F466225

General Info

Members Datasets Scaffolds Average Seq Length
582 345 1164 458

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0020468|Ga0501082_0020468_597_2150
Length 517
Sequence MVATAGGVDSAAAPGDACRRYPPHLAWSLVRHSGDEAPRGAGAGPPERRQTEDAMATWTPDPTFYPSPRLAARAPAEKLAYVASFDPERKRKDVLAVVDLDPASPSYAGIVGRVEMSGAGDELHHFGWNACSSSLCPNAPHPHMERRYLVVPGLRSSRIHILDTKPDPKNPKTVKVIEPEEIADRAGYTRPHTVHCGPEGIYVAALGNAEGKGPGGVFLMDHETFEVRGRWEVDRGPQEFAYDMWWHLGYDTVVTSEWGTPDMFEEGLVPELLLGSKYGRKLHFWDMHKRRHVQEIDFGKEHQLVFELRPAHDPTKAYGFVNCVISLEDLSSSIWTWYRDGDKWAAKKVISIPAEPADPEVLPPAIKGFKACPPLVTDIDLSVDDKFLYVSCWGTGDFHQYDVSDPFAPKLTGKLRIGGIVSRAPHPKGNGKLNGGPQMVEASRDGRRIYFTNSLYGAIDPQFYPDGIKGWMVKVDAKPEGGMALDPNFFVEWPAGLLPHQVRLQGGDASSDSYCYP

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
168 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
169 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
172 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
173 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
177 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
178 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
198 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
215 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
230 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
262 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
281 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
284 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
299 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
300 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
301 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
302 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
303 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
307 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
308 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
309 2509276019 Ensifer aridi TW10 Isolate Nodule
310 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
311 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
312 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
313 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
314 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
315 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
316 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
317 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
318 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
319 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
320 2643221557 Ensifer sp. Root558 Isolate Unclassified
321 2643221610 Ensifer sp. Root74 Isolate Unclassified
322 2643221668 Ensifer sp. Root423 Isolate Unclassified
323 2643221675 Ensifer sp. Root1298 Isolate Unclassified
324 2643221680 Ensifer sp. Root1312 Isolate Unclassified
325 2643221723 Ensifer sp. Root278 Isolate Unclassified
326 2643221726 Ensifer sp. Root954 Isolate Unclassified
327 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
328 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
329 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
330 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
331 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
332 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
333 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
334 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
335 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
336 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
337 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
338 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
339 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
340 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
341 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
342 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
343 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
344 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
345 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.27
Metatranscriptomes 1.03
Isolates 6.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.81
Nodule 3.26
Rhizoplane 8.76
Rhizosphere 79.38
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_0020468 3300060353 Bacteria 5706
2 JGI25159J45721_1000206 3300002987 Bacteria 27522
3 JGI25406J46586_10011997 3300003203 Bacteria 3777
4 JGI25160J50197_1000419 3300003354 Bacteria 26931
5 Ga0055526_1002069 3300003771 Bacteria 13782
6 Ga0055536_1002646 3300003781 Bacteria 9950
7 JGI25405J52794_10008228 3300003911 Bacteria 1944
8 Ga0055543_1000921 3300004625 Bacteria 13706
9 Ga0058862_10125538 3300004803 Bacteria 1470
10 Ga0065165_1000002 3300005262 Bacteria 444192
11 Ga0065715_10094795 3300005293 Bacteria 4240
12 Ga0065707_10153942 3300005295 Bacteria 1628
13 Ga0070658_10009763 3300005327 Bacteria 7709
14 Ga0070683_100003277 3300005329 Bacteria 13090
15 Ga0070670_100000980 3300005331 Bacteria 22371
16 Ga0070670_100031420 3300005331 Bacteria 4573
17 Ga0070677_10007195 3300005333 Bacteria 3708
18 Ga0070680_100009404 3300005336 Bacteria 7509
19 Ga0070680_100070967 3300005336 Bacteria 2861
20 Ga0070660_100102042 3300005339 Bacteria 2274
21 Ga0070691_10002244 3300005341 Bacteria 8545
22 Ga0070661_100019597 3300005344 Bacteria 4821
23 Ga0070661_100091996 3300005344 Bacteria 2247
24 Ga0070668_100015334 3300005347 Bacteria 5727
25 Ga0070675_100205117 3300005354 Bacteria 1712
26 Ga0070671_100014514 3300005355 Bacteria 6368
27 Ga0070674_100021245 3300005356 Bacteria 4163
28 Ga0070688_100083640 3300005365 Bacteria 2071
29 Ga0070659_100026142 3300005366 Bacteria 4489
30 Ga0070667_100035891 3300005367 Bacteria 4155
31 Ga0070714_100014610 3300005435 Bacteria 6309
32 Ga0070714_100082391 3300005435 Bacteria 2803
33 Ga0070714_100084868 3300005435 Bacteria 2764
34 Ga0070714_100096967 3300005435 Bacteria 2591
35 Ga0070710_10059098 3300005437 Bacteria 2176
