F466136

General Info

Members Datasets Scaffolds Average Seq Length
582 252 1164 276

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100016154|Ga0070680_1000161545
Length 297
Sequence MSTVAAPTMGRRLRPAVALGLWTVRESLRRRVFIVVGLLTAGFLGLYALGCSVAFSGMNNATQDTSAHVPLRELVGATLGGLGMFAVLFLGCVLAAFLTLSTVRGDAEQGLLQPLVVRPVGRAQVIVVRWAAASVVCVLYVGLVYAAMLIVLDVTGGWTPDHIVGPGFRLALSVAVLAALCVLGSVFMTATANGIAVFMVLGAGLFAGLLGQVGRGIGNSSLKHAANVIAWCLPFESLYQDALAQTTAAQVGISRFLVQLGPFGGGVSGGALLLPYVVAYLAGVGAMTVALAARRDL

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
149 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.14
Rhizosphere 89.35
Stem 0
Stem Tuber 0
Unclassified 3.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100016154 3300005336 Bacteria 5869
2 JGI25406J46586_10040655 3300003203 Bacteria 1646
3 JGI25406J46586_10040919 3300003203 Bacteria 1637
4 JGI25407J50210_10001233 3300003373 Bacteria 5711
5 JGI25407J50210_10017659 3300003373 Bacteria 1853
6 JGI25407J50210_10029251 3300003373 Bacteria 1428
7 Ga0070658_10011680 3300005327 Bacteria 7044
8 Ga0070658_10374622 3300005327 Bacteria 1221
9 Ga0070658_10384111 3300005327 Bacteria 1205
10 Ga0070683_100008018 3300005329 Bacteria 8962
11 Ga0070683_100027928 3300005329 Bacteria 5095
12 Ga0070683_100038034 3300005329 Bacteria 4409
13 Ga0070683_100056161 3300005329 Bacteria 3656
14 Ga0070683_100116339 3300005329 Bacteria 2524
15 Ga0070683_100118404 3300005329 Bacteria 2501
16 Ga0070683_100126719 3300005329 Bacteria 2414
17 Ga0070690_100098875 3300005330 Bacteria 1932
18 Ga0070680_100052035 3300005336 Bacteria 3343
19 Ga0070680_100080516 3300005336 Bacteria 2686
20 Ga0070680_100129294 3300005336 Bacteria 2112
21 Ga0070680_100270840 3300005336 Unclassified 1438
22 Ga0068868_100063433 3300005338 Bacteria 2931
23 Ga0068868_100272731 3300005338 Unclassified 1430
24 Ga0070660_100037061 3300005339 Bacteria 3696
25 Ga0070660_100053195 3300005339 Bacteria 3122
26 Ga0070660_100078561 3300005339 Bacteria 2588
27 Ga0070691_10043813 3300005341 Bacteria 2120
28 Ga0070691_10143602 3300005341 Bacteria 1218
29 Ga0070661_100007123 3300005344 Bacteria 7712
30 Ga0070661_100027116 3300005344 Bacteria 4124
31 Ga0070661_100040274 3300005344 Bacteria 3408
32 Ga0070661_100145894 3300005344 Bacteria 1786
33 Ga0070692_10017845 3300005345 Bacteria 3401
34 Ga0070692_10037227 3300005345 Bacteria 2472
35 Ga0070671_100172636 3300005355 Bacteria 1829
36 Ga0070674_100016122 3300005356 Bacteria 4681
37 Ga0070659_100043999 3300005366 Bacteria 3494
38 Ga0070659_100063890 3300005366 Bacteria 2913
39 Ga0070659_100302319 3300005366 Bacteria 1335
40 Ga0070714_100037786 3300005435 Bacteria 4058
41 Ga0070714_100282435 3300005435 Bacteria 1543
42 Ga0070713_100180257 3300005436 Bacteria 1898
43 Ga0070705_100284461 3300005440 Unclassified 1177
44 Ga0070694_100034592 3300005444 Bacteria 3333
45 Ga0070708_100080520 3300005445 Bacteria 2947
46 Ga0070678_100006097 3300005456 Bacteria 7036
47 Ga0070678_100222412 3300005456 Bacteria 1570
48 Ga0070678_100232696 3300005456 Bacteria 1537
