ga0501033_0001480
967 Ga0501033_0014896
968 Ga0501033_0147805
969 Ga0501034_0018163
970 Ga0501034_0040894
971 Ga0501034_0060333
972 Ga0501034_0180722
973 Ga0501034_0199911
974 Ga0501034_0351370
975 Ga0501036_0002034
976 Ga0501036_0030530
977 Ga0501037_0076504
978 Ga0501037_0089911
979 Ga0501037_0109210
980 Ga0501037_0127409
981 Ga0501038_0008108
982 Ga0501038_0020864
983 Ga0501038_0026228
984 Ga0501038_0078133
985 Ga0501038_0080456
986 Ga0501038_0352853
987 Ga0501039_0003937
988 Ga0501039_0063405
989 Ga0501040_0016871
990 Ga0501041_0007626
991 Ga0501042_0038359
992 Ga0501042_0166666
993 Ga0501043_0010098
994 Ga0501043_0010802
995 Ga0501043_0042693
996 Ga0501043_0096135
997 Ga0501043_0359964
998 Ga0501046_0143169
999 Ga0501046_0178842
1000 Ga0501047_0000075
1001 Ga0501047_0010008
1002 Ga0501047_0019563
1003 Ga0501047_0026242
1004 Ga0501047_0029538
1005 Ga0501047_0035891
1006 Ga0501047_0050759
1007 Ga0501047_0061426
1008 Ga0501067_0008093
1009 Ga0501068_0001012
1010 Ga0501069_0041993
1011 Ga0501070_0020288
1012 Ga0501070_0024944
1013 Ga0501070_0057670
1014 Ga0501070_0084559
1015 Ga0501070_0383418
1016 Ga0501071_0015784
1017 Ga0501072_0002416
1018 Ga0501073_0027817
1019 Ga0501074_0000911
1020 Ga0501074_0103364
1021 Ga0501076_0004866
1022 Ga0501077_0031507
1023 Ga0501079_0172122
1024 Ga0501080_0017719
1025 Ga0501083_0098323
1026 Ga0501035_0002359
1027 Ga0501035_0003374
1028 Ga0501035_0028467
1029 Ga0501035_0055243
1030 Ga0501035_0109706
1031 Ga0501044_0008982
1032 Ga0501044_0015827
1033 Ga0501044_0016471
1034 Ga0501044_0021020
1035 Ga0501044_0146169
1036 Ga0501044_0182729
1037 Ga0501044_0237307
1038 Ga0501044_0291702
1039 Ga0501045_0074721
1040 Ga0501045_0146017
1041 nmdc:mga04h51_74699_c1
1042 nmdc:mga06r32_38010_c1
1043 Ga0495601_0183316
1044 Ga0495655_0056829
1045 Ga0495619_0158557
1046 Ga0500583_0118245
1047 Ga0500640_103110
1048 Ga0500650_0045552
1049 Ga0500560_002145
1050 Ga0500560_020314
1051 Ga0500573_0047754
1052 Ga0500573_0109195
1053 Ga0500624_003049
1054 Ga0501084_0018193
1055 Ga0501082_0001998
1056 Ga0466962_0003105
1057 Ga0466962_0003196
1058 Ga0466962_0041391
1059 Ga0530510_0202921
1060 3006499495
1061 2515721074
1062 2516084315
1063 2547406189
1064 2554257436
1065 2585298367
1066 2585305670
1067 2585312626
1068 2616702752
1069 2616904113
1070 2643763228
1071 2643900271
1072 2643948014
1073 2644262785
1074 2644390564
1075 2644405505
1076 2644433880
1077 2644442995
1078 2644463902
1079 2644628367
1080 2784589113
1081 2785342735
1082 2785370160
1083 2786671146
1084 2793985115
1085 2808842582
1086 2808921085
1087 2809232715
1088 2811845656
1089 2812357534
1090 2812480044
1091 2819697472
1092 2852637392
1093 2862178857
1094 2862286175
1095 2862292040
1096 2862389725
1097 2862516415
1098 2862578743
1099 2862707713
1100 2863412629
1101 2867347589
1102 2867372370
1103 2867435531
1104 2867478226
1105 2867509762
1106 2873155239
1107 2875395090
1108 2877680556
1109 2884694025
1110 2895439119
1111 2895448140
1112 2912719206
1113 2912724042
1114 2912731487
1115 2912761425
1116 2918504989
1117 2919475538
1118 2935390700
1119 2946049391
1120 2946068342
1121 2946076462
1122 2947228566
1123 2954006957
1124 2954385672
1125 2954677478
1126 2954686676
1127 2954696322
1128 2954711485
1129 2954715688
1130 2954725625
1131 2954736187
1132 2954744564
1133 2954755034
1134 2954763547
1135 2964329426
1136 2966602194
1137 2990050034
1138 2990061533
1139 2990091141
1140 2995468852
1141 2997458943
1142 2997604569
1143 3006325826
1144 3006399203
1145 3006425833
1146 3006487712
1147 8008488646
1148 8008578394
1149 8023625818
1150 8025482216
1151 8025527494
1152 8025534526
1153 8033691366
1154 8047718951
1155 8047897497
1156 8048127915
1157 8048361373
1158 8048374484
1159 8048383738
1160 8048410313
1161 8054160948
1162 8056452880
1163 8056671348
1164 8056837953

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

175

304

0.91

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

50

134

0.89

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

207

347

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.982 1 325
2j8z-assembly1.cif.gz_A-2 crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.9761 1 326
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9761 1 325
2oby-assembly2.cif.gz_C crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.9735 1 326
2j8z-assembly1.cif.gz_A-2 crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.9731 1 326
ID Description Score Start End Superfamily
af_O65423_126_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9976 127 262 3.40.50.720
af_C6TID4_1_124_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.996 1 123 3.90.180.10
af_P72043_133_294_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9934 133 290 3.40.50.720
af_A0A1D6HNQ2_3_340_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9934 1 324 3.90.180.10
af_A0A1D6HNQ2_126_296_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9932 123 280 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A803NY03-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9953 2 324 GO:0016651
GO:0034045
GO:0070402
AF-A0A445BBA4-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9953 1 324 GO:0008270
GO:0016651
GO:0070402
AF-A0A1B1BLD5-F1-model_v4 NADPH:quinone oxidoreductase 0.9904 1 324 GO:0016651
GO:0070402
AF-B9JTA9-F1-model_v4 Quinone oxidoreductase 0.9902 1 325 GO:0016651
GO:0070402
AF-A0A512H9F7-F1-model_v4 NAD(P)H quinone oxidoreductase 0.9899 1 326 GO:0016651
GO:0070402

Map