36 Ga0070705_100000070 3300005440 Bacteria 54646
37 Ga0070700_100001054 3300005441 Bacteria 13643
38 Ga0070700_100036534 3300005441 Bacteria 2980
39 Ga0070694_100001284 3300005444 Bacteria 14583
40 Ga0070694_100067636 3300005444 Bacteria 2453
41 Ga0070708_100056228 3300005445 Bacteria 3499
42 Ga0070708_100099695 3300005445 Bacteria 2658
43 Ga0070663_100002090 3300005455 Bacteria 11171
44 Ga0070663_100007812 3300005455 Bacteria 6538
45 Ga0070681_10030210 3300005458 Bacteria 5436
46 Ga0068867_100062423 3300005459 Bacteria 2768
47 Ga0070706_100148392 3300005467 Bacteria 2189
48 Ga0070707_100061430 3300005468 Bacteria 3603
49 Ga0070707_100078779 3300005468 Bacteria 3179
50 Ga0070698_100001178 3300005471 Bacteria 29022
51 Ga0070698_100052920 3300005471 Bacteria 4127
52 Ga0070699_100018295 3300005518 Bacteria 6021
53 Ga0070679_100001234 3300005530 Bacteria 22482
54 Ga0070679_100126178 3300005530 Bacteria 2541
55 Ga0070684_100002536 3300005535 Bacteria 13485
56 Ga0070684_100111997 3300005535 Bacteria 2448
57 Ga0070697_100030506 3300005536 Bacteria 4332
58 Ga0070672_100043603 3300005543 Bacteria 3460
59 Ga0070695_100000961 3300005545 Bacteria 15654
60 Ga0070696_100024181 3300005546 Bacteria 4129
61 Ga0070696_100033970 3300005546 Bacteria 3507
62 Ga0070665_100233591 3300005548 Bacteria 1839
63 Ga0070704_100001472 3300005549 Bacteria 12642
64 Ga0068855_100158271 3300005563 Bacteria 2572
65 Ga0070664_100006260 3300005564 Bacteria 9613
66 Ga0068857_100010641 3300005577 Bacteria 8000
67 Ga0068857_100027658 3300005577 Bacteria 5003
68 Ga0068854_100041645 3300005578 Bacteria 3246
69 Ga0068856_100126634 3300005614 Bacteria 2557
70 Ga0070702_100046753 3300005615 Bacteria 2455
71 Ga0068859_100020770 3300005617 Bacteria 6591
72 Ga0068859_100183691 3300005617 Bacteria 2174
73 Ga0068864_100012350 3300005618 Bacteria 7059
74 Ga0068864_100028697 3300005618 Bacteria 4707
75 Ga0068864_100095152 3300005618 Bacteria 2634
76 Ga0068864_100129823 3300005618 Bacteria 2262
77 Ga0068870_10007145 3300005840 Bacteria 4967
78 Ga0068863_100041332 3300005841 Bacteria 4383
79 Ga0068863_100078026 3300005841 Bacteria 3135
80 Ga0068863_100101369 3300005841 Bacteria 2737
81 Ga0068858_100105178 3300005842 Bacteria 2634
82 Ga0068860_100004449 3300005843 Bacteria 14300
83 Ga0068862_100001012 3300005844 Bacteria 26997
84 Ga0081455_10000807 3300005937 Bacteria 40308
85 Ga0081455_10004902 3300005937 Bacteria 14836
86 Ga0081455_10006325 3300005937 Bacteria 12718
87 Ga0081455_10014866 3300005937 Bacteria 7590
88 Ga0081538_10001041 3300005981 Bacteria 29562
89 Ga0081538_10007258 3300005981 Bacteria 9610
90 Ga0081540_1012864 3300005983 Bacteria 5473
91 Ga0081540_1054158 3300005983 Bacteria 1962
92 Ga0081539_10001156 3300005985 Bacteria 47824
93 Ga0081539_10055759 3300005985 Bacteria 2196
94 Ga0075365_10011708 3300006038 Bacteria 5170
95 Ga0075365_10087892 3300006038 Bacteria 2114
96 Ga0075362_10030933 3300006177 Bacteria 2314
97 Ga0075427_10000780 3300006194 Bacteria 3873
98 Ga0075428_100001825 3300006844 Bacteria 22809
99 Ga0075428_100141681 3300006844 Bacteria 2614
100 Ga0075430_100000198 3300006846 Bacteria 40771
101 Ga0075430_100001275 3300006846 Bacteria 20297
102 Ga0075430_100097116 3300006846 Bacteria 2462
103 Ga0075431_100002549 3300006847 Bacteria 17587
104 Ga0075431_100025208 3300006847 Bacteria 6096
105 Ga0075431_100036324 3300006847 Bacteria 5074
106 Ga0075431_100061941 3300006847 Bacteria 3860
107 Ga0075433_10041104 3300006852 Bacteria 4005
108 Ga0075434_100103265 3300006871 Bacteria 2858
109 Ga0075434_100154960 3300006871 Bacteria 2311
110 Ga0075429_100001120 3300006880 Bacteria 21587
111 Ga0068865_100123260 3300006881 Bacteria 1931
112 Ga0075436_100014261 3300006914 Bacteria 5443
113 Ga0075436_100036400 3300006914 Bacteria 3397
114 Ga0097620_100020770 3300006931 Bacteria 6591
115 Ga0097620_100183698 3300006931 Bacteria 2174
116 Ga0075435_100036410 3300007076 Bacteria 3911
117 Ga0075435_100068438 3300007076 Bacteria 2892
118 Ga0075435_100209017 3300007076 Bacteria 1655
119 Ga0105251_10000515 3300009011 Bacteria 36438
120 Ga0105240_10004995 3300009093 Bacteria 19921
121 Ga0111539_10000148 3300009094 Bacteria 79887
122 Ga0111539_10003657 3300009094 Bacteria 20260
123 Ga0111539_10025450 3300009094 Bacteria 7256
124 Ga0111539_10039556 3300009094 Bacteria 5683
125 Ga0111539_10162370 3300009094 Bacteria 2613
126 Ga0111539_10220364 3300009094 Bacteria 2210
127 Ga0111539_10234731 3300009094 Bacteria 2135
128 Ga0111539_10246919 3300009094 Bacteria 2078
129 Ga0105245_10064318 3300009098 Bacteria 3314
130 Ga0105247_10004920 3300009101 Bacteria 8496
131 Ga0105247_10021630 3300009101 Bacteria 3871
132 Ga0114129_10004220 3300009147 Bacteria 20303
133 Ga0114129_10014015 3300009147 Bacteria 11420
134 Ga0114129_10020425 3300009147 Bacteria 9418
135 Ga0114129_10026708 3300009147 Bacteria 8177
136 Ga0114129_10032460 3300009147 Bacteria 7380
137 Ga0114129_10049486 3300009147 Bacteria 5905
138 Ga0114129_10065218 3300009147 Bacteria 5083
139 Ga0114129_10093037 3300009147 Bacteria 4177
140 Ga0114129_10243293 3300009147 Bacteria 2418
141 Ga0114129_10259496 3300009147 Bacteria 2330
142 Ga0114129_10311568 3300009147 Bacteria 2095
143 Ga0114129_10403248 3300009147 Bacteria 1802
144 Ga0114129_10453471 3300009147 Bacteria 1682
145 Ga0105243_10085167 3300009148 Bacteria 2590
146 Ga0105248_10102486 3300009177 Bacteria 3226
147 Ga0105248_10138915 3300009177 Bacteria 2741
148 Ga0105248_10301107 3300009177 Bacteria 1805
149 Ga0105249_10002161 3300009553 Bacteria 17038
150 Ga0105249_10003044 3300009553 Bacteria 14468
151 Ga0105029_101102 3300009984 Bacteria 1618
152 Ga0105239_10064341 3300010375 Bacteria 4026
153 Ga0105239_10108492 3300010375 Bacteria 3076
154 Ga0105239_10167037 3300010375 Bacteria 2461
155 Ga0105246_10029586 3300011119 Bacteria 3608
156 Ga0105246_10032492 3300011119 Bacteria 3461
157 Ga0157373_10046992 3300013100 Bacteria 3079