49 Ga0070678_100331178 3300005456 Bacteria 1303
50 Ga0070681_10000028 3300005458 Bacteria 104446
51 Ga0070681_10007661 3300005458 Bacteria 10560
52 Ga0070681_10008977 3300005458 Bacteria 9830
53 Ga0070681_10025369 3300005458 Bacteria 5962
54 Ga0070681_10030842 3300005458 Bacteria 5381
55 Ga0070681_10171421 3300005458 Bacteria 2092
56 Ga0070681_10203690 3300005458 Bacteria 1896
57 Ga0070681_10582992 3300005458 Bacteria 1032
58 Ga0068867_100224125 3300005459 Bacteria 1516
59 Ga0070707_100065245 3300005468 Bacteria 3497
60 Ga0070698_100009434 3300005471 Bacteria 10452
61 Ga0070699_100061547 3300005518 Bacteria 3252
62 Ga0070679_100000092 3300005530 Bacteria 68394
63 Ga0070679_100010518 3300005530 Bacteria 8778
64 Ga0070679_100034720 3300005530 Bacteria 4999
65 Ga0070679_100085820 3300005530 Bacteria 3135
66 Ga0070679_100124935 3300005530 Bacteria 2556
67 Ga0070679_100126520 3300005530 Bacteria 2538
68 Ga0070684_100000697 3300005535 Bacteria 23198
69 Ga0070684_100019943 3300005535 Bacteria 5557
70 Ga0070684_100059431 3300005535 Bacteria 3342
71 Ga0070684_100105914 3300005535 Bacteria 2517
72 Ga0070684_100133881 3300005535 Bacteria 2237
73 Ga0070684_100222176 3300005535 Bacteria 1723
74 Ga0070684_100272755 3300005535 Bacteria 1549
75 Ga0070684_100288533 3300005535 Bacteria 1504
76 Ga0070684_100312518 3300005535 Bacteria 1443
77 Ga0068853_100034382 3300005539 Bacteria 4302
78 Ga0070672_100249467 3300005543 Bacteria 1495
79 Ga0070686_100033434 3300005544 Bacteria 3160
80 Ga0070686_100288176 3300005544 Unclassified 1213
81 Ga0070695_100088917 3300005545 Bacteria 2058
82 Ga0070696_100072876 3300005546 Bacteria 2419
83 Ga0070696_100077639 3300005546 Bacteria 2347
84 Ga0070693_100281067 3300005547 Bacteria 1115
85 Ga0070665_100003484 3300005548 Bacteria 16763
86 Ga0070665_100267247 3300005548 Bacteria 1712
87 Ga0068855_100014350 3300005563 Bacteria 9539
88 Ga0068855_100018060 3300005563 Bacteria 8475
89 Ga0068855_100077474 3300005563 Bacteria 3857
90 Ga0068855_100163281 3300005563 Bacteria 2526
91 Ga0068855_100409011 3300005563 Bacteria 1486
92 Ga0070664_100023660 3300005564 Bacteria 5075
93 Ga0070664_100165149 3300005564 Bacteria 1961
94 Ga0068857_100008743 3300005577 Bacteria 8770
95 Ga0068857_100041977 3300005577 Bacteria 4056
96 Ga0068854_100035562 3300005578 Bacteria 3487
97 Ga0068856_100007244 3300005614 Bacteria 10821
98 Ga0068856_100049256 3300005614 Bacteria 4152
99 Ga0068856_100074113 3300005614 Bacteria 3370
100 Ga0070702_100033840 3300005615 Bacteria 2813
101 Ga0070702_100082242 3300005615 Bacteria 1932
102 Ga0068852_100126006 3300005616 Bacteria 2352
103 Ga0068852_100199283 3300005616 Bacteria 1894
104 Ga0068852_100199959 3300005616 Bacteria 1891
105 Ga0068864_100036351 3300005618 Bacteria 4198
106 Ga0068861_100235188 3300005719 Archaea 1556
107 Ga0068858_100078360 3300005842 Bacteria 3071
108 Ga0068860_100469005 3300005843 Bacteria 1254
109 Ga0081455_10007004 3300005937 Bacteria 11981
110 Ga0081455_10030588 3300005937 Bacteria 4889
