F466232
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 582 | 330 | 1164 | 318 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|3006493962|3006499495 |
| Length | 351 |
| Sequence | TEDRSDRGRRQPGSGRGRRSSVPLMHAITISEPGGPEALVWAEVPDPVPGEGEVLVEVTASAVNRADIMQRQGFYDPPPGASPYPGLECAGRIAALGPGVSGWAVGDEVCALLAGGGYAQKVAVPSGQLLPVPEGVGLKQAAALPEVVCTVWSNVFMVAHLRPGETLLVHGGSSGIGTMAIQLAKAVGAKVAVTAGTKEKLERCAELGADILINYREQDFVAEIKEATGGAGADVILDNMGAKYLDRNVQALAVNGRLAIIGMQGGRKGELNIGTLLAKRAAVSATSLRARPLEEKAAIVAAVREHVWPLVAAGHVRPIVDRELPMSEAPAAHRVVEESGHIGKVLLTTAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 6 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 7 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 10 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 11 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 12 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 13 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 14 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 15 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 16 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 17 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 18 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 19 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 20 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 21 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 22 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 23 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 24 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 32 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 33 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 34 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 35 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 36 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 37 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 38 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 39 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 40 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 41 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 42 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 43 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 44 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 45 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 46 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 47 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 48 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 49 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 50 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 51 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 52 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 53 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 54 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 55 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 56 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 57 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 58 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 59 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 60 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 61 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 62 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 63 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 64 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 65 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 66 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 67 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 68 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 69 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 70 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 71 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 72 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 73 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 74 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 75 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 76 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 77 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 78 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 79 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 80 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 81 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 82 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 83 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 84 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 85 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 86 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 87 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 88 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 89 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 90 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 91 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 92 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 93 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 94 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 95 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 96 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 97 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 98 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 99 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 100 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 101 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 102 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 103 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 104 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 105 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 106 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 107 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 178 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 180 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 181 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 182 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 213 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 218 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 219 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 220 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 221 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 222 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 223 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 226 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 227 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 228 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 229 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 230 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 231 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 232 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 233 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 234 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 235 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 236 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 237 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 238 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 239 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 240 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 241 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 242 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 243 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 244 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 245 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 246 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 247 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 248 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 249 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 250 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 251 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 252 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 253 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 254 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 255 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 256 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 257 