158 Ga0157373_10065576 3300013100 Bacteria 2569
159 Ga0157370_10016724 3300013104 Bacteria 7423
160 Ga0157369_10013291 3300013105 Bacteria 9315
161 Ga0157369_10126768 3300013105 Bacteria 2706
162 Ga0157374_10067801 3300013296 Bacteria 3356
163 Ga0163162_10000853 3300013306 Bacteria 28385
164 Ga0163162_10320230 3300013306 Bacteria 1683
165 Ga0157372_10015790 3300013307 Bacteria 8100
166 Ga0157372_10022377 3300013307 Bacteria 6838
167 Ga0163163_10038722 3300014325 Bacteria 4647
168 Ga0157376_10031937 3300014969 Bacteria 4223
169 Ga0214543_1000025 3300021327 Bacteria 225351
170 Ga0213872_10067072 3300021361 Bacteria 1620
171 Ga0213875_10011320 3300021388 Bacteria 4440
172 Ga0213871_10005413 3300021441 Bacteria 2630
173 Ga0224712_10021990 3300022467 Bacteria 2192
174 Ga0224712_10053550 3300022467 Unclassified 1580
175 Ga0209436_100645 3300025208 Bacteria 14856
176 Ga0209130_1000010 3300025284 Bacteria 444920
177 Ga0209676_1011737 3300025292 Bacteria 3504
178 Ga0209025_1000534 3300025294 Bacteria 72165
179 Ga0209564_1000473 3300025295 Bacteria 67272
180 Ga0209758_1034509 3300025297 Bacteria 2011
181 Ga0209050_1019450 3300025298 Bacteria 2577
182 Ga0209256_1000509 3300025299 Bacteria 57170
183 Ga0209256_1001883 3300025299 Bacteria 19325
184 Ga0207426_1000036 3300025302 Bacteria 444920
185 Ga0207426_1003595 3300025302 Bacteria 8234
186 Ga0209257_1003891 3300025304 Bacteria 12179
187 Ga0207713_1007478 3300025735 Bacteria 6438
188 Ga0207653_10008090 3300025885 Bacteria 3278
189 Ga0207682_10011102 3300025893 Bacteria 3526
190 Ga0207642_10023085 3300025899 Bacteria 2479
191 Ga0207710_10002598 3300025900 Bacteria 8329
192 Ga0207688_10001503 3300025901 Bacteria 12239
193 Ga0207643_10064285 3300025908 Bacteria 2100
194 Ga0207684_10036917 3300025910 Bacteria 4147
195 Ga0207707_10059766 3300025912 Bacteria 3316
196 Ga0207707_10132081 3300025912 Bacteria 2183
197 Ga0207663_10040898 3300025916 Bacteria 2821
198 Ga0207660_10036195 3300025917 Bacteria 3431
199 Ga0207660_10045016 3300025917 Bacteria 3107
200 Ga0207660_10099936 3300025917 Bacteria 2165
201 Ga0207657_10021556 3300025919 Bacteria 6059
202 Ga0207657_10089558 3300025919 Bacteria 2570
203 Ga0207652_10037696 3300025921 Bacteria 4092
204 Ga0207646_10038927 3300025922 Bacteria 4279
205 Ga0207681_10097855 3300025923 Bacteria 2110
206 Ga0207659_10185162 3300025926 Bacteria 1653
207 Ga0207687_10095611 3300025927 Bacteria 2176
208 Ga0207664_10011401 3300025929 Bacteria 6316
209 Ga0207664_10116258 3300025929 Bacteria 2231
210 Ga0207664_10118990 3300025929 Bacteria 2208
211 Ga0207706_10059114 3300025933 Bacteria 3376
212 Ga0207706_10151605 3300025933 Bacteria 2038
213 Ga0207704_10041666 3300025938 Bacteria 2695
214 Ga0207691_10002238 3300025940 Bacteria 18948
215 Ga0207691_10043104 3300025940 Bacteria 4159
216 Ga0207711_10007126 3300025941 Bacteria 9370
217 Ga0207689_10186953 3300025942 Bacteria 1708
218 Ga0207661_10180233 3300025944 Bacteria 1845
219 Ga0207679_10023322 3300025945 Bacteria 4229
220 Ga0207667_10374616 3300025949 Bacteria 1451
221 Ga0207712_10000086 3300025961 Bacteria 107484
222 Ga0207712_10014486 3300025961 Bacteria 5075
223 Ga0207712_10047665 3300025961 Bacteria 2976
224 Ga0207668_10007938 3300025972 Bacteria 6313
225 Ga0207668_10019583 3300025972 Bacteria 4280
226 Ga0207640_10042848 3300025981 Bacteria 2888
227 Ga0207658_10026600 3300025986 Bacteria 4058
228 Ga0207639_10123586 3300026041 Bacteria 2131
229 Ga0207639_10284464 3300026041 Bacteria 1455
230 Ga0207678_10028359 3300026067 Bacteria 4887
231 Ga0207678_10054716 3300026067 Bacteria 3437
232 Ga0207708_10000440 3300026075 Bacteria 32431
233 Ga0207708_10001367 3300026075 Bacteria 18341
234 Ga0207641_10053508 3300026088 Bacteria 3422
235 Ga0207641_10057994 3300026088 Bacteria 3294
236 Ga0207641_10096937 3300026088 Bacteria 2591
237 Ga0207676_10029028 3300026095 Bacteria 4137
238 Ga0207676_10044381 3300026095 Bacteria 3429
239 Ga0207674_10009840 3300026116 Bacteria 10887
240 Ga0207674_10015598 3300026116 Bacteria 8343
241 Ga0207674_10031602 3300026116 Bacteria 5559
242 Ga0207675_100005302 3300026118 Bacteria 12397
243 Ga0207683_10175727 3300026121 Bacteria 1941
244 Ga0207683_10220027 3300026121 Bacteria 1730
245 Ga0207698_10113466 3300026142 Bacteria 2277
246 Ga0209998_10003280 3300027717 Bacteria 3562
247 Ga0207428_10000272 3300027907 Bacteria 69872
248 Ga0268265_10014552 3300028380 Bacteria 5362
249 Ga0268264_10017830 3300028381 Bacteria 5811
250 Ga0268264_10036648 3300028381 Bacteria 4042
251 Ga0268264_10123153 3300028381 Bacteria 2288
252 Ga0265332_10006501 3300031238 Bacteria 5298
253 Ga0307408_100030794 3300031548 Bacteria 3728
254 Ga0307405_10012704 3300031731 Bacteria 4469
255 Ga0307413_10009626 3300031824 Bacteria 4636
256 Ga0307410_10001286 3300031852 Bacteria 11174
257 Ga0307406_10022127 3300031901 Bacteria 3769
258 Ga0307406_10141263 3300031901 Bacteria 1705
259 Ga0307407_10010762 3300031903 Bacteria 4326
260 Ga0307412_10024177 3300031911 Bacteria 3748
261 Ga0307416_100008809 3300032002 Bacteria 6543
262 Ga0307416_100158223 3300032002 Bacteria 2089
263 Ga0307415_100010783 3300032126 Bacteria 5191
264 Ga0373948_0004974 3300034817 Bacteria 2130
265 Ga0373958_0001186 3300034819 Bacteria 3467
266 Ga0373938_0001646 3300034957 Bacteria 3580
267 Ga0373934_0005206 3300035086 Bacteria 4812
268 Ga0373940_0011672 3300035088 Bacteria 2091
269 Ga0373949_0019926 3300035090 Bacteria 1531
270 Ga0373952_0001723 3300035092 Bacteria 3979
271 Ga0373932_0003343 3300035112 Bacteria 3869
272 Ga0373932_0008524 3300035112 Bacteria 2452
273 Ga0373936_0029707 3300035113 Bacteria 2153
274 Ga0373939_0009340 3300035114 Bacteria 2429
275 Ga0373939_0024430 3300035114 Bacteria 1683
276 Ga0373941_0004779 3300035115 Bacteria 3151
277 Ga0373960_0002107 3300035121 Bacteria 4479
278 Ga0373943_0106865 3300035170 Bacteria 1471
279 Ga0373942_0002057 3300035207 Bacteria 5001