111 Ga0081455_10031806 3300005937 Bacteria 4766
112 Ga0081455_10061234 3300005937 Bacteria 3168
113 Ga0081455_10076554 3300005937 Bacteria 2755
114 Ga0081538_10000040 3300005981 Bacteria 118224
115 Ga0081538_10000198 3300005981 Bacteria 66425
116 Ga0081538_10000420 3300005981 Bacteria 47749
117 Ga0081538_10000791 3300005981 Bacteria 34415
118 Ga0081538_10007592 3300005981 Bacteria 9354
119 Ga0081538_10010103 3300005981 Bacteria 7768
120 Ga0081539_10001192 3300005985 Bacteria 46924
121 Ga0081539_10001699 3300005985 Bacteria 35496
122 Ga0070717_10023352 3300006028 Bacteria 4898
123 Ga0070712_100004608 3300006175 Bacteria 8519
124 Ga0075428_100192948 3300006844 Bacteria 2203
125 Ga0075431_100072281 3300006847 Bacteria 3559
126 Ga0075433_10517584 3300006852 Unclassified 1050
127 Ga0075434_100136326 3300006871 Bacteria 2474
128 Ga0075429_100313494 3300006880 Bacteria 1373
129 Ga0068865_100256312 3300006881 Bacteria 1383
130 Ga0068865_100312930 3300006881 Bacteria 1261
131 Ga0075435_100081220 3300007076 Bacteria 2663
132 Ga0075435_100260445 3300007076 Bacteria 1477
133 Ga0111539_10021125 3300009094 Bacteria 8016
134 Ga0111539_10128297 3300009094 Bacteria 2971
135 Ga0105245_10005679 3300009098 Bacteria 10965
136 Ga0105245_10079401 3300009098 Bacteria 2996
137 Ga0105245_10096957 3300009098 Bacteria 2722
138 Ga0105243_10047338 3300009148 Bacteria 3384
139 Ga0105243_10101512 3300009148 Bacteria 2389
140 Ga0105243_10114146 3300009148 Bacteria 2266
141 Ga0105243_10175161 3300009148 Bacteria 1861
142 Ga0105241_10089221 3300009174 Bacteria 2429
143 Ga0105241_10120613 3300009174 Bacteria 2111
144 Ga0105242_10023299 3300009176 Bacteria 4880
145 Ga0105242_10041109 3300009176 Unclassified 3727
146 Ga0105242_10102437 3300009176 Bacteria 2428
147 Ga0105248_10148879 3300009177 Bacteria 2641
148 Ga0105237_10013298 3300009545 Bacteria 8632
149 Ga0105237_10091393 3300009545 Bacteria 3033
150 Ga0105238_10043857 3300009551 Bacteria 4524
151 Ga0105238_10219172 3300009551 Bacteria 1879
152 Ga0105239_10130606 3300010375 Bacteria 2794
153 Ga0105239_10178452 3300010375 Bacteria 2376
154 Ga0105239_10235360 3300010375 Bacteria 2055
155 Ga0105239_10338668 3300010375 Bacteria 1697
156 Ga0105246_10459897 3300011119 Bacteria 1072
157 Ga0157373_10137589 3300013100 Bacteria 1717
158 Ga0157373_10167290 3300013100 Bacteria 1547
159 Ga0157371_10108427 3300013102 Bacteria 1971
160 Ga0157370_10032471 3300013104 Bacteria 5098
161 Ga0157370_10032977 3300013104 Bacteria 5051
162 Ga0157370_10079404 3300013104 Bacteria 3090
163 Ga0157369_10003200 3300013105 Bacteria 19524
164 Ga0157369_10045038 3300013105 Bacteria 4800
165 Ga0157369_10045588 3300013105 Bacteria 4767
166 Ga0157369_10068684 3300013105 Bacteria 3807
167 Ga0157369_10223475 3300013105 Bacteria 1970
168 Ga0157369_10485612 3300013105 Bacteria 1278
169 Ga0157374_10096625 3300013296 Bacteria 2825
170 Ga0157372_10018459 3300013307 Bacteria 7497
171 Ga0157372_10064366 3300013307 Bacteria 4115
172 Ga0157372_10717091 3300013307 Unclassified 1163
173 Ga0157375_10133198 3300013308 Bacteria 2606