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 258 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 259 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 260 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 261 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 262 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 263 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 264 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 265 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 266 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 267 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 268 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 269 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 270 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 271 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 272 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 273 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 274 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 275 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 276 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 277 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 278 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 279 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 280 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 281 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 282 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 283 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 284 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 285 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 286 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 287 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 288 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 289 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 290 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 291 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 292 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 293 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 294 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 295 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 296 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 297 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 298 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 299 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 300 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 301 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 302 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 303 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 304 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 305 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 306 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 307 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 308 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 309 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 310 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 311 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 312 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 313 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 314 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 315 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 316 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 317 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 318 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 319 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 320 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 321 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 322 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 323 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 324 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 325 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 326 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 327 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 328 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 329 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 330 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.93 |
| Metatranscriptomes | 1.03 |
| Isolates | 18.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.89 |
| Nodule | 0.52 |
| Rhizoplane | 0.69 |
| Rhizosphere | 81.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10010447 | 3300001989 | Bacteria | 3447 |
| 2 | JGI24738J21930_10008964 | 3300002075 | Bacteria | 2266 |
| 3 | Ga0006562J51391_1040353 | 3300003578 | Bacteria | 3120 |
| 4 | Ga0006562J51391_1040356 | 3300003578 | Bacteria | 1720 |
| 5 | Ga0006562J51391_1048769 | 3300003578 | Bacteria | 8848 |
| 6 | Ga0006562J51391_1048771 | 3300003578 | Bacteria | 4770 |
| 7 | Ga0070682_100133479 | 3300005337 | Bacteria | 1683 |
| 8 | Ga0070710_10000109 | 3300005437 | Bacteria | 38429 |
| 9 | Ga0068856_100095757 | 3300005614 | Bacteria | 2957 |
| 10 | Ga0081455_10001677 | 3300005937 | Bacteria | 26857 |
| 11 | Ga0081539_10008925 | 3300005985 | Bacteria | 8548 |
| 12 | Ga0075363_100006383 | 3300006048 | Bacteria | 5347 |
| 13 | Ga0075431_100001341 | 3300006847 | Bacteria | 22523 |
| 14 | Ga0099826_10078984 | 3300006948 | Bacteria | 2058 |
| 15 | Ga0105251_10005321 | 3300009011 | Bacteria | 8461 |
| 16 | Ga0105243_10279347 | 3300009148 | Bacteria | 1503 |
| 17 | Ga0105239_10057311 | 3300010375 | Bacteria | 4273 |
| 18 | Ga0105246_10053002 | 3300011119 | Bacteria | 2790 |
| 19 | Ga0157372_10072759 | 3300013307 | Bacteria | 3874 |
| 20 | Ga0157372_10084370 | 3300013307 | Bacteria | 3600 |
| 21 | Ga0182008_10001312 | 3300014497 | Bacteria | 16986 |
| 22 | Ga0157379_10000033 | 3300014968 | Bacteria | 83512 |
| 23 | Ga0182007_10001652 | 3300015262 | Bacteria | 11807 |
| 24 | Ga0183367_1008 | 3300015688 | Bacteria | 490626 |
| 25 | Ga0206353_10624330 | 3300020082 | Bacteria | 1210 |
| 26 | Ga0206353_11286074 | 3300020082 | Bacteria | 1910 |
| 27 | Ga0213875_10007912 | 3300021388 | Bacteria | 5464 |
| 28 | Ga0207426_1008528 | 3300025302 | Bacteria | 4124 |
| 29 | Ga0207713_1031153 | 3300025735 | Bacteria | 2362 |
| 30 | Ga0207692_10003141 | 3300025898 | Bacteria | 6408 |
| 31 | Ga0207647_10012368 | 3300025904 | Bacteria | 5942 |
| 32 | Ga0207687_10101063 | 3300025927 | Bacteria | 2122 |
| 33 | Ga0207709_10028364 | 3300025935 | Bacteria | 3236 |
| 34 | Ga0207665_10012250 | 3300025939 | Bacteria | 5631 |
| 35 | Ga0268266_10301141 | 3300028379 | Bacteria | 1496 |
| 36 | Ga0307515_10003050 | 3300028794 | Bacteria | 35485 |
| 37 | Ga0307515_10014752 | 3300028794 | Bacteria | 14455 |
| 38 | Ga0265338_10001945 | 3300028800 | Bacteria | 32263 |
| 39 | Ga0307511_10004073 | 3300030521 | Bacteria | 14945 |
| 40 | Ga0307511_10096555 | 3300030521 | Bacteria | 1968 |
| 41 | Ga0307512_10001246 | 3300030522 | Bacteria | 36723 |
| 42 | Ga0316177_1197593 | 3300030731 | Bacteria | 2275 |
| 43 | Ga0316176_1142576 | 3300030732 | Bacteria | 3011 |
| 44 | Ga0314311_1199289 | 3300030733 | Bacteria | 4016 |
| 45 | Ga0316180_1118571 | 3300030736 | Bacteria | 2229 |
| 46 | Ga0307513_10002997 | 3300031456 | Bacteria | 23028 |
| 47 | Ga0307513_10041728 | 3300031456 | Bacteria | 5060 |
| 48 | Ga0307509_10016499 | 3300031507 | Bacteria | 8542 |
| 49 | Ga0307509_10023649 | 3300031507 | Bacteria | 6892 |
| 50 | Ga0307509_10051127 | 3300031507 | Bacteria | 4422 |
| 51 | Ga0307508_10009392 | 3300031616 | Bacteria | 8995 |
| 52 | Ga0307508_10062200 | 3300031616 | Bacteria | 3296 |
| 53 | Ga0307514_10002693 | 3300031649 | Bacteria | 17986 |
| 54 | Ga0307514_10056397 | 3300031649 | Bacteria | 3015 |
| 55 | Ga0307514_10094857 | 3300031649 | Bacteria | 2161 |
| 56 | Ga0307514_10174004 | 3300031649 | Bacteria | 1400 |
| 57 | Ga0316575_10003103 | 3300031665 | Bacteria | 5678 |
| 58 | Ga0316579_10003855 | 3300031691 | Bacteria | 5907 |
| 59 | Ga0316579_10017809 | 3300031691 | Bacteria | 3120 |
| 60 | Ga0316576_10002291 | 3300031727 | Bacteria | 10848 |
| 61 | Ga0316576_10089715 | 3300031727 | Bacteria | 2289 |
| 62 | Ga0316576_10144894 | 3300031727 | Bacteria | 1789 |
| 63 | Ga0316578_10010414 | 3300031728 | Bacteria | 4825 |
| 64 | Ga0316578_10013319 | 3300031728 | Bacteria | 4359 |
| 65 | Ga0307516_10007466 | 3300031730 | Bacteria | 12572 |