280 Ga0373942_0009072 3300035207 Bacteria 2324
281 Ga0373961_0003597 3300035241 Bacteria 3816
282 Ga0373961_0003742 3300035241 Bacteria 3719
283 Ga0373962_0008453 3300035242 Bacteria 2533
284 Ga0373935_0017967 3300035692 Bacteria 4298
285 Ga0373935_0094405 3300035692 Bacteria 1963
286 Ga0373935_0115078 3300035692 Unclassified 1790
287 Ga0373933_0000295 3300035724 Bacteria 32120
288 Ga0373947_0035232 3300035725 Bacteria 2963
289 Ga0373947_0052619 3300035725 Bacteria 2453
290 Ga0373937_0000015 3300036401 Bacteria 148228
291 Ga0373937_0012210 3300036401 Bacteria 7543
292 Ga0373925_0032973 3300037068 Bacteria 3815
293 Ga0373925_0078492 3300037068 Bacteria 2507
294 Ga0395899_0055042 3300037312 Bacteria 2943
295 Ga0395899_0092364 3300037312 Bacteria 2192
296 Ga0395900_0002864 3300037418 Bacteria 18810
297 Ga0395900_0016774 3300037418 Bacteria 7470
298 Ga0395898_0004348 3300037466 Bacteria 15510
299 Ga0395898_0004796 3300037466 Bacteria 14716
300 Ga0395898_0178860 3300037466 Bacteria 2027
301 Ga0395905_0080848 3300037471 Bacteria 3046
302 Ga0436364_0015459 3300037853 Bacteria 4384
303 Ga0436364_0870792 3300037853 Bacteria 16127
304 Ga0436364_1495038 3300037853 Bacteria 3763
305 Ga0395901_0004042 3300038443 Bacteria 14771
306 Ga0395901_0004388 3300038443 Bacteria 14227
307 Ga0395901_0104490 3300038443 Bacteria 2973
308 Ga0436365_0343073 3300039437 Bacteria 37920
309 Ga0436365_1274582 3300039437 Bacteria 10974
310 Ga0436360_0270156 3300039438 Bacteria 2639
311 Ga0436360_0482858 3300039438 Bacteria 3078
312 Ga0436360_1319116 3300039438 Bacteria 1492
313 Ga0436361_0374672 3300039447 Bacteria 1633
314 Ga0436361_1037939 3300039447 Bacteria 4882
315 Ga0436362_1257765 3300039453 Bacteria 1847
316 Ga0439435_0006573 3300042436 Bacteria 2617
317 Ga0466967_0070936 3300045976 Bacteria 3118
318 Ga0495603_0023467 3300046455 Bacteria 3732
319 Ga0495603_0028987 3300046455 Bacteria 3339
320 Ga0495603_0068171 3300046455 Bacteria 2093
321 Ga0495590_0005107 3300046457 Bacteria 5230
322 Ga0495629_0034721 3300046459 Bacteria 3565
323 Ga0495629_0092946 3300046459 Bacteria 2105
324 Ga0495638_0003720 3300046460 Bacteria 11874
325 Ga0495638_0020652 3300046460 Bacteria 4348
326 Ga0495638_0059400 3300046460 Bacteria 2368
327 Ga0495641_0049973 3300046461 Bacteria 1913
328 Ga0495651_0005671 3300046462 Bacteria 9515
329 Ga0495651_0075327 3300046462 Bacteria 2559
330 Ga0495650_0025021 3300046471 Bacteria 2808
331 Ga0495580_0013812 3300046472 Bacteria 6148
332 Ga0495580_0024667 3300046472 Bacteria 4399
333 Ga0495582_0057290 3300046473 Bacteria 2148
334 Ga0495605_0010700 3300046474 Bacteria 5127
335 Ga0495664_0164816 3300046477 Bacteria 1345
336 Ga0495594_0017113 3300046499 Bacteria 3826
337 Ga0495606_0015111 3300046507 Bacteria 5973
338 Ga0495628_0047139 3300046516 Bacteria 3421
339 Ga0495663_0016473 3300046525 Bacteria 2089
340 Ga0495666_0011920 3300046526 Bacteria 4338
341 Ga0495652_0083045 3300046529 Bacteria 2638
342 Ga0495587_0000081 3300046536 Bacteria 74942
343 Ga0495598_0004228 3300046537 Bacteria 3099
344 Ga0495621_0022296 3300046539 Bacteria 2097
345 Ga0495633_0052797 3300046558 Bacteria 1914
346 Ga0495656_0022435 3300046615 Bacteria 2472
347 Ga0495656_0045332 3300046615 Bacteria 1856
348 Ga0495634_0026126 3300046642 Bacteria 4077
349 Ga0495635_0062508 3300046663 Bacteria 2557
350 Ga0495647_0008207 3300046681 Bacteria 3509
351 Ga0495658_0023162 3300046683 Bacteria 3294
352 Ga0495658_0036618 3300046683 Bacteria 2708
353 Ga0495669_0016051 3300046684 Bacteria 3207
354 Ga0495613_0023083 3300046689 Bacteria 4637
355 Ga0495624_0092155 3300046690 Bacteria 1869
356 Ga0495670_0074483 3300046691 Bacteria 1722
357 Ga0495670_0092022 3300046691 Bacteria 1553
358 Ga0495671_0082643 3300046692 Bacteria 1574
359 Ga0495589_0020426 3300046794 Bacteria 3387
360 Ga0495581_0026956 3300047315 Bacteria 3332
361 Ga0495581_0116010 3300047315 Bacteria 1557
362 Ga0495604_0029599 3300047317 Bacteria 4356
363 Ga0495636_0046298 3300047318 Bacteria 1814
364 Ga0495674_0032368 3300047319 Bacteria 4743
365 Ga0495674_0068321 3300047319 Bacteria 3076
366 Ga0495672_0029075 3300047320 Bacteria 3486
367 Ga0495676_0036279 3300047321 Bacteria 4119
368 Ga0495683_0001614 3300047323 Bacteria 14505
369 Ga0495675_0000105 3300047444 Bacteria 60274
370 Ga0495684_0164470 3300047471 Bacteria 1653
371 Ga0495593_0081007 3300047673 Bacteria 1679
372 Ga0495602_0000101 3300048088 Bacteria 81181
373 Ga0496100_0013914 3300048903 Bacteria 4656
374 Ga0496100_0015452 3300048903 Bacteria 4458
375 Ga0496100_0047968 3300048903 Bacteria 2755
376 Ga0496101_0003175 3300048904 Bacteria 10180
377 Ga0496101_0005460 3300048904 Bacteria 8108
378 Ga0496101_0089091 3300048904 Bacteria 2293
379 Ga0496102_0001759 3300048905 Bacteria 18856
380 Ga0496102_0100732 3300048905 Bacteria 2683
381 Ga0496102_0233639 3300048905 Bacteria 1733
382 Ga0496103_0002756 3300048906 Bacteria 10953
383 Ga0496103_0028284 3300048906 Bacteria 3401
384 Ga0496103_0086486 3300048906 Bacteria 1976
385 Ga0496104_0000771 3300048907 Bacteria 27410
386 Ga0496104_0020461 3300048907 Bacteria 6066
387 Ga0496104_0104472 3300048907 Bacteria 2714
388 Ga0496105_0006172 3300048908 Bacteria 9187
389 Ga0496105_0076532 3300048908 Bacteria 2763
390 Ga0496106_0000442 3300048909 Bacteria 29596
391 Ga0496106_0007901 3300048909 Bacteria 7861
392 Ga0496106_0012687 3300048909 Bacteria 6225
393 Ga0496106_0123197 3300048909 Bacteria 2028
394 Ga0496107_0003680 3300048910 Bacteria 10304
395 Ga0496107_0006188 3300048910 Bacteria 8223
396 Ga0496107_0045365 3300048910 Bacteria 3161
397 Ga0496107_0167892 3300048910 Bacteria 1627
398 Ga0496108_0014091 3300048911 Bacteria 6521
399 Ga0496109_0010932 3300048912 Bacteria 7775
400 Ga0496109_0132830 3300048912 Bacteria 2324
401 Ga0496110_0013691 3300048913 Bacteria 6719
402 Ga0496110_0064926 3300048913 Bacteria 3227
403 Ga0496110_0138094 3300048913 Bacteria 2204