174 Ga0157375_10348646 3300013308 Bacteria 1646
175 Ga0182008_10059024 3300014497 Bacteria 1893
176 Ga0157379_10136344 3300014968 Bacteria 2211
177 Ga0197907_11127039 3300020069 Bacteria 2138
178 Ga0206356_10985998 3300020070 Bacteria 1430
179 Ga0206354_10756337 3300020081 Bacteria 2551
180 Ga0206353_10247030 3300020082 Bacteria 2638
181 Ga0206353_11840393 3300020082 Bacteria 1485
182 Ga0207688_10052450 3300025901 Bacteria 2285
183 Ga0207705_10020815 3300025909 Bacteria 4681
184 Ga0207705_10239887 3300025909 Bacteria 1381
185 Ga0207684_10028666 3300025910 Bacteria 4744
186 Ga0207654_10085255 3300025911 Bacteria 1912
187 Ga0207654_10107244 3300025911 Bacteria 1731
188 Ga0207707_10000584 3300025912 Bacteria 37030
189 Ga0207707_10004431 3300025912 Bacteria 12375
190 Ga0207707_10008862 3300025912 Bacteria 8736
191 Ga0207707_10011148 3300025912 Bacteria 7820
192 Ga0207707_10012057 3300025912 Bacteria 7517
193 Ga0207707_10028270 3300025912 Bacteria 4902
194 Ga0207707_10205730 3300025912 Bacteria 1715
195 Ga0207707_10246884 3300025912 Bacteria 1551
196 Ga0207693_10011588 3300025915 Bacteria 7133
197 Ga0207663_10094850 3300025916 Bacteria 1989
198 Ga0207660_10001153 3300025917 Bacteria 17641
199 Ga0207660_10006758 3300025917 Bacteria 7426
200 Ga0207660_10025139 3300025917 Bacteria 4040
201 Ga0207657_10003370 3300025919 Bacteria 17079
202 Ga0207657_10014969 3300025919 Bacteria 7536
203 Ga0207657_10026178 3300025919 Bacteria 5365
204 Ga0207657_10048331 3300025919 Bacteria 3715
205 Ga0207657_10073444 3300025919 Bacteria 2890
206 Ga0207657_10116755 3300025919 Bacteria 2198
207 Ga0207657_10382139 3300025919 Bacteria 1109
208 Ga0207649_10007027 3300025920 Bacteria 6115
209 Ga0207649_10058745 3300025920 Bacteria 2410
210 Ga0207649_10066849 3300025920 Bacteria 2280
211 Ga0207649_10073513 3300025920 Bacteria 2190
212 Ga0207652_10000092 3300025921 Bacteria 98391
213 Ga0207652_10003220 3300025921 Bacteria 13567
214 Ga0207652_10024144 3300025921 Bacteria 5042
215 Ga0207646_10060981 3300025922 Bacteria 3367
216 Ga0207681_10362599 3300025923 Bacteria 1163
217 Ga0207694_10058139 3300025924 Bacteria 3008
218 Ga0207694_10282252 3300025924 Unclassified 1364
219 Ga0207659_10145017 3300025926 Bacteria 1848
220 Ga0207687_10011226 3300025927 Bacteria 5850
221 Ga0207687_10057084 3300025927 Bacteria 2741
222 Ga0207700_10276551 3300025928 Bacteria 1443
223 Ga0207700_10628097 3300025928 Bacteria 957
224 Ga0207664_10032083 3300025929 Bacteria 4024
225 Ga0207644_10101930 3300025931 Bacteria 2158
226 Ga0207644_10298765 3300025931 Unclassified 1297
227 Ga0207690_10004864 3300025932 Bacteria 7924
228 Ga0207690_10021267 3300025932 Bacteria 4021
229 Ga0207690_10052588 3300025932 Bacteria 2729
230 Ga0207690_10423333 3300025932 Bacteria 1066
231 Ga0207706_10150516 3300025933 Bacteria 2046
232 Ga0207706_10273563 3300025933 Bacteria 1474
233 Ga0207686_10062486 3300025934 Bacteria 2365
234 Ga0207686_10413671 3300025934 Unclassified 1030
235 Ga0207709_10100325 3300025935 Bacteria 1912