| 66 | Ga0307516_10016086 | 3300031730 | Bacteria | 7841 |
| 67 | Ga0307516_10091955 | 3300031730 | Bacteria | 2861 |
| 68 | Ga0316577_10012281 | 3300031733 | Bacteria | 4664 |
| 69 | Ga0307409_100030420 | 3300031995 | Bacteria | 3879 |
| 70 | Ga0307409_100052528 | 3300031995 | Bacteria | 3126 |
| 71 | Ga0307415_100222879 | 3300032126 | Bacteria | 1513 |
| 72 | Ga0316585_10008209 | 3300032137 | Bacteria | 3024 |
| 73 | Ga0316580_10002557 | 3300032139 | Bacteria | 5030 |
| 74 | Ga0316580_10015236 | 3300032139 | Bacteria | 2351 |
| 75 | Ga0307507_10020931 | 3300033179 | Bacteria | 7303 |
| 76 | Ga0307507_10022851 | 3300033179 | Bacteria | 6888 |
| 77 | Ga0307507_10073202 | 3300033179 | Bacteria | 3081 |
| 78 | Ga0307510_10009192 | 3300033180 | Bacteria | 11769 |
| 79 | Ga0307510_10014521 | 3300033180 | Bacteria | 9320 |
| 80 | Ga0307510_10025624 | 3300033180 | Bacteria | 6796 |
| 81 | Ga0373944_0001447 | 3300035089 | Bacteria | 5991 |
| 82 | Ga0373951_0000043 | 3300035091 | Bacteria | 49665 |
| 83 | Ga0373936_0003933 | 3300035113 | Bacteria | 5594 |
| 84 | Ga0373945_0000238 | 3300035116 | Bacteria | 15194 |
| 85 | Ga0373953_0112018 | 3300035117 | Bacteria | 1154 |
| 86 | Ga0373956_0093317 | 3300035119 | Bacteria | 1390 |
| 87 | Ga0373957_0071281 | 3300035120 | Bacteria | 1359 |
| 88 | Ga0373943_0000802 | 3300035170 | Bacteria | 13772 |
| 89 | Ga0373955_0011789 | 3300035172 | Bacteria | 4181 |
| 90 | Ga0373955_0017178 | 3300035172 | Bacteria | 3575 |
| 91 | Ga0373935_0001253 | 3300035692 | Bacteria | 14047 |
| 92 | Ga0373935_0217352 | 3300035692 | Bacteria | 1326 |
| 93 | Ga0373927_0002383 | 3300035695 | Bacteria | 13700 |
| 94 | Ga0373933_0089983 | 3300035724 | Bacteria | 1892 |
| 95 | Ga0373947_0101272 | 3300035725 | Bacteria | 1810 |
| 96 | Ga0373937_0082405 | 3300036401 | Bacteria | 2976 |
| 97 | Ga0373937_0109143 | 3300036401 | Bacteria | 2573 |
| 98 | Ga0316582_0011974 | 3300036647 | Bacteria | 4823 |
| 99 | Ga0316582_0020250 | 3300036647 | Bacteria | 3908 |
| 100 | Ga0316584_0024409 | 3300036712 | Bacteria | 4424 |
| 101 | Ga0373925_0004733 | 3300037068 | Bacteria | 10262 |
| 102 | Ga0373925_0008941 | 3300037068 | Bacteria | 7297 |
| 103 | Ga0395898_0018072 | 3300037466 | Bacteria | 7193 |
| 104 | Ga0395898_0347498 | 3300037466 | Bacteria | 1414 |
| 105 | Ga0395905_0287199 | 3300037471 | Bacteria | 1532 |
| 106 | Ga0316581_0034774 | 3300037588 | Bacteria | 1525 |
| 107 | Ga0436364_0388132 | 3300037853 | Bacteria | 5740 |
| 108 | Ga0400486_10710 | 3300038742 | Bacteria | 19778 |
| 109 | Ga0439436_0000983 | 3300041404 | Bacteria | 7909 |
| 110 | Ga0439436_0012274 | 3300041404 | Bacteria | 2600 |
| 111 | Ga0439439_0008482 | 3300041406 | Bacteria | 2428 |
| 112 | Ga0451833_0577864 | 3300041491 | Bacteria | 3801 |
| 113 | Ga0451837_0384653 | 3300041494 | Bacteria | 1431 |
| 114 | Ga0451837_1279266 | 3300041494 | Bacteria | 10695 |
| 115 | Ga0451839_0707163 | 3300041496 | Bacteria | 1190 |
| 116 | Ga0451853_0523210 | 3300041512 | Bacteria | 3358 |
| 117 | Ga0451853_2316153 | 3300041512 | Bacteria | 1556 |
| 118 | Ga0439433_0000050 | 3300041999 | Bacteria | 14628 |
| 119 | Ga0439448_0008481 | 3300042005 | Bacteria | 3010 |
| 120 | Ga0439449_0011239 | 3300042007 | Bacteria | 3370 |
| 121 | Ga0439449_0020099 | 3300042007 | Bacteria | 2502 |
| 122 | Ga0439449_0053976 | 3300042007 | Bacteria | 1485 |
| 123 | Ga0439457_000139 | 3300042014 | Bacteria | 18414 |
| 124 | Ga0439457_010482 | 3300042014 | Bacteria | 2129 |
| 125 | Ga0450894_000061 | 3300042131 | Bacteria | 17057 |
| 126 | Ga0450903_000287 | 3300042138 | Bacteria | 11153 |
| 127 | Ga0450906_018643 | 3300042145 | Bacteria | 1244 |
| 128 | Ga0439458_0002128 | 3300042157 | Bacteria | 4896 |
| 129 | Ga0439458_0012643 | 3300042157 | Bacteria | 1897 |
| 130 | Ga0466969_0003717 | 3300044656 | Bacteria | 8111 |
| 131 | Ga0466969_0008105 | 3300044656 | Bacteria | 5577 |
| 132 | Ga0466969_0024880 | 3300044656 | Bacteria | 3079 |
| 133 | Ga0466972_0005936 | 3300044658 | Bacteria | 6131 |
| 134 | Ga0466972_0016449 | 3300044658 | Bacteria | 3699 |
| 135 | Ga0466972_0016745 | 3300044658 | Bacteria | 3665 |
| 136 | Ga0466972_0034114 | 3300044658 | Bacteria | 2495 |
| 137 | Ga0466965_0000060 | 3300044683 | Bacteria | 34483 |
| 138 | Ga0466965_0001194 | 3300044683 | Bacteria | 10265 |
| 139 | Ga0466965_0038519 | 3300044683 | Bacteria | 2349 |
| 140 | Ga0466966_0001375 | 3300044684 | Bacteria | 15650 |
| 141 | Ga0466966_0015878 | 3300044684 | Bacteria | 4977 |
| 142 | Ga0466961_0000532 | 3300044693 | Bacteria | 24186 |
| 143 | Ga0466961_0003958 | 3300044693 | Bacteria | 9268 |
| 144 | Ga0466961_0015124 | 3300044693 | Bacteria | 4954 |
| 145 | Ga0466961_0030113 | 3300044693 | Bacteria | 3488 |
| 146 | Ga0466963_0000553 | 3300044694 | Bacteria | 17596 |
| 147 | Ga0466963_0021872 | 3300044694 | Bacteria | 4041 |
| 148 | Ga0466963_0029161 | 3300044694 | Bacteria | 3549 |
| 149 | Ga0466963_0074946 | 3300044694 | Bacteria | 2283 |
| 150 | Ga0466963_0370628 | 3300044694 | Bacteria | 1009 |
| 151 | Ga0466964_0002316 | 3300044706 | Bacteria | 6756 |
| 152 | Ga0466971_0000435 | 3300044719 | Bacteria | 16354 |
| 153 | Ga0466971_0006178 | 3300044719 | Bacteria | 5206 |
| 154 | Ga0466971_0015558 | 3300044719 | Bacteria | 3350 |
| 155 | Ga0466971_0059083 | 3300044719 | Bacteria | 1732 |
| 156 | Ga0466968_0030386 | 3300044735 | Bacteria | 2238 |
| 157 | Ga0466970_0006653 | 3300044765 | Bacteria | 5778 |
| 158 | Ga0466970_0007692 | 3300044765 | Bacteria | 5406 |
| 159 | Ga0466970_0019908 | 3300044765 | Bacteria | 3482 |
| 160 | Ga0466957_0001608 | 3300044842 | Bacteria | 11845 |
| 161 | Ga0466957_0188868 | 3300044842 | Bacteria | 1349 |
| 162 | Ga0466960_0001244 | 3300044901 | Bacteria | 9222 |
| 163 | Ga0466960_0008529 | 3300044901 | Bacteria | 4200 |
| 164 | Ga0466960_0023713 | 3300044901 | Bacteria | 2758 |
| 165 | Ga0466960_0042969 | 3300044901 | Bacteria | 2148 |
| 166 | Ga0466959_0056608 | 3300045049 | Bacteria | 2861 |
| 167 | Ga0466959_0060787 | 3300045049 | Bacteria | 2748 |
| 168 | Ga0451576_0051309 | 3300045051 | Bacteria | 4325 |
| 169 | Ga0466958_0000503 | 3300045836 | Bacteria | 16423 |
| 170 | Ga0466958_0007323 | 3300045836 | Bacteria | 6063 |
| 171 | Ga0466967_0002502 | 3300045976 | Bacteria | 11483 |
| 172 | Ga0466967_0143939 | 3300045976 | Bacteria | 2222 |
| 173 | Ga0466967_0146702 | 3300045976 | Bacteria | 2201 |
| 174 | Ga0466967_0213609 | 3300045976 | Bacteria | 1830 |
| 175 | Ga0466967_0292471 | 3300045976 | Bacteria | 1565 |
| 176 | Ga0495617_054639 | 3300046452 | Bacteria | 1325 |
| 177 | Ga0495627_045242 | 3300046453 | Bacteria | 1341 |
| 178 | Ga0495592_0007783 | 3300046454 | Bacteria | 8031 |
| 179 | Ga0495592_0020264 | 3300046454 | Bacteria | 5059 |
| 180 | Ga0495603_0000510 | 3300046455 | Bacteria | 21610 |
| 181 | Ga0495603_0020287 | 3300046455 | Bacteria | 4027 |
| 182 | Ga0495603_0208287 | 3300046455 | Bacteria | 1129 |
| 183 | Ga0495590_0100900 | 3300046457 | Bacteria | 1025 |
| 184 | Ga0495629_0002110 | 3300046459 | Bacteria | 15420 |
| 185 | Ga0495629_0003170 | 3300046459 | Bacteria | 12462 |
| 186 | Ga0495629_0004900 | 3300046459 | Bacteria | 10049 |
| 187 | Ga0495629_0009168 | 3300046459 | Bacteria | 7244 |
| 188 | Ga0495629_0013852 | 3300046459 | Bacteria | 5818 |
| 189 | Ga0495629_0056898 | 3300046459 | Bacteria | 2734 |
| 190 | Ga0495629_0088126 | 3300046459 | Bacteria | 2165 |
| 191 | Ga0495629_0090226 | 3300046459 | Bacteria | 2138 |
| 192 | Ga0495629_0101503 | 3300046459 | Bacteria | 2007 |
| 193 | Ga0495629_0226655 | 3300046459 | Bacteria | 1288 |
| 194 | Ga0495638_0057090 | 3300046460 | Bacteria | 2422 |
| 195 | Ga0495641_0023354 | 3300046461 | Bacteria | 3074 |
| 196 | Ga0495641_0051609 | 3300046461 | Bacteria | 1877 |
| 197 | Ga0495651_0007478 | 3300046462 | Bacteria | 8355 |
| 198 | Ga0495651_0057776 | 3300046462 | Bacteria | 2978 |
| 199 | Ga0495651_0176663 | 3300046462 | Bacteria | 1515 |
| 200 | Ga0495651_0179142 | 3300046462 | Bacteria | 1501 |
| 201 | Ga0495653_0004745 | 3300046463 | Bacteria | 11008 |
| 202 | Ga0495653_0032959 | 3300046463 | Bacteria | 4108 |
| 203 | Ga0495653_0046682 | 3300046463 | Bacteria | 3353 |
| 204 | Ga0495582_0148492 | 3300046473 | Bacteria | 1330 |
| 205 | Ga0495605_0002356 | 3300046474 | Bacteria | 11759 |
| 206 | Ga0495662_0000389 | 3300046476 | Bacteria | 19593 |