404 Ga0496110_0254705 3300048913 Bacteria 1598
405 Ga0496111_0000201 3300048914 Bacteria 27885
406 Ga0496111_0007920 3300048914 Bacteria 7006
407 Ga0496111_0098048 3300048914 Bacteria 2152
408 Ga0496111_0115448 3300048914 Bacteria 1979
409 Ga0496112_0015735 3300048915 Bacteria 7065
410 Ga0496112_0026084 3300048915 Bacteria 5619
411 Ga0496112_0049208 3300048915 Bacteria 4132
412 Ga0496112_0070889 3300048915 Bacteria 3444
413 Ga0496112_0080518 3300048915 Bacteria 3220
414 Ga0496113_0001392 3300048916 Bacteria 13446
415 Ga0496113_0001658 3300048916 Bacteria 12579
416 Ga0496113_0195997 3300048916 Bacteria 1604
417 Ga0496114_0004568 3300048917 Bacteria 10751
418 Ga0496114_0009443 3300048917 Bacteria 7744
419 Ga0496114_0200683 3300048917 Bacteria 1747
420 Ga0496115_0006962 3300048918 Bacteria 8304
421 Ga0496115_0010619 3300048918 Bacteria 6886
422 Ga0496118_0003348 3300048921 Bacteria 20291
423 Ga0496121_0009181 3300048924 Bacteria 11430
424 Ga0496122_0004756 3300048925 Bacteria 16629
425 Ga0496123_0005936 3300048926 Bacteria 12028
426 Ga0501031_0013801 3300049568 Bacteria 5267
427 Ga0501031_0013916 3300049568 Bacteria 5241
428 Ga0501031_0123430 3300049568 Bacteria 1692
429 Ga0501031_0144888 3300049568 Bacteria 1552
430 Ga0501034_0037893 3300049571 Bacteria 4883
431 Ga0501036_0032650 3300049572 Bacteria 4400
432 Ga0501036_0054991 3300049572 Bacteria 3372
433 Ga0501036_0082403 3300049572 Bacteria 2719
434 Ga0501039_0007423 3300049575 Bacteria 8365
435 Ga0501039_0029796 3300049575 Bacteria 4205
436 Ga0501039_0168791 3300049575 Bacteria 1720
437 Ga0501040_0028565 3300049576 Bacteria 3761
438 Ga0501040_0043315 3300049576 Bacteria 3068
439 Ga0501041_0028574 3300049577 Bacteria 3364
440 Ga0501041_0029150 3300049577 Bacteria 3330
441 Ga0501041_0075044 3300049577 Bacteria 2079
442 Ga0501042_0062469 3300049578 Bacteria 2661
443 Ga0501042_0080128 3300049578 Bacteria 2340
444 Ga0501042_0104296 3300049578 Bacteria 2040
445 Ga0501042_0157115 3300049578 Bacteria 1640
446 Ga0501042_0171592 3300049578 Bacteria 1565
447 Ga0501043_0044111 3300049579 Bacteria 3506
448 Ga0501046_0006331 3300049580 Bacteria 10490
449 Ga0501046_0111057 3300049580 Bacteria 2094
450 Ga0501046_0118317 3300049580 Bacteria 2018
451 Ga0501048_0011072 3300049582 Bacteria 6724
452 Ga0501048_0026314 3300049582 Bacteria 4236
453 Ga0501068_0018531 3300049584 Bacteria 4031
454 Ga0501070_0018058 3300049586 Bacteria 5919
455 Ga0501071_0050084 3300049587 Bacteria 3008
456 Ga0501071_0184474 3300049587 Bacteria 1564
457 Ga0501072_0006434 3300049588 Bacteria 8948
458 Ga0501072_0025292 3300049588 Bacteria 4624
459 Ga0501074_0017832 3300049590 Bacteria 5159
460 Ga0501075_0008960 3300049591 Bacteria 6981
461 Ga0501075_0031179 3300049591 Bacteria 3955
462 Ga0501075_0062966 3300049591 Bacteria 2796
463 Ga0501075_0086061 3300049591 Bacteria 2381
464 Ga0501075_0104249 3300049591 Bacteria 2155
465 Ga0501076_0037045 3300049592 Bacteria 3823
466 Ga0501076_0057674 3300049592 Bacteria 3084
467 Ga0501076_0070145 3300049592 Bacteria 2801
468 Ga0501077_0003092 3300049593 Bacteria 10005
469 Ga0501077_0016719 3300049593 Bacteria 4625
470 Ga0501079_0017315 3300049741 Bacteria 5503
471 Ga0501079_0021750 3300049741 Bacteria 4909
472 Ga0501079_0086657 3300049741 Bacteria 2424
473 Ga0501079_0200645 3300049741 Bacteria 1558
474 Ga0501080_0016609 3300049742 Bacteria 6800
475 Ga0501080_0187297 3300049742 Bacteria 1903
476 Ga0501080_0188083 3300049742 Bacteria 1898
477 Ga0501081_0018726 3300049743 Bacteria 4599
478 Ga0501083_0007057 3300049744 Bacteria 7978
479 Ga0501045_0012788 3300049824 Bacteria 5914
480 Ga0501045_0026091 3300049824 Bacteria 4200
481 Ga0501045_0116580 3300049824 Bacteria 1982
482 Ga0501045_0125948 3300049824 Bacteria 1903
483 nmdc:mga0yw44_141659_c1 3300050492 Bacteria 1563
484 nmdc:mga0yw44_9371_c1 3300050492 Bacteria 4945
485 nmdc:mga06z11_4288_c1 3300050494 Bacteria 5603
486 nmdc:mga06z11_47887_c1 3300050494 Bacteria 2173
487 nmdc:mga05p37_117772_c1 3300050507 Bacteria 3264
488 nmdc:mga05p37_166369_c1 3300050507 Bacteria 2691
489 nmdc:mga05p37_19099_c2 3300050507 Bacteria 5199
490 nmdc:mga05p37_251069_c1 3300050507 Bacteria 2122
491 nmdc:mga05p37_28146_c1 3300050507 Bacteria 6850
492 nmdc:mga05p37_288265_c1 3300050507 Bacteria 1955
493 nmdc:mga05p37_4650_c2 3300050507 Bacteria 11206
494 nmdc:mga09592_157814_c1 3300050508 Bacteria 1959
495 nmdc:mga09592_3461_c1 3300050508 Bacteria 12750
496 nmdc:mga09592_95706_c1 3300050508 Bacteria 2540
497 nmdc:mga0qj67_1632_c1 3300050509 Bacteria 15769
498 nmdc:mga0qj67_194478_c1 3300050509 Bacteria 1648
499 nmdc:mga0qj67_29080_c1 3300050509 Bacteria 4292
500 nmdc:mga0qj67_91523_c1 3300050509 Bacteria 2444
501 nmdc:mga06r32_15139_c1 3300050510 Bacteria 7004
502 nmdc:mga06r32_2960_c1 3300050510 Bacteria 15220
503 nmdc:mga06r32_546_c1 3300050510 Bacteria 32690
504 nmdc:mga06r32_84164_c1 3300050510 Bacteria 3099
505 nmdc:mga08y16_12340_c1 3300050511 Bacteria 8986
506 nmdc:mga08y16_163487_c1 3300050511 Bacteria 2312
507 nmdc:mga08y16_264474_c1 3300050511 Bacteria 1776
508 nmdc:mga08y16_44004_c1 3300050511 Bacteria 4678
509 nmdc:mga0n895_27752_c1 3300050512 Bacteria 5381
510 nmdc:mga0n895_28160_c1 3300050512 Bacteria 5344
511 nmdc:mga0n895_97086_c1 3300050512 Bacteria 2952
512 nmdc:mga0rr50_1066_c1 3300050513 Bacteria 14910
513 nmdc:mga0rr50_37681_c1 3300050513 Bacteria 3493
514 nmdc:mga0rr50_56045_c1 3300050513 Bacteria 2943
515 nmdc:mga0rr50_8656_c1 3300050513 Bacteria 6343
516 nmdc:mga08x19_18811_c1 3300050514 Bacteria 4235
517 nmdc:mga08x19_28700_c1 3300050514 Bacteria 3487
518 nmdc:mga08x19_30326_c1 3300050514 Bacteria 3397
519 nmdc:mga08x19_5506_c1 3300050514 Bacteria 7491
520 nmdc:mga08x19_7907_c1 3300050514 Bacteria 6316
521 nmdc:mga0a205_106682_c1 3300050515 Bacteria 2699
522 nmdc:mga0a205_6259_c1 3300050515 Bacteria 10746
523 Ga0495619_0132236 3300053085 Bacteria 1715