236 Ga0207709_10107078 3300025935 Bacteria 1861
237 Ga0207669_10103738 3300025937 Bacteria 1887
238 Ga0207669_10151702 3300025937 Bacteria 1624
239 Ga0207704_10088792 3300025938 Bacteria 2024
240 Ga0207704_10232727 3300025938 Bacteria 1371
241 Ga0207711_10281344 3300025941 Unclassified 1532
242 Ga0207689_10013768 3300025942 Bacteria 6893
243 Ga0207661_10002379 3300025944 Bacteria 12948
244 Ga0207661_10042088 3300025944 Bacteria 3600
245 Ga0207661_10051532 3300025944 Bacteria 3284
246 Ga0207661_10059328 3300025944 Bacteria 3083
247 Ga0207661_10077036 3300025944 Bacteria 2741
248 Ga0207661_10200821 3300025944 Bacteria 1753
249 Ga0207661_10235419 3300025944 Bacteria 1623
250 Ga0207679_10122357 3300025945 Bacteria 2074
251 Ga0207679_10318685 3300025945 Bacteria 1345
252 Ga0207667_10031916 3300025949 Bacteria 5681
253 Ga0207667_10098057 3300025949 Bacteria 3024
254 Ga0207667_10137224 3300025949 Bacteria 2518
255 Ga0207712_10100309 3300025961 Bacteria 2151
256 Ga0207668_10021996 3300025972 Bacteria 4075
257 Ga0207677_10052679 3300026023 Bacteria 2766
258 Ga0207677_10248179 3300026023 Unclassified 1444
259 Ga0207703_10017503 3300026035 Bacteria 5593
260 Ga0207678_10068016 3300026067 Bacteria 3057
261 Ga0207708_10010743 3300026075 Bacteria 6807
262 Ga0207702_10003367 3300026078 Bacteria 14651
263 Ga0207702_10060671 3300026078 Bacteria 3224
264 Ga0207702_10070253 3300026078 Bacteria 3012
265 Ga0207648_10041172 3300026089 Bacteria 4058
266 Ga0207648_10244629 3300026089 Unclassified 1598
267 Ga0207648_10326143 3300026089 Bacteria 1380
268 Ga0207676_10026994 3300026095 Bacteria 4273
269 Ga0207674_10014793 3300026116 Bacteria 8606
270 Ga0207674_10047429 3300026116 Bacteria 4404
271 Ga0207674_10106206 3300026116 Bacteria 2786
272 Ga0207674_10125298 3300026116 Bacteria 2535
273 Ga0207674_10599308 3300026116 Bacteria 1064
274 Ga0207675_100212276 3300026118 Bacteria 1862
275 Ga0207683_10011424 3300026121 Bacteria 7578
276 Ga0207698_10018563 3300026142 Bacteria 4742
277 Ga0207698_10143727 3300026142 Bacteria 2059
278 Ga0207698_10308777 3300026142 Bacteria 1476
279 Ga0207428_10055757 3300027907 Bacteria 3141
280 Ga0268266_10019891 3300028379 Bacteria 5721
281 Ga0268266_10123308 3300028379 Bacteria 2308
282 Ga0268265_10139158 3300028380 Bacteria 2030
283 Ga0268264_10432227 3300028381 Bacteria 1272
284 Ga0265319_1022547 3300028563 Bacteria 2293
285 Ga0265318_10051869 3300028577 Bacteria 1540
286 Ga0265338_10198451 3300028800 Bacteria 1515
287 Ga0265320_10035734 3300031240 Bacteria 2517
288 Ga0307408_100062449 3300031548 Bacteria 2722
289 Ga0307405_10191844 3300031731 Bacteria 1476
290 Ga0307413_10012124 3300031824 Bacteria 4276
291 Ga0307406_10038150 3300031901 Bacteria 2972
292 Ga0307407_10010395 3300031903 Bacteria 4388
293 Ga0307409_100061941 3300031995 Bacteria 2926
294 Ga0307409_100158013 3300031995 Bacteria 1979
295 Ga0307416_100041612 3300032002 Bacteria 3580
296 Ga0307416_100117236 3300032002 Bacteria 2363
297 Ga0307415_100434458 3300032126 Bacteria 1130
298 Ga0373937_0110038 3300036401 Bacteria 2562