| 207 | Ga0495662_0006812 | 3300046476 | Bacteria | 5686 |
| 208 | Ga0495662_0009969 | 3300046476 | Bacteria | 4666 |
| 209 | Ga0495662_0039773 | 3300046476 | Bacteria | 2272 |
| 210 | Ga0495662_0116281 | 3300046476 | Bacteria | 1311 |
| 211 | Ga0495664_0010024 | 3300046477 | Bacteria | 5315 |
| 212 | Ga0495664_0050824 | 3300046477 | Bacteria | 2461 |
| 213 | Ga0495664_0151564 | 3300046477 | Bacteria | 1406 |
| 214 | Ga0495664_0153583 | 3300046477 | Bacteria | 1396 |
| 215 | Ga0495585_0099462 | 3300046492 | Bacteria | 1557 |
| 216 | Ga0495594_0014576 | 3300046499 | Bacteria | 4121 |
| 217 | Ga0495594_0036858 | 3300046499 | Bacteria | 2668 |
| 218 | Ga0495594_0039455 | 3300046499 | Bacteria | 2582 |
| 219 | Ga0495594_0078149 | 3300046499 | Bacteria | 1846 |
| 220 | Ga0495596_0078082 | 3300046500 | Bacteria | 1285 |
| 221 | Ga0495607_0029734 | 3300046501 | Bacteria | 3361 |
| 222 | Ga0495607_0087960 | 3300046501 | Bacteria | 1689 |
| 223 | Ga0495583_0013771 | 3300046506 | Bacteria | 4492 |
| 224 | Ga0495606_0025681 | 3300046507 | Bacteria | 4213 |
| 225 | Ga0495608_0001041 | 3300046511 | Bacteria | 19510 |
| 226 | Ga0495608_0141006 | 3300046511 | Bacteria | 1538 |
| 227 | Ga0495608_0241485 | 3300046511 | Bacteria | 1128 |
| 228 | Ga0495610_0025319 | 3300046512 | Bacteria | 3186 |
| 229 | Ga0495618_0009600 | 3300046514 | Bacteria | 5844 |
| 230 | Ga0495618_0012441 | 3300046514 | Bacteria | 5169 |
| 231 | Ga0495618_0032708 | 3300046514 | Bacteria | 3258 |
| 232 | Ga0495618_0055114 | 3300046514 | Bacteria | 2517 |
| 233 | Ga0495620_0004995 | 3300046515 | Bacteria | 7436 |
| 234 | Ga0495628_0026827 | 3300046516 | Bacteria | 4689 |
| 235 | Ga0495628_0031386 | 3300046516 | Bacteria | 4298 |
| 236 | Ga0495630_0034461 | 3300046517 | Bacteria | 3780 |
| 237 | Ga0495630_0227335 | 3300046517 | Bacteria | 1425 |
| 238 | Ga0495637_0031059 | 3300046520 | Bacteria | 2365 |
| 239 | Ga0495643_0004721 | 3300046522 | Bacteria | 9438 |
| 240 | Ga0495643_0065707 | 3300046522 | Bacteria | 1915 |
| 241 | Ga0495648_0038341 | 3300046524 | Bacteria | 3066 |
| 242 | Ga0495666_0000261 | 3300046526 | Bacteria | 22812 |
| 243 | Ga0495666_0006347 | 3300046526 | Bacteria | 5951 |
| 244 | Ga0495652_0035225 | 3300046529 | Bacteria | 4357 |
| 245 | Ga0495652_0093451 | 3300046529 | Bacteria | 2455 |
| 246 | Ga0495652_0166381 | 3300046529 | Bacteria | 1706 |
| 247 | Ga0495640_0002592 | 3300046533 | Bacteria | 14530 |
| 248 | Ga0495640_0007457 | 3300046533 | Bacteria | 8592 |
| 249 | Ga0495640_0018760 | 3300046533 | Bacteria | 5120 |
| 250 | Ga0495640_0047196 | 3300046533 | Bacteria | 2981 |
| 251 | Ga0495586_0023524 | 3300046535 | Bacteria | 3291 |
| 252 | Ga0495586_0028243 | 3300046535 | Bacteria | 3003 |
| 253 | Ga0495587_0005116 | 3300046536 | Bacteria | 8574 |
| 254 | Ga0495587_0048191 | 3300046536 | Bacteria | 2523 |
| 255 | Ga0495609_0032614 | 3300046538 | Bacteria | 2365 |
| 256 | Ga0495645_0003947 | 3300046543 | Bacteria | 10120 |
| 257 | Ga0495645_0026841 | 3300046543 | Bacteria | 4182 |
| 258 | Ga0495645_0129744 | 3300046543 | Bacteria | 1768 |
| 259 | Ga0495622_0002212 | 3300046557 | Bacteria | 9479 |
| 260 | Ga0495622_0002507 | 3300046557 | Bacteria | 8879 |
| 261 | Ga0495622_0052659 | 3300046557 | Bacteria | 1888 |
| 262 | Ga0495622_0157740 | 3300046557 | Bacteria | 1024 |
| 263 | Ga0495667_0028618 | 3300046559 | Bacteria | 3753 |
| 264 | Ga0495667_0057270 | 3300046559 | Bacteria | 2562 |
| 265 | Ga0495667_0084698 | 3300046559 | Bacteria | 2057 |
| 266 | Ga0495667_0096605 | 3300046559 | Bacteria | 1912 |
| 267 | Ga0495634_0010135 | 3300046642 | Bacteria | 6914 |
| 268 | Ga0495634_0021703 | 3300046642 | Bacteria | 4533 |
| 269 | Ga0495634_0022514 | 3300046642 | Bacteria | 4439 |
| 270 | Ga0495634_0093252 | 3300046642 | Bacteria | 1953 |
| 271 | Ga0495611_0019513 | 3300046648 | Bacteria | 2912 |
| 272 | Ga0495611_0049509 | 3300046648 | Bacteria | 1891 |
| 273 | Ga0495635_0001446 | 3300046663 | Bacteria | 15877 |
| 274 | Ga0495635_0026875 | 3300046663 | Bacteria | 4002 |
| 275 | Ga0495635_0052889 | 3300046663 | Bacteria | 2797 |
| 276 | Ga0495635_0053749 | 3300046663 | Bacteria | 2774 |
| 277 | Ga0495635_0053999 | 3300046663 | Bacteria | 2767 |
| 278 | Ga0495661_0019702 | 3300046665 | Bacteria | 4416 |
| 279 | Ga0495657_0004061 | 3300046675 | Bacteria | 11738 |
| 280 | Ga0495657_0015661 | 3300046675 | Bacteria | 5541 |
| 281 | Ga0495657_0016684 | 3300046675 | Bacteria | 5344 |
| 282 | Ga0495657_0016874 | 3300046675 | Bacteria | 5308 |
| 283 | Ga0495657_0057784 | 3300046675 | Bacteria | 2578 |
| 284 | Ga0495657_0064398 | 3300046675 | Bacteria | 2415 |
| 285 | Ga0495657_0080981 | 3300046675 | Bacteria | 2100 |
| 286 | Ga0495599_0040297 | 3300046678 | Bacteria | 2933 |
| 287 | Ga0495599_0041328 | 3300046678 | Bacteria | 2895 |
| 288 | Ga0495599_0196655 | 3300046678 | Bacteria | 1239 |
| 289 | Ga0495623_0091836 | 3300046679 | Bacteria | 1862 |
| 290 | Ga0495646_0017152 | 3300046680 | Bacteria | 4596 |
| 291 | Ga0495646_0056544 | 3300046680 | Bacteria | 2352 |
| 292 | Ga0495646_0157259 | 3300046680 | Bacteria | 1260 |
| 293 | Ga0495613_0001142 | 3300046689 | Bacteria | 20232 |
| 294 | Ga0495613_0013435 | 3300046689 | Bacteria | 6082 |
| 295 | Ga0495613_0013652 | 3300046689 | Bacteria | 6027 |
| 296 | Ga0495613_0014945 | 3300046689 | Bacteria | 5761 |
| 297 | Ga0495613_0021705 | 3300046689 | Bacteria | 4783 |
| 298 | Ga0495613_0148211 | 3300046689 | Bacteria | 1674 |
| 299 | Ga0495624_0019684 | 3300046690 | Bacteria | 4499 |
| 300 | Ga0495624_0028204 | 3300046690 | Bacteria | 3670 |
| 301 | Ga0495624_0053175 | 3300046690 | Bacteria | 2557 |
| 302 | Ga0495624_0068445 | 3300046690 | Bacteria | 2213 |
| 303 | Ga0495671_0022831 | 3300046692 | Bacteria | 3273 |
| 304 | Ga0495671_0208414 | 3300046692 | Bacteria | 947 |
| 305 | Ga0495649_0011047 | 3300046694 | Bacteria | 5319 |
| 306 | Ga0495649_0087906 | 3300046694 | Bacteria | 1658 |
| 307 | Ga0495589_0014508 | 3300046794 | Bacteria | 4055 |
| 308 | Ga0495589_0019101 | 3300046794 | Bacteria | 3516 |
| 309 | Ga0495589_0029311 | 3300046794 | Bacteria | 2774 |
| 310 | Ga0495589_0038124 | 3300046794 | Bacteria | 2407 |
| 311 | Ga0495589_0059021 | 3300046794 | Bacteria | 1886 |
| 312 | Ga0495589_0076459 | 3300046794 | Bacteria | 1632 |
| 313 | Ga0495600_0010471 | 3300046809 | Bacteria | 5759 |
| 314 | Ga0495600_0010729 | 3300046809 | Bacteria | 5695 |
| 315 | Ga0495600_0056281 | 3300046809 | Bacteria | 2569 |
| 316 | Ga0495600_0100079 | 3300046809 | Bacteria | 1889 |
| 317 | Ga0495600_0127345 | 3300046809 | Bacteria | 1656 |
| 318 | Ga0495660_0014919 | 3300046810 | Bacteria | 4494 |
| 319 | Ga0495581_0049681 | 3300047315 | Bacteria | 2422 |
| 320 | Ga0495581_0088387 | 3300047315 | Bacteria | 1797 |
| 321 | Ga0495581_0092966 | 3300047315 | Bacteria | 1750 |
| 322 | Ga0495581_0172717 | 3300047315 | Bacteria | 1264 |
| 323 | Ga0495581_0176371 | 3300047315 | Bacteria | 1249 |
| 324 | Ga0495581_0200240 | 3300047315 | Bacteria | 1168 |
| 325 | Ga0495604_0000211 | 3300047317 | Bacteria | 53509 |
| 326 | Ga0495604_0010806 | 3300047317 | Bacteria | 7250 |
| 327 | Ga0495604_0026440 | 3300047317 | Bacteria | 4619 |
| 328 | Ga0495604_0057788 | 3300047317 | Bacteria | 2981 |
| 329 | Ga0495604_0095141 | 3300047317 | Bacteria | 2200 |
| 330 | Ga0495636_0010498 | 3300047318 | Bacteria | 3658 |
| 331 | Ga0495636_0037577 | 3300047318 | Bacteria | 2000 |
| 332 | Ga0495674_0000163 | 3300047319 | Bacteria | 51636 |
| 333 | Ga0495674_0113684 | 3300047319 | Bacteria | 2293 |
| 334 | Ga0495674_0142382 | 3300047319 | Bacteria | 2015 |
| 335 | Ga0495674_0239008 | 3300047319 | Bacteria | 1497 |
| 336 | Ga0495676_0000599 | 3300047321 | Bacteria | 29838 |
| 337 | Ga0495676_0001779 | 3300047321 | Bacteria | 18823 |
| 338 | Ga0495676_0003611 | 3300047321 | Bacteria | 14038 |
| 339 | Ga0495676_0004226 | 3300047321 | Bacteria | 13116 |
| 340 | Ga0495676_0006330 | 3300047321 | Bacteria | 10900 |
| 341 | Ga0495676_0014188 | 3300047321 | Bacteria | 7133 |
| 342 | Ga0495676_0020993 | 3300047321 | Bacteria | 5715 |
| 343 | Ga0495680_0004104 | 3300047322 | Bacteria | 14008 |
| 344 | Ga0495680_0007429 | 3300047322 | Bacteria | 10048 |
| 345 | Ga0495683_0001255 | 3300047323 | Bacteria | 17202 |
| 346 | Ga0495683_0104040 | 3300047323 | Bacteria | 1362 |
| 347 | Ga0495687_001757 | 3300047443 | Bacteria | 19154 |