524 Ga0500641_0016292 3300053096 Bacteria 2767
525 Ga0500555_000057 3300053103 Bacteria 56490
526 Ga0500642_0001391 3300053130 Bacteria 6933
527 Ga0501084_0035805 3300054114 Bacteria 4149
528 Ga0501084_0053386 3300054114 Bacteria 3381
529 Ga0501084_0170717 3300054114 Bacteria 1836
530 Ga0590071_008341 3300059421 Bacteria 2442
531 Ga0587070_005509 3300059491 Bacteria 1663
532 Ga0587077_007438 3300059493 Bacteria 1595
533 Ga0587094_003226 3300059513 Bacteria 1758
534 Ga0501082_0003316 3300060353 Bacteria 14056
535 Ga0501082_0018589 3300060353 Bacteria 5990
536 Ga0501082_0083752 3300060353 Bacteria 2751
537 Ga0501082_0243427 3300060353 Bacteria 1565
538 Ga0501082_0272515 3300060353 Bacteria 1473
539 Ga0530510_0000469 3300061734 Bacteria 25872
540 Ga0530510_0008761 3300061734 Bacteria 7075
541 Ga0530510_0018066 3300061734 Bacteria 4998
542 Ga0530510_0028404 3300061734 Bacteria 4011
543 Ga0530510_0178240 3300061734 Bacteria 1575
544 2509078328 2508501114 Bacteria 7082538
545 2509110972 2508501122 Bacteria 6292184
546 2509379305 2509276019 Bacteria 6802256
547 2513912423 2513237144 Bacteria 7530820
548 2513928346 2513237146 Bacteria 7166346
549 2514591244 2513237351 Bacteria 6968952
550 2524460141 2524023209 Bacteria 6679728
551 2558861568 2558860100 Bacteria 8458965
552 2585270372 2582581306 Bacteria 6450535
553 2585391456 2582581865 Bacteria 6644329
554 2585397004 2582581866 Bacteria 6859583
555 2599419142 2599185170 Bacteria 7295545
556 2600196766 2599185352 Bacteria 7228948
557 2643806431 2643221557 Bacteria 7184309
558 2644067328 2643221610 Bacteria 7480339
559 2644380099 2643221668 Bacteria 7306521
560 2644418416 2643221675 Bacteria 7473456
561 2644451783 2643221680 Bacteria 7473610
562 2644674666 2643221723 Bacteria 7095460
563 2644687210 2643221726 Bacteria 7455827
564 2676487127 2675903059 Bacteria 8644972
565 2770197764 2767802442 Bacteria 5747986
566 2835315855 2835312727 Bacteria 7413381
567 2838037172 2838035591 Bacteria 7166484
568 2838663652 2838661181 Bacteria 7385261
569 2840769725 2840764183 Bacteria 6358399
570 2841913228 2841911363 Bacteria 6173697
571 2841918975 2841917233 Bacteria 6173500
572 2842298633 2842298080 Bacteria 6123127
573 2842359500 2842357229 Bacteria 6485165
574 2842510661 2842509118 Bacteria 6850950
575 2850084465 2850079185 Bacteria 6848280
576 2852391127 2852387548 Bacteria 8025568
577 2894233306 2894232714 Bacteria 8834183
578 2894656827 2894652903 Bacteria 4587256
579 2895438937 2895427314 Bacteria 13147766
580 2904581723 2904578770 Bacteria 5302906
581 2919123389 2919119836 Bacteria 5208557
582 2937848087 2937843397 Bacteria 5256375
583 Ga0501082_0020468
584 JGI25159J45721_1000206
585 JGI25406J46586_10011997
586 JGI25160J50197_1000419
587 Ga0055526_1002069
588 Ga0055536_1002646
589 JGI25405J52794_10008228
590 Ga0055543_1000921
591 Ga0058862_10125538
592 Ga0065165_1000002
593 Ga0065715_10094795
594 Ga0065707_10153942
595 Ga0070658_10009763
596 Ga0070683_100003277
597 Ga0070670_100000980
598 Ga0070670_100031420
599 Ga0070677_10007195
600 Ga0070680_100009404
601 Ga0070680_100070967
602 Ga0070660_100102042
603 Ga0070691_10002244
604 Ga0070661_100019597
605 Ga0070661_100091996
606 Ga0070668_100015334
607 Ga0070675_100205117
608 Ga0070671_100014514
609 Ga0070674_100021245
610 Ga0070688_100083640
611 Ga0070659_100026142
612 Ga0070667_100035891
613 Ga0070714_100014610
614 Ga0070714_100082391
615 Ga0070714_100084868
616 Ga0070714_100096967
617 Ga0070710_10059098
618 Ga0070705_100000070
619 Ga0070700_100001054
620 Ga0070700_100036534
621 Ga0070694_100001284
622 Ga0070694_100067636
623 Ga0070708_100056228
624 Ga0070708_100099695
625 Ga0070663_100002090
626 Ga0070663_100007812
627 Ga0070681_10030210
628 Ga0068867_100062423
629 Ga0070706_100148392
630 Ga0070707_100061430
631 Ga0070707_100078779
632 Ga0070698_100001178
633 Ga0070698_100052920
634 Ga0070699_100018295
635 Ga0070679_100001234
636 Ga0070679_100126178
637 Ga0070684_100002536
638 Ga0070684_100111997
639 Ga0070697_100030506
640 Ga0070672_100043603
641 Ga0070695_100000961
642 Ga0070696_100024181
643 Ga0070696_100033970
644 Ga0070665_100233591
645 Ga0070704_100001472
646 Ga0068855_100158271
647 Ga0070664_100006260
648 Ga0068857_100010641
649 Ga0068857_100027658
650 Ga0068854_100041645
651 Ga0068856_100126634
652 Ga0070702_100046753
653 Ga0068859_100020770
654 Ga0068859_100183691
655 Ga0068864_100012350
656 Ga0068864_100028697
657 Ga0068864_100095152
658 Ga0068864_100129823
659 Ga0068870_10007145
660 Ga0068863_100041332
661 Ga0068863_100078026
662 Ga0068863_100101369
663 Ga0068858_100105178
664 Ga0068860_100004449
665 Ga0068862_100001012
666 Ga0081455_10000807
667 Ga0081455_10004902
668 Ga0081455_10006325
669 Ga0081455_10014866
670 Ga0081538_10001041
671 Ga0081538_10007258
672 Ga0081540_1012864
673 Ga0081540_1054158
674 Ga0081539_10001156
675 Ga0081539_10055759
676 Ga0075365_10011708
677 Ga0075365_10087892
678 Ga0075362_10030933
679 Ga0075427_10000780
680 Ga0075428_100001825
681 Ga0075428_100141681
682 Ga0075430_100000198
683 Ga0075430_100001275
684 Ga0075430_100097116
685 Ga0075431_100002549
686 Ga0075431_100025208
687 Ga0075431_100036324
688 Ga0075431_100061941
689 Ga0075433_10041104
690 Ga0075434_100103265
691 Ga0075434_100154960
692 Ga0075429_100001120
693 Ga0068865_100123260
694 Ga0075436_100014261
695 Ga0075436_100036400
696 Ga0097620_100020770
697 Ga0097620_100183698
698 Ga0075435_100036410
699 Ga0075435_100068438
700 Ga0075435_100209017
701 Ga0105251_10000515
702 Ga0105240_10004995
703 Ga0111539_10000148
704 Ga0111539_10003657
705 Ga0111539_10025450
706 Ga0111539_10039556
707 Ga0111539_10162370
708 Ga0111539_10220364
709 Ga0111539_10234731
710 Ga0111539_10246919
711 Ga0105245_10064318
712 Ga0105247_10004920
713 Ga0105247_10021630
714 Ga0114129_10004220
715 Ga0114129_10014015
716 Ga0114129_10020425
717 Ga0114129_10026708
718 Ga0114129_10032460
719 Ga0114129_10049486
720 Ga0114129_10065218