299 Ga0395899_0003167 3300037312 Bacteria 13055
300 Ga0395899_0007782 3300037312 Bacteria 8265
301 Ga0395899_0067172 3300037312 Bacteria 2631
302 Ga0395900_0002183 3300037418 Bacteria 21862
303 Ga0395900_0004812 3300037418 Bacteria 14226
304 Ga0395900_0262203 3300037418 Bacteria 1725
305 Ga0395900_0562882 3300037418 Unclassified 1083
306 Ga0395898_0002275 3300037466 Bacteria 23195
307 Ga0395898_0008244 3300037466 Bacteria 11016
308 Ga0395898_0048679 3300037466 Bacteria 4155
309 Ga0395898_0069980 3300037466 Bacteria 3394
310 Ga0395898_0431349 3300037466 Bacteria 1256
311 Ga0395905_0004089 3300037471 Bacteria 15281
312 Ga0395905_0038457 3300037471 Bacteria 4490
313 Ga0395905_0052088 3300037471 Bacteria 3833
314 Ga0395905_0138295 3300037471 Bacteria 2292
315 Ga0436364_0017677 3300037853 Bacteria 2107
316 Ga0395901_0002719 3300038443 Bacteria 17817
317 Ga0395901_0009600 3300038443 Bacteria 9815
318 Ga0395901_0017150 3300038443 Bacteria 7386
319 Ga0395901_0050242 3300038443 Bacteria 4333
320 Ga0395901_0114861 3300038443 Bacteria 2828
321 Ga0395901_0340499 3300038443 Bacteria 1549
322 Ga0395901_0367891 3300038443 Bacteria 1481
323 Ga0395901_0733655 3300038443 Bacteria 982
324 Ga0436363_0683500 3300039450 Bacteria 1784
325 Ga0451833_0714431 3300041491 Bacteria 1199
326 Ga0450920_036566 3300042122 Bacteria 974
327 Ga0466966_0014258 3300044684 Bacteria 5263
328 Ga0466961_0025694 3300044693 Bacteria 3786
329 Ga0466961_0028556 3300044693 Bacteria 3587
330 Ga0466961_0081392 3300044693 Bacteria 2049
331 Ga0466961_0209166 3300044693 Unclassified 1205
332 Ga0466963_0000247 3300044694 Bacteria 23573
333 Ga0466963_0017451 3300044694 Bacteria 4475
334 Ga0466963_0034819 3300044694 Bacteria 3278
335 Ga0466963_0070249 3300044694 Bacteria 2355
336 Ga0466963_0314971 3300044694 Bacteria 1101
337 Ga0466964_0109982 3300044706 Bacteria 1227
338 Ga0466957_0206036 3300044842 Bacteria 1293
339 Ga0466957_0342529 3300044842 Bacteria 1013
340 Ga0466960_0159019 3300044901 Bacteria 1212
341 Ga0466959_0026653 3300045049 Bacteria 4284
342 Ga0466959_0106589 3300045049 Bacteria 2004
343 Ga0451576_0267969 3300045051 Bacteria 1785
344 Ga0466958_0003549 3300045836 Bacteria 8114
345 Ga0466967_0001788 3300045976 Bacteria 12878
346 Ga0466967_0019689 3300045976 Bacteria 5434
347 Ga0466967_0023856 3300045976 Bacteria 5020
348 Ga0466967_0044040 3300045976 Bacteria 3868
349 Ga0466967_0086246 3300045976 Bacteria 2844
350 Ga0466967_0364206 3300045976 Bacteria 1401
351 Ga0466967_0774447 3300045976 Bacteria 952
352 Ga0495592_0017643 3300046454 Bacteria 5424
353 Ga0495641_0012380 3300046461 Bacteria 4777
354 Ga0495651_0004887 3300046462 Bacteria 10251
355 Ga0495653_0010741 3300046463 Bacteria 7498
356 Ga0495664_0112818 3300046477 Bacteria 1641
357 Ga0495664_0225816 3300046477 Bacteria 1133
358 Ga0495583_0085025 3300046506 Bacteria 1370
359 Ga0495608_0019149 3300046511 Bacteria 4717
360 Ga0495618_0018512 3300046514 Bacteria 4276
361 Ga0495618_0115902 3300046514 Bacteria 1715