| 348 | Ga0495687_013559 | 3300047443 | Bacteria | 4245 |
| 349 | Ga0495675_0004344 | 3300047444 | Bacteria | 8576 |
| 350 | Ga0495675_0004704 | 3300047444 | Bacteria | 8293 |
| 351 | Ga0495675_0005542 | 3300047444 | Bacteria | 7699 |
| 352 | Ga0495675_0010785 | 3300047444 | Bacteria | 5726 |
| 353 | Ga0495675_0015627 | 3300047444 | Bacteria | 4798 |
| 354 | Ga0495675_0069793 | 3300047444 | Bacteria | 2218 |
| 355 | Ga0495677_0022305 | 3300047445 | Bacteria | 2296 |
| 356 | Ga0495685_002009 | 3300047447 | Bacteria | 6313 |
| 357 | Ga0495685_006468 | 3300047447 | Bacteria | 3836 |
| 358 | Ga0495685_013068 | 3300047447 | Bacteria | 2816 |
| 359 | Ga0495685_022296 | 3300047447 | Bacteria | 2179 |
| 360 | Ga0495685_036234 | 3300047447 | Bacteria | 1694 |
| 361 | Ga0495681_0001653 | 3300047470 | Bacteria | 16549 |
| 362 | Ga0495684_0040459 | 3300047471 | Bacteria | 3573 |
| 363 | Ga0495684_0073828 | 3300047471 | Bacteria | 2591 |
| 364 | Ga0495684_0084205 | 3300047471 | Bacteria | 2412 |
| 365 | Ga0495686_0028121 | 3300047472 | Bacteria | 3663 |
| 366 | Ga0495593_0006827 | 3300047673 | Bacteria | 6680 |
| 367 | Ga0495593_0014457 | 3300047673 | Bacteria | 4486 |
| 368 | Ga0495593_0036113 | 3300047673 | Bacteria | 2681 |
| 369 | Ga0495593_0036266 | 3300047673 | Bacteria | 2674 |
| 370 | Ga0495614_0000179 | 3300048089 | Bacteria | 23615 |
| 371 | Ga0495614_0008694 | 3300048089 | Bacteria | 4515 |
| 372 | Ga0495614_0036689 | 3300048089 | Bacteria | 2104 |
| 373 | Ga0495614_0070436 | 3300048089 | Bacteria | 1506 |
| 374 | Ga0495626_0002880 | 3300048091 | Bacteria | 11472 |
| 375 | Ga0496105_0041670 | 3300048908 | Bacteria | 3784 |
| 376 | Ga0496109_0015129 | 3300048912 | Bacteria | 6717 |
| 377 | Ga0496110_0134887 | 3300048913 | Bacteria | 2230 |
| 378 | Ga0496119_0055334 | 3300048922 | Bacteria | 2410 |
| 379 | Ga0496121_0001882 | 3300048924 | Bacteria | 33689 |
| 380 | Ga0495678_019975 | 3300049459 | Bacteria | 2976 |
| 381 | Ga0501032_0004468 | 3300049569 | Bacteria | 10537 |
| 382 | Ga0501032_0020811 | 3300049569 | Bacteria | 4567 |
| 383 | Ga0501032_0021669 | 3300049569 | Bacteria | 4465 |
| 384 | Ga0501033_0001480 | 3300049570 | Bacteria | 20793 |
| 385 | Ga0501033_0014896 | 3300049570 | Bacteria | 5902 |
| 386 | Ga0501033_0147805 | 3300049570 | Bacteria | 1696 |
| 387 | Ga0501034_0018163 | 3300049571 | Bacteria | 7214 |
| 388 | Ga0501034_0040894 | 3300049571 | Bacteria | 4690 |
| 389 | Ga0501034_0060333 | 3300049571 | Bacteria | 3810 |
| 390 | Ga0501034_0180722 | 3300049571 | Bacteria | 2074 |
| 391 | Ga0501034_0199911 | 3300049571 | Bacteria | 1957 |
| 392 | Ga0501034_0351370 | 3300049571 | Bacteria | 1402 |
| 393 | Ga0501036_0002034 | 3300049572 | Bacteria | 15749 |
| 394 | Ga0501036_0030530 | 3300049572 | Bacteria | 4551 |
| 395 | Ga0501037_0076504 | 3300049573 | Bacteria | 2430 |
| 396 | Ga0501037_0089911 | 3300049573 | Bacteria | 2221 |
| 397 | Ga0501037_0109210 | 3300049573 | Bacteria | 1993 |
| 398 | Ga0501037_0127409 | 3300049573 | Bacteria | 1827 |
| 399 | Ga0501038_0008108 | 3300049574 | Bacteria | 9666 |
| 400 | Ga0501038_0020864 | 3300049574 | Bacteria | 5888 |
| 401 | Ga0501038_0026228 | 3300049574 | Bacteria | 5191 |
| 402 | Ga0501038_0078133 | 3300049574 | Bacteria | 2793 |
| 403 | Ga0501038_0080456 | 3300049574 | Bacteria | 2746 |
| 404 | Ga0501038_0352853 | 3300049574 | Bacteria | 1145 |
| 405 | Ga0501039_0003937 | 3300049575 | Bacteria | 11160 |
| 406 | Ga0501039_0063405 | 3300049575 | Bacteria | 2863 |
| 407 | Ga0501040_0016871 | 3300049576 | Bacteria | 4839 |
| 408 | Ga0501041_0007626 | 3300049577 | Bacteria | 6357 |
| 409 | Ga0501042_0038359 | 3300049578 | Bacteria | 3403 |
| 410 | Ga0501042_0166666 | 3300049578 | Bacteria | 1589 |
| 411 | Ga0501043_0010098 | 3300049579 | Bacteria | 7401 |
| 412 | Ga0501043_0010802 | 3300049579 | Bacteria | 7147 |
| 413 | Ga0501043_0042693 | 3300049579 | Bacteria | 3563 |
| 414 | Ga0501043_0096135 | 3300049579 | Bacteria | 2328 |
| 415 | Ga0501043_0359964 | 3300049579 | Bacteria | 1104 |
| 416 | Ga0501046_0143169 | 3300049580 | Bacteria | 1807 |
| 417 | Ga0501046_0178842 | 3300049580 | Bacteria | 1587 |
| 418 | Ga0501047_0000075 | 3300049581 | Bacteria | 124995 |
| 419 | Ga0501047_0010008 | 3300049581 | Bacteria | 8964 |
| 420 | Ga0501047_0019563 | 3300049581 | Bacteria | 6496 |
| 421 | Ga0501047_0026242 | 3300049581 | Bacteria | 5604 |
| 422 | Ga0501047_0029538 | 3300049581 | Bacteria | 5285 |
| 423 | Ga0501047_0035891 | 3300049581 | Bacteria | 4790 |
| 424 | Ga0501047_0050759 | 3300049581 | Bacteria | 4006 |
| 425 | Ga0501047_0061426 | 3300049581 | Bacteria | 3625 |
| 426 | Ga0501067_0008093 | 3300049583 | Bacteria | 5840 |
| 427 | Ga0501068_0001012 | 3300049584 | Bacteria | 14818 |
| 428 | Ga0501069_0041993 | 3300049585 | Bacteria | 2528 |
| 429 | Ga0501070_0020288 | 3300049586 | Bacteria | 5575 |
| 430 | Ga0501070_0024944 | 3300049586 | Bacteria | 5014 |
| 431 | Ga0501070_0057670 | 3300049586 | Bacteria | 3219 |
| 432 | Ga0501070_0084559 | 3300049586 | Bacteria | 2627 |
| 433 | Ga0501070_0383418 | 3300049586 | Bacteria | 1138 |
| 434 | Ga0501071_0015784 | 3300049587 | Bacteria | 5187 |
| 435 | Ga0501072_0002416 | 3300049588 | Bacteria | 13994 |
| 436 | Ga0501073_0027817 | 3300049589 | Bacteria | 4040 |
| 437 | Ga0501074_0000911 | 3300049590 | Bacteria | 18917 |
| 438 | Ga0501074_0103364 | 3300049590 | Bacteria | 2039 |
| 439 | Ga0501076_0004866 | 3300049592 | Bacteria | 9599 |
| 440 | Ga0501077_0031507 | 3300049593 | Bacteria | 3374 |
| 441 | Ga0501079_0172122 | 3300049741 | Bacteria | 1688 |
| 442 | Ga0501080_0017719 | 3300049742 | Bacteria | 6590 |
| 443 | Ga0501083_0098323 | 3300049744 | Bacteria | 1930 |
| 444 | Ga0501035_0002359 | 3300049822 | Bacteria | 18572 |
| 445 | Ga0501035_0003374 | 3300049822 | Bacteria | 15284 |
| 446 | Ga0501035_0028467 | 3300049822 | Bacteria | 5099 |
| 447 | Ga0501035_0055243 | 3300049822 | Bacteria | 3545 |
| 448 | Ga0501035_0109706 | 3300049822 | Bacteria | 2419 |
| 449 | Ga0501044_0008982 | 3300049823 | Bacteria | 10928 |
| 450 | Ga0501044_0015827 | 3300049823 | Bacteria | 8115 |
| 451 | Ga0501044_0016471 | 3300049823 | Bacteria | 7933 |
| 452 | Ga0501044_0021020 | 3300049823 | Bacteria | 6968 |
| 453 | Ga0501044_0146169 | 3300049823 | Bacteria | 2349 |
| 454 | Ga0501044_0182729 | 3300049823 | Bacteria | 2063 |
| 455 | Ga0501044_0237307 | 3300049823 | Bacteria | 1768 |
| 456 | Ga0501044_0291702 | 3300049823 | Bacteria | 1562 |
| 457 | Ga0501045_0074721 | 3300049824 | Bacteria | 2496 |
| 458 | Ga0501045_0146017 | 3300049824 | Bacteria | 1759 |
| 459 | nmdc:mga04h51_74699_c1 | 3300050495 | Bacteria | 1191 |
| 460 | nmdc:mga06r32_38010_c1 | 3300050510 | Bacteria | 4557 |
| 461 | Ga0495601_0183316 | 3300053077 | Bacteria | 1368 |
| 462 | Ga0495655_0056829 | 3300053083 | Bacteria | 1054 |
| 463 | Ga0495619_0158557 | 3300053085 | Bacteria | 1562 |
| 464 | Ga0500583_0118245 | 3300053092 | Bacteria | 1310 |
| 465 | Ga0500640_103110 | 3300053095 | Bacteria | 1175 |
| 466 | Ga0500650_0045552 | 3300053098 | Bacteria | 2032 |
| 467 | Ga0500560_002145 | 3300053107 | Bacteria | 3689 |
| 468 | Ga0500560_020314 | 3300053107 | Bacteria | 1882 |
| 469 | Ga0500573_0047754 | 3300053140 | Bacteria | 2465 |
| 470 | Ga0500573_0109195 | 3300053140 | Bacteria | 1549 |
| 471 | Ga0500624_003049 | 3300053157 | Bacteria | 2212 |
| 472 | Ga0501084_0018193 | 3300054114 | Bacteria | 5850 |
| 473 | Ga0501082_0001998 | 3300060353 | Bacteria | 17925 |
| 474 | Ga0466962_0003105 | 3300061719 | Bacteria | 7890 |
| 475 | Ga0466962_0003196 | 3300061719 | Bacteria | 7779 |
| 476 | Ga0466962_0041391 | 3300061719 | Bacteria | 2204 |
| 477 | Ga0530510_0202921 | 3300061734 | Bacteria | 1473 |
| 478 | 3006499495 | 3006493962 | Bacteria | 8825450 |
| 479 | 2515721074 | 2515154129 | Bacteria | 5584369 |
| 480 | 2516084315 | 2515154202 | Bacteria | 5471270 |
| 481 | 2547406189 | 2547132111 | Bacteria | 8013147 |
| 482 | 2554257436 | 2554235005 | Bacteria | 6457341 |
| 483 | 2585298367 | 2582581312 | Bacteria | 7308206 |
| 484 | 2585305670 | 2582581313 | Bacteria | 10042643 |
| 485 | 2585312626 | 2582581314 | Bacteria | 11452267 |
| 486 | 2616702752 | 2616644814 | Bacteria | 11555299 |
| 487 | 2616904113 | 2616644941 | Bacteria | 8510691 |
| 488 | 2643763228 | 2643221548 | Bacteria | 8053412 |
| 489 | 2643900271 | 2643221578 | Bacteria | 9213798 |