721 Ga0114129_10093037
722 Ga0114129_10243293
723 Ga0114129_10259496
724 Ga0114129_10311568
725 Ga0114129_10403248
726 Ga0114129_10453471
727 Ga0105243_10085167
728 Ga0105248_10102486
729 Ga0105248_10138915
730 Ga0105248_10301107
731 Ga0105249_10002161
732 Ga0105249_10003044
733 Ga0105029_101102
734 Ga0105239_10064341
735 Ga0105239_10108492
736 Ga0105239_10167037
737 Ga0105246_10029586
738 Ga0105246_10032492
739 Ga0157373_10046992
740 Ga0157373_10065576
741 Ga0157370_10016724
742 Ga0157369_10013291
743 Ga0157369_10126768
744 Ga0157374_10067801
745 Ga0163162_10000853
746 Ga0163162_10320230
747 Ga0157372_10015790
748 Ga0157372_10022377
749 Ga0163163_10038722
750 Ga0157376_10031937
751 Ga0214543_1000025
752 Ga0213872_10067072
753 Ga0213875_10011320
754 Ga0213871_10005413
755 Ga0224712_10021990
756 Ga0224712_10053550
757 Ga0209436_100645
758 Ga0209130_1000010
759 Ga0209676_1011737
760 Ga0209025_1000534
761 Ga0209564_1000473
762 Ga0209758_1034509
763 Ga0209050_1019450
764 Ga0209256_1000509
765 Ga0209256_1001883
766 Ga0207426_1000036
767 Ga0207426_1003595
768 Ga0209257_1003891
769 Ga0207713_1007478
770 Ga0207653_10008090
771 Ga0207682_10011102
772 Ga0207642_10023085
773 Ga0207710_10002598
774 Ga0207688_10001503
775 Ga0207643_10064285
776 Ga0207684_10036917
777 Ga0207707_10059766
778 Ga0207707_10132081
779 Ga0207663_10040898
780 Ga0207660_10036195
781 Ga0207660_10045016
782 Ga0207660_10099936
783 Ga0207657_10021556
784 Ga0207657_10089558
785 Ga0207652_10037696
786 Ga0207646_10038927
787 Ga0207681_10097855
788 Ga0207659_10185162
789 Ga0207687_10095611
790 Ga0207664_10011401
791 Ga0207664_10116258
792 Ga0207664_10118990
793 Ga0207706_10059114
794 Ga0207706_10151605
795 Ga0207704_10041666
796 Ga0207691_10002238
797 Ga0207691_10043104
798 Ga0207711_10007126
799 Ga0207689_10186953
800 Ga0207661_10180233
801 Ga0207679_10023322
802 Ga0207667_10374616
803 Ga0207712_10000086
804 Ga0207712_10014486
805 Ga0207712_10047665
806 Ga0207668_10007938
807 Ga0207668_10019583
808 Ga0207640_10042848
809 Ga0207658_10026600
810 Ga0207639_10123586
811 Ga0207639_10284464
812 Ga0207678_10028359
813 Ga0207678_10054716
814 Ga0207708_10000440
815 Ga0207708_10001367
816 Ga0207641_10053508
817 Ga0207641_10057994
818 Ga0207641_10096937
819 Ga0207676_10029028
820 Ga0207676_10044381
821 Ga0207674_10009840
822 Ga0207674_10015598
823 Ga0207674_10031602
824 Ga0207675_100005302
825 Ga0207683_10175727
826 Ga0207683_10220027
827 Ga0207698_10113466
828 Ga0209998_10003280
829 Ga0207428_10000272
830 Ga0268265_10014552
831 Ga0268264_10017830
832 Ga0268264_10036648
833 Ga0268264_10123153
834 Ga0265332_10006501
835 Ga0307408_100030794
836 Ga0307405_10012704
837 Ga0307413_10009626
838 Ga0307410_10001286
839 Ga0307406_10022127
840 Ga0307406_10141263
841 Ga0307407_10010762
842 Ga0307412_10024177
843 Ga0307416_100008809
844 Ga0307416_100158223
845 Ga0307415_100010783
846 Ga0373948_0004974
847 Ga0373958_0001186
848 Ga0373938_0001646
849 Ga0373934_0005206
850 Ga0373940_0011672
851 Ga0373949_0019926
852 Ga0373952_0001723
853 Ga0373932_0003343
854 Ga0373932_0008524
855 Ga0373936_0029707
856 Ga0373939_0009340
857 Ga0373939_0024430
858 Ga0373941_0004779
859 Ga0373960_0002107
860 Ga0373943_0106865
861 Ga0373942_0002057
862 Ga0373942_0009072
863 Ga0373961_0003597
864 Ga0373961_0003742
865 Ga0373962_0008453
866 Ga0373935_0017967
867 Ga0373935_0094405
868 Ga0373935_0115078
869 Ga0373933_0000295
870 Ga0373947_0035232
871 Ga0373947_0052619
872 Ga0373937_0000015
873 Ga0373937_0012210
874 Ga0373925_0032973
875 Ga0373925_0078492
876 Ga0395899_0055042
877 Ga0395899_0092364
878 Ga0395900_0002864
879 Ga0395900_0016774
880 Ga0395898_0004348
881 Ga0395898_0004796
882 Ga0395898_0178860
883 Ga0395905_0080848
884 Ga0436364_0015459
885 Ga0436364_0870792
886 Ga0436364_1495038
887 Ga0395901_0004042
888 Ga0395901_0004388
889 Ga0395901_0104490
890 Ga0436365_0343073
891 Ga0436365_1274582
892 Ga0436360_0270156
893 Ga0436360_0482858
894 Ga0436360_1319116
895 Ga0436361_0374672
896 Ga0436361_1037939
897 Ga0436362_1257765
898 Ga0439435_0006573
899 Ga0466967_0070936
900 Ga0495603_0023467
901 Ga0495603_0028987
902 Ga0495603_0068171
903 Ga0495590_0005107
904 Ga0495629_0034721
905 Ga0495629_0092946
906 Ga0495638_0003720
907 Ga0495638_0020652
908 Ga0495638_0059400
909 Ga0495641_0049973
910 Ga0495651_0005671
911 Ga0495651_0075327
912 Ga0495650_0025021
913 Ga0495580_0013812
914 Ga0495580_0024667
915 Ga0495582_0057290
916 Ga0495605_0010700
917 Ga0495664_0164816
918 Ga0495594_0017113
919 Ga0495606_0015111
920 Ga0495628_0047139
921 Ga0495663_0016473
922 Ga0495666_0011920
923 Ga0495652_0083045
924 Ga0495587_0000081
925 Ga0495598_0004228
926 Ga0495621_0022296
927 Ga0495633_0052797
928 Ga0495656_0022435
929 Ga0495656_0045332
930 Ga0495634_0026126
931 Ga0495635_0062508
932 Ga0495647_0008207
933 Ga0495658_0023162
934 Ga0495658_0036618
935 Ga0495669_0016051
936 Ga0495613_0023083
937 Ga0495624_0092155
938 Ga0495670_0074483
939 Ga0495670_0092022
940 Ga0495671_0082643
941 Ga0495589_0020426
942 Ga0495581_0026956
943 Ga0495581_0116010
944 Ga0495604_0029599
945 Ga0495636_0046298
946 Ga0495674_0032368
947 Ga0495674_0068321
948 Ga0495672_0029075
949 Ga0495676_0036279
950 Ga0495683_0001614
951 Ga0495675_0000105
952 Ga0495684_0164470
953 Ga0495593_0081007
954 Ga0495602_0000101
955 Ga0496100_0013914
956 Ga0496100_0015452
957 Ga0496100_0047968
958 Ga0496101_0003175
959 Ga0496101_0005460
960 Ga0496101_0089091
961 Ga0496102_0001759
962 Ga0496102_0100732
963 Ga0496102_0233639
964 Ga0496103_0002756
965 Ga0496103_0028284
966 Ga0496103_0086486
967 Ga0496104_0000771
968 Ga0496104_0020461
969 Ga0496104_0104472
970 Ga0496105_0006172
971 Ga0496105_0076532
972 Ga0496106_0000442
973 Ga0496106_0007901
974 Ga0496106_0012687
975 Ga0496106_0123197
976 Ga0496107_0003680
977 Ga0496107_0006188
978 Ga0496107_0045365
979 Ga0496107_0167892
980 Ga0496108_0014091
981 Ga0496109_0010932