| 490 | 2643948014 | 2643221587 | Bacteria | 7586415 |
| 491 | 2644262785 | 2643221647 | Bacteria | 10741251 |
| 492 | 2644390564 | 2643221670 | Bacteria | 6497041 |
| 493 | 2644405505 | 2643221673 | Bacteria | 9196637 |
| 494 | 2644433880 | 2643221677 | Bacteria | 7584031 |
| 495 | 2644442995 | 2643221678 | Bacteria | 9540101 |
| 496 | 2644463902 | 2643221682 | Bacteria | 6743283 |
| 497 | 2644628367 | 2643221714 | Bacteria | 9015452 |
| 498 | 2784589113 | 2784132148 | Bacteria | 8627943 |
| 499 | 2785342735 | 2784746763 | Bacteria | 9783172 |
| 500 | 2785370160 | 2784746768 | Bacteria | 10036182 |
| 501 | 2786671146 | 2786546132 | Bacteria | 10419719 |
| 502 | 2793985115 | 2791355406 | Bacteria | 11364898 |
| 503 | 2808842582 | 2808606359 | Bacteria | 9866990 |
| 504 | 2808921085 | 2808606375 | Bacteria | 9466072 |
| 505 | 2809232715 | 2808606448 | Bacteria | 8656184 |
| 506 | 2811845656 | 2808606982 | Bacteria | 7791042 |
| 507 | 2812357534 | 2811994879 | Bacteria | 9313447 |
| 508 | 2812480044 | 2811994917 | Bacteria | 7761064 |
| 509 | 2819697472 | 2818991463 | Bacteria | 7948711 |
| 510 | 2852637392 | 2852635781 | Bacteria | 8251373 |
| 511 | 2862178857 | 2862178590 | Bacteria | 8583590 |
| 512 | 2862286175 | 2862281513 | Bacteria | 9621493 |
| 513 | 2862292040 | 2862290372 | Bacteria | 7471434 |
| 514 | 2862389725 | 2862382967 | Bacteria | 10317375 |
| 515 | 2862516415 | 2862507626 | Bacteria | 9425308 |
| 516 | 2862578743 | 2862574272 | Bacteria | 10567477 |
| 517 | 2862707713 | 2862705112 | Bacteria | 6563286 |
| 518 | 2863412629 | 2863404153 | Bacteria | 9672205 |
| 519 | 2867347589 | 2867346516 | Bacteria | 7608576 |
| 520 | 2867372370 | 2867369537 | Bacteria | 6501581 |
| 521 | 2867435531 | 2867428634 | Bacteria | 9590268 |
| 522 | 2867478226 | 2867475112 | Bacteria | 6909112 |
| 523 | 2867509762 | 2867507094 | Bacteria | 6506033 |
| 524 | 2873155239 | 2873151551 | Bacteria | 8625867 |
| 525 | 2875395090 | 2875391855 | Bacteria | 7600475 |
| 526 | 2877680556 | 2877676314 | Bacteria | 9512378 |
| 527 | 2884694025 | 2884693830 | Bacteria | 11273186 |
| 528 | 2895439119 | 2895427314 | Bacteria | 13147766 |
| 529 | 2895448140 | 2895442618 | Bacteria | 11027144 |
| 530 | 2912719206 | 2912715099 | Bacteria | 9460473 |
| 531 | 2912724042 | 2912723979 | Bacteria | 8557534 |
| 532 | 2912731487 | 2912723979 | Bacteria | 8557534 |
| 533 | 2912761425 | 2912757875 | Bacteria | 7940295 |
| 534 | 2918504989 | 2918501144 | Bacteria | 8668083 |
| 535 | 2919475538 | 2919468124 | Bacteria | 9133025 |
| 536 | 2935390700 | 2935390628 | Bacteria | 7043367 |
| 537 | 2946049391 | 2946045630 | Bacteria | 8527308 |
| 538 | 2946068342 | 2946064051 | Bacteria | 8957905 |
| 539 | 2946076462 | 2946072368 | Bacteria | 8999607 |
| 540 | 2947228566 | 2947224130 | Bacteria | 9938529 |
| 541 | 2954006957 | 2954002825 | Bacteria | 9173742 |
| 542 | 2954385672 | 2954380949 | Bacteria | 10050426 |
| 543 | 2954677478 | 2954673503 | Bacteria | 9685905 |
| 544 | 2954686676 | 2954682443 | Bacteria | 9862841 |
| 545 | 2954696322 | 2954691527 | Bacteria | 10720516 |
| 546 | 2954711485 | 2954701450 | Bacteria | 10834262 |
| 547 | 2954715688 | 2954711539 | Bacteria | 10867210 |
| 548 | 2954725625 | 2954721474 | Bacteria | 10456478 |
| 549 | 2954736187 | 2954731030 | Bacteria | 10243860 |
| 550 | 2954744564 | 2954740390 | Bacteria | 10229294 |
| 551 | 2954755034 | 2954749733 | Bacteria | 10366972 |
| 552 | 2954763547 | 2954759201 | Bacteria | 9358192 |
| 553 | 2964329426 | 2964326757 | Bacteria | 3290868 |
| 554 | 2966602194 | 2966598605 | Bacteria | 7676064 |
| 555 | 2990050034 | 2990044586 | Bacteria | 6603797 |
| 556 | 2990061533 | 2990059506 | Bacteria | 9321252 |
| 557 | 2990091141 | 2990088156 | Bacteria | 6657676 |
| 558 | 2995468852 | 2995463766 | Bacteria | 8577691 |
| 559 | 2997458943 | 2997451912 | Bacteria | 8492419 |
| 560 | 2997604569 | 2997600082 | Bacteria | 9896405 |
| 561 | 3006325826 | 3006321560 | Bacteria | 8247479 |
| 562 | 3006399203 | 3006393351 | Bacteria | 6615579 |
| 563 | 3006425833 | 3006425503 | Bacteria | 6491253 |
| 564 | 3006487712 | 3006486233 | Bacteria | 8157040 |
| 565 | 8008488646 | 8008485437 | Bacteria | 7198341 |
| 566 | 8008578394 | 8008574985 | Bacteria | 7815457 |
| 567 | 8023625818 | 8023623736 | Bacteria | 8593882 |
| 568 | 8025482216 | 8025478263 | Bacteria | 8209203 |
| 569 | 8025527494 | 8025524527 | Bacteria | 7197316 |
| 570 | 8025534526 | 8025530807 | Bacteria | 8495698 |
| 571 | 8033691366 | 8033684223 | Bacteria | 6906479 |
| 572 | 8047718951 | 8047710418 | Bacteria | 11023148 |
| 573 | 8047897497 | 8047893842 | Bacteria | 11723082 |
| 574 | 8048127915 | 8048127548 | Bacteria | 11053136 |
| 575 | 8048361373 | 8048356638 | Bacteria | 11044339 |
| 576 | 8048374484 | 8048369669 | Bacteria | 11666822 |
| 577 | 8048383738 | 8048379754 | Bacteria | 11877923 |
| 578 | 8048410313 | 8048406513 | Bacteria | 8936924 |
| 579 | 8054160948 | 8054160619 | Bacteria | 7783213 |
| 580 | 8056452880 | 8056447290 | Bacteria | 7680491 |
| 581 | 8056671348 | 8056667051 | Bacteria | 6953971 |
| 582 | 8056837953 | 8056829672 | Bacteria | 9045328 |
| 583 | JGI24739J22299_10010447 | |||
| 584 | JGI24738J21930_10008964 | |||
| 585 | Ga0006562J51391_1040353 | |||
| 586 | Ga0006562J51391_1040356 | |||
| 587 | Ga0006562J51391_1048769 | |||
| 588 | Ga0006562J51391_1048771 | |||
| 589 | Ga0070682_100133479 | |||
| 590 | Ga0070710_10000109 | |||
| 591 | Ga0068856_100095757 | |||
| 592 | Ga0081455_10001677 | |||
| 593 | Ga0081539_10008925 | |||
| 594 | Ga0075363_100006383 | |||
| 595 | Ga0075431_100001341 | |||
| 596 | Ga0099826_10078984 | |||
| 597 | Ga0105251_10005321 | |||
| 598 | Ga0105243_10279347 | |||
| 599 | Ga0105239_10057311 | |||
| 600 | Ga0105246_10053002 | |||
| 601 | Ga0157372_10072759 | |||
| 602 | Ga0157372_10084370 | |||
| 603 | Ga0182008_10001312 | |||
| 604 | Ga0157379_10000033 | |||
| 605 | Ga0182007_10001652 | |||
| 606 | Ga0183367_1008 | |||
| 607 | Ga0206353_10624330 | |||
| 608 | Ga0206353_11286074 | |||
| 609 | Ga0213875_10007912 | |||
| 610 | Ga0207426_1008528 | |||
| 611 | Ga0207713_1031153 | |||
| 612 | Ga0207692_10003141 | |||
| 613 | Ga0207647_10012368 | |||
| 614 | Ga0207687_10101063 | |||
| 615 | Ga0207709_10028364 | |||
| 616 | Ga0207665_10012250 | |||
| 617 | Ga0268266_10301141 | |||
| 618 | Ga0307515_10003050 | |||
| 619 | Ga0307515_10014752 | |||
| 620 | Ga0265338_10001945 | |||
| 621 | Ga0307511_10004073 | |||
| 622 | Ga0307511_10096555 | |||
| 623 | Ga0307512_10001246 | |||
| 624 | Ga0316177_1197593 | |||
| 625 | Ga0316176_1142576 | |||
| 626 | Ga0314311_1199289 | |||
| 627 | Ga0316180_1118571 | |||
| 628 | Ga0307513_10002997 | |||
| 629 | Ga0307513_10041728 | |||
| 630 | Ga0307509_10016499 | |||
| 631 | Ga0307509_10023649 | |||
| 632 | Ga0307509_10051127 | |||
| 633 | Ga0307508_10009392 | |||
| 634 | Ga0307508_10062200 | |||
| 635 | Ga0307514_10002693 | |||
| 636 | Ga0307514_10056397 | |||
| 637 | Ga0307514_10094857 | |||
| 638 | Ga0307514_10174004 | |||
| 639 | Ga0316575_10003103 | |||
| 640 | Ga0316579_10003855 | |||
| 641 | Ga0316579_10017809 | |||
| 642 | Ga0316576_10002291 | |||
| 643 | Ga0316576_10089715 | |||
| 644 | Ga0316576_10144894 | |||
| 645 | Ga0316578_10010414 | |||
| 646 | Ga0316578_10013319 | |||
| 647 | Ga0307516_10007466 | |||
| 648 | Ga0307516_10016086 | |||
| 649 | Ga0307516_10091955 | |||
| 650 | Ga0316577_10012281 | |||
| 651 | Ga0307409_100030420 | |||
| 652 | Ga0307409_100052528 | |||
| 653 | Ga0307415_100222879 | |||
| 654 | Ga0316585_10008209 | |||
| 655 | Ga0316580_10002557 | |||
| 656 | Ga0316580_10015236 | |||
| 657 | Ga0307507_10020931 | |||
| 658 | Ga0307507_10022851 | |||
| 659 | Ga0307507_10073202 | |||
| 660 | Ga0307510_10009192 | |||
| 661 | Ga0307510_10014521 | |||
| 662 | Ga0307510_10025624 | |||
| 663 | Ga0373944_0001447 | |||
| 664 | Ga0373951_0000043 | |||
| 665 | Ga0373936_0003933 | |||
| 666 | Ga0373945_0000238 | |||
| 667 | Ga0373953_0112018 | |||
| 668 | Ga0373956_0093317 | |||
| 669 | Ga0373957_0071281 | |||
| 670 | Ga0373943_0000802 | |||
| 671 | Ga0373955_0011789 | |||
| 672 | Ga0373955_0017178 | |||
| 673 | Ga0373935_0001253 | |||
| 674 | Ga0373935_0217352 | |||
| 675 | Ga0373927_0002383 | |||
| 676 | Ga0373933_0089983 | |||
| 677 | Ga0373947_0101272 | |||
| 678 | Ga0373937_0082405 | |||
| 679 | Ga0373937_0109143 | |||
| 680 | Ga0316582_0011974 | |||
| 681 | Ga0316582_0020250 | |||
| 682 | Ga0316584_0024409 | |||
| 683 | Ga0373925_0004733 | |||
| 684 | Ga0373925_0008941 | |||
| 685 | Ga0395898_0018072 | |||
| 686 | Ga0395898_0347498 | |||
| 687 | Ga0395905_0287199 | |||
| 688 | Ga0316581_0034774 | |||
| 689 | Ga0436364_0388132 | |||
| 690 | Ga0400486_10710 | |||
| 691 | Ga0439436_0000983 | |||
| 692 | Ga0439436_0012274 | |||
| 693 | Ga0439439_0008482 | |||
| 694 | Ga0451833_0577864 | |||
| 695 | Ga0451837_0384653 | |||
| 696 | Ga0451837_1279266 | |||
| 697 | Ga0451839_0707163 | |||
| 698 | Ga0451853_0523210 | |||
| 699 | Ga0451853_2316153 | |||
| 700 | Ga0439433_0000050 | |||
| 701 | Ga0439448_0008481 | |||
| 702 | Ga0439449_0011239 | |||
| 703 | Ga0439449_0020099 | |||
| 704 | Ga0439449_0053976 | |||
| 705 | Ga0439457_000139 | |||
| 706 | Ga0439457_010482 | |||
| 707 | Ga0450894_000061 | |||
| 708 | Ga0450903_000287 | |||
| 709 | Ga0450906_018643 | |||
| 710 | Ga0439458_0002128 | |||
| 711 | Ga0439458_0012643 | |||
| 712 | Ga0466969_0003717 | |||
| 713 | Ga0466969_0008105 | |||
| 714 | Ga0466969_0024880 | |||
| 715 | Ga0466972_0005936 | |||
| 716 | Ga0466972_0016449 | |||
| 717 | Ga0466972_0016745 | |||
| 718 | Ga0466972_0034114 | |||
| 719 | Ga0466965_0000060 | |||
| 720 | Ga0466965_0001194 | |||
| 721 | Ga0466965_0038519 | |||
| 722 | Ga0466966_0001375 | |||
| 723 | Ga0466966_0015878 | |||
| 724 | Ga0466961_0000532 | |||
| 725 | Ga0466961_0003958 | |||
| 726 | Ga0466961_0015124 | |||
| 727 | Ga0466961_0030113 | |||
| 728 | Ga0466963_0000553 | |||
| 729 | Ga0466963_0021872 | |||
| 730 | Ga0466963_0029161 | |||
| 731 | Ga0466963_0074946 | |||
| 732 | Ga0466963_0370628 | |||
| 733 | Ga0466964_0002316 | |||
| 734 | Ga0466971_0000435 | |||
| 735 | Ga0466971_0006178 | |||
| 736 | Ga0466971_0015558 | |||
| 737 | Ga0466971_0059083 | |||
| 738 | Ga0466968_0030386 | |||
| 739 | Ga0466970_0006653 | |||
| 740 | Ga0466970_0007692 | |||
| 741 | Ga0466970_0019908 | |||
| 742 | Ga0466957_0001608 | |||
| 743 | Ga0466957_0188868 | |||
| 744 | Ga0466960_0001244 | |||
| 745 | Ga0466960_0008529 | |||
| 746 | Ga0466960_0023713 | |||
| 747 | Ga0466960_0042969 | |||
| 748 | Ga0466959_0056608 | |||
| 749 | Ga0466959_0060787 | |||
| 750 | Ga0451576_0051309 | |||
| 751 | Ga0466958_0000503 | |||
| 752 | Ga0466958_0007323 | |||
| 753 | Ga0466967_0002502 | |||
| 754 | Ga0466967_0143939 | |||
| 755 | Ga0466967_0146702 | |||
| 756 | Ga0466967_0213609 | |||
| 757 | Ga0466967_0292471 | |||
| 758 | Ga0495617_054639 | |||
| 759 | Ga0495627_045242 | |||
| 760 | Ga0495592_0007783 | |||
| 761 | Ga0495592_0020264 | |||
| 762 | Ga0495603_0000510 | |||
| 763 | Ga0495603_0020287 | |||
| 764 | Ga0495603_0208287 | |||
| 765 | Ga0495590_0100900 | |||
| 766 | Ga0495629_0002110 | |||
| 767 | Ga0495629_0003170 | |||
| 768 | Ga0495629_0004900 | |||
| 769 | Ga0495629_0009168 | |||
| 770 | Ga0495629_0013852 | |||
| 771 | Ga0495629_0056898 | |||
| 772 | Ga0495629_0088126 | |||
| 773 | Ga0495629_0090226 | |||
| 774 | Ga0495629_0101503 | |||
| 775 | Ga0495629_0226655 | |||
| 776 | Ga0495638_0057090 | |||
| 777 | Ga0495641_0023354 | |||
| 778 | Ga0495641_0051609 | |||
| 779 | Ga0495651_0007478 | |||
| 780 | Ga0495651_0057776 | |||
| 781 | Ga0495651_0176663 | |||
| 782 | Ga0495651_0179142 | |||
| 783 | Ga0495653_0004745 | |||
| 784 | Ga0495653_0032959 | |||
| 785 | Ga0495653_0046682 | |||
| 786 | Ga0495582_0148492 | |||
| 787 | Ga0495605_0002356 | |||
| 788 | Ga0495662_0000389 | |||
| 789 | Ga0495662_0006812 | |||
| 790 | Ga0495662_0009969 | |||
| 791 | Ga0495662_0039773 | |||
| 792 | Ga0495662_0116281 | |||
| 793 | Ga0495664_0010024 | |||
| 794 | Ga0495664_0050824 | |||
| 795 | Ga0495664_0151564 | |||
| 796 | Ga0495664_0153583 | |||
| 797 | Ga0495585_0099462 | |||
| 798 | Ga0495594_0014576 | |||
| 799 | Ga0495594_0036858 | |||
| 800 | Ga0495594_0039455 | |||
| 801 | Ga0495594_0078149 | |||
| 802 | Ga0495596_0078082 | |||
| 803 | Ga0495607_0029734 | |||
| 804 | Ga0495607_0087960 | |||
| 805 | Ga0495583_0013771 | |||
| 806 | Ga0495606_0025681 | |||
| 807 | Ga0495608_0001041 | |||
| 808 | Ga0495608_0141006 | |||
| 809 | Ga0495608_0241485 | |||
| 810 | Ga0495610_0025319 | |||
| 811 | Ga0495618_0009600 | |||
| 812 | Ga0495618_0012441 | |||
| 813 | Ga0495618_0032708 | |||
| 814 | Ga0495618_0055114 | |||
| 815 | Ga0495620_0004995 | |||
| 816 | Ga0495628_0026827 | |||
| 817 | Ga0495628_0031386 | |||
| 818 | Ga0495630_0034461 | |||
| 819 | Ga0495630_0227335 | |||
| 820 | Ga0495637_0031059 | |||
| 821 | Ga0495643_0004721 | |||
| 822 | Ga0495643_0065707 | |||
| 823 | Ga0495648_0038341 | |||
| 824 | Ga0495666_0000261 | |||
| 825 | Ga0495666_0006347 | |||
| 826 | Ga0495652_0035225 | |||
| 827 | Ga0495652_0093451 | |||
| 828 | Ga0495652_0166381 | |||
| 829 | Ga0495640_0002592 | |||
| 830 | Ga0495640_0007457 | |||
| 831 | Ga0495640_0018760 | |||
| 832 | Ga0495640_0047196 | |||
| 833 | Ga0495586_0023524 | |||
| 834 | Ga0495586_0028243 | |||
| 835 | Ga0495587_0005116 | |||
| 836 | Ga0495587_0048191 | |||
| 837 | Ga0495609_0032614 | |||
| 838 | Ga0495645_0003947 | |||
| 839 | Ga0495645_0026841 | |||
| 840 | Ga0495645_0129744 | |||
| 841 | Ga0495622_0002212 | |||
| 842 | Ga0495622_0002507 | |||
| 843 | Ga0495622_0052659 | |||
| 844 | Ga0495622_0157740 | |||
| 845 | Ga0495667_0028618 | |||
| 846 | Ga0495667_0057270 | |||
| 847 | Ga0495667_0084698 | |||
| 848 | Ga0495667_0096605 | |||
| 849 | Ga0495634_0010135 | |||
| 850 | Ga0495634_0021703 | |||
| 851 | Ga0495634_0022514 | |||
| 852 | Ga0495634_0093252 | |||
| 853 | Ga0495611_0019513 | |||
| 854 | Ga0495611_0049509 | |||
| 855 | Ga0495635_0001446 | |||
| 856 | Ga0495635_0026875 | |||
| 857 | Ga0495635_0052889 | |||
| 858 | Ga0495635_0053749 | |||
| 859 | Ga0495635_0053999 | |||
| 860 | Ga0495661_0019702 | |||
| 861 | Ga0495657_0004061 | |||
| 862 | Ga0495657_0015661 | |||
| 863 | Ga0495657_0016684 | |||
| 864 | Ga0495657_0016874 | |||
| 865 | Ga0495657_0057784 | |||
| 866 | Ga0495657_0064398 | |||
| 867 | Ga0495657_0080981 | |||
| 868 | Ga0495599_0040297 | |||
| 869 | Ga0495599_0041328 | |||
| 870 | Ga0495599_0196655 | |||
| 871 | Ga0495623_0091836 | |||
| 872 | Ga0495646_0017152 | |||
| 873 | Ga0495646_0056544 | |||
| 874 | Ga0495646_0157259 | |||
| 875 | Ga0495613_0001142 | |||
| 876 | Ga0495613_0013435 | |||
| 877 | Ga0495613_0013652 | |||
| 878 | Ga0495613_0014945 | |||
| 879 | Ga0495613_0021705 | |||
| 880 | Ga0495613_0148211 | |||
| 881 | Ga0495624_0019684 | |||
| 882 | Ga0495624_0028204 | |||
| 883 | Ga0495624_0053175 | |||
| 884 | Ga0495624_0068445 | |||
| 885 | Ga0495671_0022831 | |||
| 886 | Ga0495671_0208414 | |||
| 887 | Ga0495649_0011047 | |||
| 888 | Ga0495649_0087906 | |||
| 889 | Ga0495589_0014508 | |||
| 890 | Ga0495589_0019101 | |||
| 891 | Ga0495589_0029311 | |||
| 892 | Ga0495589_0038124 | |||
| 893 | Ga0495589_0059021 | |||
| 894 | Ga0495589_0076459 | |||
| 895 | Ga0495600_0010471 | |||
| 896 | Ga0495600_0010729 | |||
| 897 | Ga0495600_0056281 | |||
| 898 | Ga0495600_0100079 | |||
| 899 | Ga0495600_0127345 | |||
| 900 | Ga0495660_0014919 | |||
| 901 | Ga0495581_0049681 | |||
| 902 | Ga0495581_0088387 | |||
| 903 | Ga0495581_0092966 | |||
| 904 | Ga0495581_0172717 | |||
| 905 | Ga0495581_0176371 | |||
| 906 | Ga0495581_0200240 | |||
| 907 | Ga0495604_0000211 | |||
| 908 | Ga0495604_0010806 | |||
| 909 | Ga0495604_0026440 | |||
| 910 | Ga0495604_0057788 | |||
| 911 | Ga0495604_0095141 | |||
| 912 | Ga0495636_0010498 | |||
| 913 | Ga0495636_0037577 | |||
| 914 | Ga0495674_0000163 | |||
| 915 | Ga0495674_0113684 | |||
| 916 | Ga0495674_0142382 | |||
| 917 | Ga0495674_0239008 | |||
| 918 | Ga0495676_0000599 | |||
| 919 | Ga0495676_0001779 | |||
| 920 | Ga0495676_0003611 | |||
| 921 | Ga0495676_0004226 | |||
| 922 | Ga0495676_0006330 | |||
| 923 | Ga0495676_0014188 | |||
| 924 | Ga0495676_0020993 | |||
| 925 | Ga0495680_0004104 | |||
| 926 | Ga0495680_0007429 | |||
| 927 | Ga0495683_0001255 | |||
| 928 | Ga0495683_0104040 | |||
| 929 | Ga0495687_001757 | |||
| 930 | Ga0495687_013559 | |||
| 931 | Ga0495675_0004344 | |||
| 932 | Ga0495675_0004704 | |||
| 933 | Ga0495675_0005542 | |||
| 934 | Ga0495675_0010785 | |||
| 935 | Ga0495675_0015627 | |||
| 936 | Ga0495675_0069793 | |||
| 937 | Ga0495677_0022305 | |||
| 938 | Ga0495685_002009 | |||
| 939 | Ga0495685_006468 | |||
| 940 | Ga0495685_013068 | |||