982 Ga0496109_0132830
983 Ga0496110_0013691
984 Ga0496110_0064926
985 Ga0496110_0138094
986 Ga0496110_0254705
987 Ga0496111_0000201
988 Ga0496111_0007920
989 Ga0496111_0098048
990 Ga0496111_0115448
991 Ga0496112_0015735
992 Ga0496112_0026084
993 Ga0496112_0049208
994 Ga0496112_0070889
995 Ga0496112_0080518
996 Ga0496113_0001392
997 Ga0496113_0001658
998 Ga0496113_0195997
999 Ga0496114_0004568
1000 Ga0496114_0009443
1001 Ga0496114_0200683
1002 Ga0496115_0006962
1003 Ga0496115_0010619
1004 Ga0496118_0003348
1005 Ga0496121_0009181
1006 Ga0496122_0004756
1007 Ga0496123_0005936
1008 Ga0501031_0013801
1009 Ga0501031_0013916
1010 Ga0501031_0123430
1011 Ga0501031_0144888
1012 Ga0501034_0037893
1013 Ga0501036_0032650
1014 Ga0501036_0054991
1015 Ga0501036_0082403
1016 Ga0501039_0007423
1017 Ga0501039_0029796
1018 Ga0501039_0168791
1019 Ga0501040_0028565
1020 Ga0501040_0043315
1021 Ga0501041_0028574
1022 Ga0501041_0029150
1023 Ga0501041_0075044
1024 Ga0501042_0062469
1025 Ga0501042_0080128
1026 Ga0501042_0104296
1027 Ga0501042_0157115
1028 Ga0501042_0171592
1029 Ga0501043_0044111
1030 Ga0501046_0006331
1031 Ga0501046_0111057
1032 Ga0501046_0118317
1033 Ga0501048_0011072
1034 Ga0501048_0026314
1035 Ga0501068_0018531
1036 Ga0501070_0018058
1037 Ga0501071_0050084
1038 Ga0501071_0184474
1039 Ga0501072_0006434
1040 Ga0501072_0025292
1041 Ga0501074_0017832
1042 Ga0501075_0008960
1043 Ga0501075_0031179
1044 Ga0501075_0062966
1045 Ga0501075_0086061
1046 Ga0501075_0104249
1047 Ga0501076_0037045
1048 Ga0501076_0057674
1049 Ga0501076_0070145
1050 Ga0501077_0003092
1051 Ga0501077_0016719
1052 Ga0501079_0017315
1053 Ga0501079_0021750
1054 Ga0501079_0086657
1055 Ga0501079_0200645
1056 Ga0501080_0016609
1057 Ga0501080_0187297
1058 Ga0501080_0188083
1059 Ga0501081_0018726
1060 Ga0501083_0007057
1061 Ga0501045_0012788
1062 Ga0501045_0026091
1063 Ga0501045_0116580
1064 Ga0501045_0125948
1065 nmdc:mga0yw44_141659_c1
1066 nmdc:mga0yw44_9371_c1
1067 nmdc:mga06z11_4288_c1
1068 nmdc:mga06z11_47887_c1
1069 nmdc:mga05p37_117772_c1
1070 nmdc:mga05p37_166369_c1
1071 nmdc:mga05p37_19099_c2
1072 nmdc:mga05p37_251069_c1
1073 nmdc:mga05p37_28146_c1
1074 nmdc:mga05p37_288265_c1
1075 nmdc:mga05p37_4650_c2
1076 nmdc:mga09592_157814_c1
1077 nmdc:mga09592_3461_c1
1078 nmdc:mga09592_95706_c1
1079 nmdc:mga0qj67_1632_c1
1080 nmdc:mga0qj67_194478_c1
1081 nmdc:mga0qj67_29080_c1
1082 nmdc:mga0qj67_91523_c1
1083 nmdc:mga06r32_15139_c1
1084 nmdc:mga06r32_2960_c1
1085 nmdc:mga06r32_546_c1
1086 nmdc:mga06r32_84164_c1
1087 nmdc:mga08y16_12340_c1
1088 nmdc:mga08y16_163487_c1
1089 nmdc:mga08y16_264474_c1
1090 nmdc:mga08y16_44004_c1
1091 nmdc:mga0n895_27752_c1
1092 nmdc:mga0n895_28160_c1
1093 nmdc:mga0n895_97086_c1
1094 nmdc:mga0rr50_1066_c1
1095 nmdc:mga0rr50_37681_c1
1096 nmdc:mga0rr50_56045_c1
1097 nmdc:mga0rr50_8656_c1
1098 nmdc:mga08x19_18811_c1
1099 nmdc:mga08x19_28700_c1
1100 nmdc:mga08x19_30326_c1
1101 nmdc:mga08x19_5506_c1
1102 nmdc:mga08x19_7907_c1
1103 nmdc:mga0a205_106682_c1
1104 nmdc:mga0a205_6259_c1
1105 Ga0495619_0132236
1106 Ga0500641_0016292
1107 Ga0500555_000057
1108 Ga0500642_0001391
1109 Ga0501084_0035805
1110 Ga0501084_0053386
1111 Ga0501084_0170717
1112 Ga0590071_008341
1113 Ga0587070_005509
1114 Ga0587077_007438
1115 Ga0587094_003226
1116 Ga0501082_0003316
1117 Ga0501082_0018589
1118 Ga0501082_0083752
1119 Ga0501082_0243427
1120 Ga0501082_0272515
1121 Ga0530510_0000469
1122 Ga0530510_0008761
1123 Ga0530510_0018066
1124 Ga0530510_0028404
1125 Ga0530510_0178240
1126 2509078328
1127 2509110972
1128 2509379305
1129 2513912423
1130 2513928346
1131 2514591244
1132 2524460141
1133 2558861568
1134 2585270372
1135 2585391456
1136 2585397004
1137 2599419142
1138 2600196766
1139 2643806431
1140 2644067328
1141 2644380099
1142 2644418416
1143 2644451783
1144 2644674666
1145 2644687210
1146 2676487127
1147 2770197764
1148 2835315855
1149 2838037172
1150 2838663652
1151 2840769725
1152 2841913228
1153 2841918975
1154 2842298633
1155 2842359500
1156 2842510661
1157 2850084465
1158 2852391127
1159 2894233306
1160 2894656827
1161 2895438937
1162 2904581723
1163 2919123389
1164 2937848087

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05694

SBP56

56kDa selenium binding protein (SBP56)

58

515

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ece-assembly1.cif.gz_A x-ray structure of hypothetical selenium-binding protein from sulfolobus tokodaii, st0059 0.979 7 464
2ece-assembly1.cif.gz_A x-ray structure of hypothetical selenium-binding protein from sulfolobus tokodaii, st0059 0.9747 7 464
6nag-assembly1.cif.gz_A "x-ray structure of a secreted c11 cysteine protease from bacteroides thetaiotaomicron ""iotapain" 0.7948 277 299
6zxh-assembly1.cif.gz_g cryo-em structure of a late human pre-40s ribosomal subunit - state h2 0.7662 66 431
1l0q-assembly3.cif.gz_C tandem yvtn beta-propeller and pkd domains from an archaeal surface layer protein 0.7512 26 449
ID Description Score Start End Superfamily
af_Q8RZW7_110_449_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8853 104 433 2.130.10.10
af_Q8RZW7_110_449_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8577 104 433 2.130.10.10
af_Q6PHD9_6_457_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8574 5 461 2.130.10.10
af_Q21950_81_542_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8561 19 461 2.130.10.10
af_Q6PHD9_6_457_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8482 5 461 2.130.10.10
ID Description Score Start End GO Terms
AF-W8I6H8-F1-model_v4 deleted 0.997 16 464
AF-A0A1E1V6B4-F1-model_v4 Selenium-binding protein 1 0.9969 29 464 GO:0008430
GO:0018549
AF-A0A6G6X526-F1-model_v4 Methanethiol oxidase (EC 1.8.3.4) 0.9965 5 464 GO:0008430
GO:0018549
AF-A0A537PD44-F1-model_v4 Methanethiol oxidase (EC 1.8.3.4) 0.9957 8 464 GO:0008430
GO:0018549
AF-A0A537NEA7-F1-model_v4 Methanethiol oxidase (EC 1.8.3.4) 0.9956 3 464 GO:0008430
GO:0018549

Map