| 941 | Ga0495685_022296 | |||
| 942 | Ga0495685_036234 | |||
| 943 | Ga0495681_0001653 | |||
| 944 | Ga0495684_0040459 | |||
| 945 | Ga0495684_0073828 | |||
| 946 | Ga0495684_0084205 | |||
| 947 | Ga0495686_0028121 | |||
| 948 | Ga0495593_0006827 | |||
| 949 | Ga0495593_0014457 | |||
| 950 | Ga0495593_0036113 | |||
| 951 | Ga0495593_0036266 | |||
| 952 | Ga0495614_0000179 | |||
| 953 | Ga0495614_0008694 | |||
| 954 | Ga0495614_0036689 | |||
| 955 | Ga0495614_0070436 | |||
| 956 | Ga0495626_0002880 | |||
| 957 | Ga0496105_0041670 | |||
| 958 | Ga0496109_0015129 | |||
| 959 | Ga0496110_0134887 | |||
| 960 | Ga0496119_0055334 | |||
| 961 | Ga0496121_0001882 | |||
| 962 | Ga0495678_019975 | |||
| 963 | Ga0501032_0004468 | |||
| 964 | Ga0501032_0020811 | |||
| 965 | Ga0501032_0021669 | |||
| 966 | Ga0501033_0001480 | |||
| 967 | Ga0501033_0014896 | |||
| 968 | Ga0501033_0147805 | |||
| 969 | Ga0501034_0018163 | |||
| 970 | Ga0501034_0040894 | |||
| 971 | Ga0501034_0060333 | |||
| 972 | Ga0501034_0180722 | |||
| 973 | Ga0501034_0199911 | |||
| 974 | Ga0501034_0351370 | |||
| 975 | Ga0501036_0002034 | |||
| 976 | Ga0501036_0030530 | |||
| 977 | Ga0501037_0076504 | |||
| 978 | Ga0501037_0089911 | |||
| 979 | Ga0501037_0109210 | |||
| 980 | Ga0501037_0127409 | |||
| 981 | Ga0501038_0008108 | |||
| 982 | Ga0501038_0020864 | |||
| 983 | Ga0501038_0026228 | |||
| 984 | Ga0501038_0078133 | |||
| 985 | Ga0501038_0080456 | |||
| 986 | Ga0501038_0352853 | |||
| 987 | Ga0501039_0003937 | |||
| 988 | Ga0501039_0063405 | |||
| 989 | Ga0501040_0016871 | |||
| 990 | Ga0501041_0007626 | |||
| 991 | Ga0501042_0038359 | |||
| 992 | Ga0501042_0166666 | |||
| 993 | Ga0501043_0010098 | |||
| 994 | Ga0501043_0010802 | |||
| 995 | Ga0501043_0042693 | |||
| 996 | Ga0501043_0096135 | |||
| 997 | Ga0501043_0359964 | |||
| 998 | Ga0501046_0143169 | |||
| 999 | Ga0501046_0178842 | |||
| 1000 | Ga0501047_0000075 | |||
| 1001 | Ga0501047_0010008 | |||
| 1002 | Ga0501047_0019563 | |||
| 1003 | Ga0501047_0026242 | |||
| 1004 | Ga0501047_0029538 | |||
| 1005 | Ga0501047_0035891 | |||
| 1006 | Ga0501047_0050759 | |||
| 1007 | Ga0501047_0061426 | |||
| 1008 | Ga0501067_0008093 | |||
| 1009 | Ga0501068_0001012 | |||
| 1010 | Ga0501069_0041993 | |||
| 1011 | Ga0501070_0020288 | |||
| 1012 | Ga0501070_0024944 | |||
| 1013 | Ga0501070_0057670 | |||
| 1014 | Ga0501070_0084559 | |||
| 1015 | Ga0501070_0383418 | |||
| 1016 | Ga0501071_0015784 | |||
| 1017 | Ga0501072_0002416 | |||
| 1018 | Ga0501073_0027817 | |||
| 1019 | Ga0501074_0000911 | |||
| 1020 | Ga0501074_0103364 | |||
| 1021 | Ga0501076_0004866 | |||
| 1022 | Ga0501077_0031507 | |||
| 1023 | Ga0501079_0172122 | |||
| 1024 | Ga0501080_0017719 | |||
| 1025 | Ga0501083_0098323 | |||
| 1026 | Ga0501035_0002359 | |||
| 1027 | Ga0501035_0003374 | |||
| 1028 | Ga0501035_0028467 | |||
| 1029 | Ga0501035_0055243 | |||
| 1030 | Ga0501035_0109706 | |||
| 1031 | Ga0501044_0008982 | |||
| 1032 | Ga0501044_0015827 | |||
| 1033 | Ga0501044_0016471 | |||
| 1034 | Ga0501044_0021020 | |||
| 1035 | Ga0501044_0146169 | |||
| 1036 | Ga0501044_0182729 | |||
| 1037 | Ga0501044_0237307 | |||
| 1038 | Ga0501044_0291702 | |||
| 1039 | Ga0501045_0074721 | |||
| 1040 | Ga0501045_0146017 | |||
| 1041 | nmdc:mga04h51_74699_c1 | |||
| 1042 | nmdc:mga06r32_38010_c1 | |||
| 1043 | Ga0495601_0183316 | |||
| 1044 | Ga0495655_0056829 | |||
| 1045 | Ga0495619_0158557 | |||
| 1046 | Ga0500583_0118245 | |||
| 1047 | Ga0500640_103110 | |||
| 1048 | Ga0500650_0045552 | |||
| 1049 | Ga0500560_002145 | |||
| 1050 | Ga0500560_020314 | |||
| 1051 | Ga0500573_0047754 | |||
| 1052 | Ga0500573_0109195 | |||
| 1053 | Ga0500624_003049 | |||
| 1054 | Ga0501084_0018193 | |||
| 1055 | Ga0501082_0001998 | |||
| 1056 | Ga0466962_0003105 | |||
| 1057 | Ga0466962_0003196 | |||
| 1058 | Ga0466962_0041391 | |||
| 1059 | Ga0530510_0202921 | |||
| 1060 | 3006499495 | |||
| 1061 | 2515721074 | |||
| 1062 | 2516084315 | |||
| 1063 | 2547406189 | |||
| 1064 | 2554257436 | |||
| 1065 | 2585298367 | |||
| 1066 | 2585305670 | |||
| 1067 | 2585312626 | |||
| 1068 | 2616702752 | |||
| 1069 | 2616904113 | |||
| 1070 | 2643763228 | |||
| 1071 | 2643900271 | |||
| 1072 | 2643948014 | |||
| 1073 | 2644262785 | |||
| 1074 | 2644390564 | |||
| 1075 | 2644405505 | |||
| 1076 | 2644433880 | |||
| 1077 | 2644442995 | |||
| 1078 | 2644463902 | |||
| 1079 | 2644628367 | |||
| 1080 | 2784589113 | |||
| 1081 | 2785342735 | |||
| 1082 | 2785370160 | |||
| 1083 | 2786671146 | |||
| 1084 | 2793985115 | |||
| 1085 | 2808842582 | |||
| 1086 | 2808921085 | |||
| 1087 | 2809232715 | |||
| 1088 | 2811845656 | |||
| 1089 | 2812357534 | |||
| 1090 | 2812480044 | |||
| 1091 | 2819697472 | |||
| 1092 | 2852637392 | |||
| 1093 | 2862178857 | |||
| 1094 | 2862286175 | |||
| 1095 | 2862292040 | |||
| 1096 | 2862389725 | |||
| 1097 | 2862516415 | |||
| 1098 | 2862578743 | |||
| 1099 | 2862707713 | |||
| 1100 | 2863412629 | |||
| 1101 | 2867347589 | |||
| 1102 | 2867372370 | |||
| 1103 | 2867435531 | |||
| 1104 | 2867478226 | |||
| 1105 | 2867509762 | |||
| 1106 | 2873155239 | |||
| 1107 | 2875395090 | |||
| 1108 | 2877680556 | |||
| 1109 | 2884694025 | |||
| 1110 | 2895439119 | |||
| 1111 | 2895448140 | |||
| 1112 | 2912719206 | |||
| 1113 | 2912724042 | |||
| 1114 | 2912731487 | |||
| 1115 | 2912761425 | |||
| 1116 | 2918504989 | |||
| 1117 | 2919475538 | |||
| 1118 | 2935390700 | |||
| 1119 | 2946049391 | |||
| 1120 | 2946068342 | |||
| 1121 | 2946076462 | |||
| 1122 | 2947228566 | |||
| 1123 | 2954006957 | |||
| 1124 | 2954385672 | |||
| 1125 | 2954677478 | |||
| 1126 | 2954686676 | |||
| 1127 | 2954696322 | |||
| 1128 | 2954711485 | |||
| 1129 | 2954715688 | |||
| 1130 | 2954725625 | |||
| 1131 | 2954736187 | |||
| 1132 | 2954744564 | |||
| 1133 | 2954755034 | |||
| 1134 | 2954763547 | |||
| 1135 | 2964329426 | |||
| 1136 | 2966602194 | |||
| 1137 | 2990050034 | |||
| 1138 | 2990061533 | |||
| 1139 | 2990091141 | |||
| 1140 | 2995468852 | |||
| 1141 | 2997458943 | |||
| 1142 | 2997604569 | |||
| 1143 | 3006325826 | |||
| 1144 | 3006399203 | |||
| 1145 | 3006425833 | |||
| 1146 | 3006487712 | |||
| 1147 | 8008488646 | |||
| 1148 | 8008578394 | |||
| 1149 | 8023625818 | |||
| 1150 | 8025482216 | |||
| 1151 | 8025527494 | |||
| 1152 | 8025534526 | |||
| 1153 | 8033691366 | |||
| 1154 | 8047718951 | |||
| 1155 | 8047897497 | |||
| 1156 | 8048127915 | |||
| 1157 | 8048361373 | |||
| 1158 | 8048374484 | |||
| 1159 | 8048383738 | |||
| 1160 | 8048410313 | |||
| 1161 | 8054160948 | |||
| 1162 | 8056452880 | |||
| 1163 | 8056671348 | |||
| 1164 | 8056837953 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dup-assembly1.cif.gz_A | crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 | 0.982 | 1 | 325 |
| 2j8z-assembly1.cif.gz_A-2 | crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) | 0.9761 | 1 | 326 |
| 4dup-assembly1.cif.gz_A | crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 | 0.9761 | 1 | 325 |
| 2oby-assembly2.cif.gz_C | crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) | 0.9735 | 1 | 326 |
| 2j8z-assembly1.cif.gz_A-2 | crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) | 0.9731 | 1 | 326 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O65423_126_262_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9976 | 127 | 262 | 3.40.50.720 |
| af_C6TID4_1_124_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.996 | 1 | 123 | 3.90.180.10 |
| af_P72043_133_294_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9934 | 133 | 290 | 3.40.50.720 |
| af_A0A1D6HNQ2_3_340_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9934 | 1 | 324 | 3.90.180.10 |
| af_A0A1D6HNQ2_126_296_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9932 | 123 | 280 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A803NY03-F1-model_v4 | Enoyl reductase (ER) domain-containing protein | 0.9953 | 2 | 324 |
GO:0016651
GO:0034045 GO:0070402 |
| AF-A0A445BBA4-F1-model_v4 | Enoyl reductase (ER) domain-containing protein | 0.9953 | 1 | 324 |
GO:0008270
GO:0016651 GO:0070402 |
| AF-A0A1B1BLD5-F1-model_v4 | NADPH:quinone oxidoreductase | 0.9904 | 1 | 324 |
GO:0016651
GO:0070402 |
| AF-B9JTA9-F1-model_v4 | Quinone oxidoreductase | 0.9902 | 1 | 325 |
GO:0016651
GO:0070402 |
| AF-A0A512H9F7-F1-model_v4 | NAD(P)H quinone oxidoreductase | 0.9899 | 1 | 326 |
GO:0016651
GO:0070402 |