362 Ga0495628_0000061 3300046516 Bacteria 86531
363 Ga0495628_0033136 3300046516 Bacteria 4165
364 Ga0495628_0073094 3300046516 Bacteria 2672
365 Ga0495628_0324401 3300046516 Unclassified 1136
366 Ga0495631_0075661 3300046518 Unclassified 1453
367 Ga0495666_0047579 3300046526 Bacteria 2066
368 Ga0495652_0040662 3300046529 Bacteria 4018
369 Ga0495652_0051693 3300046529 Bacteria 3508
370 Ga0495640_0001520 3300046533 Bacteria 18268
371 Ga0495587_0068208 3300046536 Bacteria 2072
372 Ga0495609_0155047 3300046538 Bacteria 973
373 Ga0495621_0131616 3300046539 Bacteria 974
374 Ga0495645_0121605 3300046543 Bacteria 1837
375 Ga0495645_0177677 3300046543 Bacteria 1461
376 Ga0495656_0055466 3300046615 Bacteria 1709
377 Ga0495634_0047781 3300046642 Bacteria 2883
378 Ga0495634_0097724 3300046642 Bacteria 1900
379 Ga0495635_0154326 3300046663 Bacteria 1563
380 Ga0495599_0059381 3300046678 Bacteria 2392
381 Ga0495647_0043591 3300046681 Bacteria 1717
382 Ga0495647_0116477 3300046681 Bacteria 1120
383 Ga0495658_0195779 3300046683 Bacteria 1258
384 Ga0495613_0057044 3300046689 Bacteria 2867
385 Ga0495604_0087982 3300047317 Bacteria 2312
386 Ga0495604_0157040 3300047317 Bacteria 1610
387 Ga0495674_0007533 3300047319 Bacteria 10396
388 Ga0495674_0108168 3300047319 Bacteria 2359
389 Ga0495680_0003583 3300047322 Bacteria 15204
390 Ga0495675_0112794 3300047444 Bacteria 1696
391 Ga0495684_0055128 3300047471 Bacteria 3032
392 Ga0495684_0286922 3300047471 Bacteria 1186
393 Ga0495602_0002656 3300048088 Bacteria 18275
394 Ga0495602_0050547 3300048088 Bacteria 3713
395 Ga0495602_0293805 3300048088 Bacteria 1192
396 Ga0495602_0403652 3300048088 Bacteria 974
397 Ga0496100_0008880 3300048903 Bacteria 5623
398 Ga0496100_0077182 3300048903 Bacteria 2239
399 Ga0496100_0101190 3300048903 Bacteria 1986
400 Ga0496100_0108952 3300048903 Bacteria 1921
401 Ga0496100_0183740 3300048903 Bacteria 1513
402 Ga0496101_0004538 3300048904 Bacteria 8767
403 Ga0496101_0008537 3300048904 Bacteria 6696
404 Ga0496101_0008544 3300048904 Bacteria 6691
405 Ga0496101_0277787 3300048904 Bacteria 1308
406 Ga0496101_0312875 3300048904 Bacteria 1231
407 Ga0496102_0001674 3300048905 Bacteria 19466
408 Ga0496102_0004302 3300048905 Bacteria 12037
409 Ga0496102_0024250 3300048905 Bacteria 5392
410 Ga0496103_0002939 3300048906 Bacteria 10557
411 Ga0496103_0036541 3300048906 Bacteria 3008
412 Ga0496103_0058116 3300048906 Bacteria 2403
413 Ga0496104_0005990 3300048907 Bacteria 10653
414 Ga0496104_0043066 3300048907 Bacteria 4239
415 Ga0496104_0466654 3300048907 Bacteria 1174
416 Ga0496105_0001400 3300048908 Bacteria 16942
417 Ga0496105_0009591 3300048908 Bacteria 7576
418 Ga0496106_0003750 3300048909 Bacteria 11334
419 Ga0496106_0040919 3300048909 Bacteria 3472
420 Ga0496106_0047886 3300048909 Bacteria 3218
421 Ga0496107_0004559 3300048910 Bacteria 9386
422 Ga0496107_0053530 3300048910 Bacteria 2911
423 Ga0496107_0087280 3300048910 Bacteria 2277
424 Ga0496107_0128440 3300048910 Bacteria 1870
425 Ga0496108_0025237 3300048911 Bacteria 4897
426 Ga0496108_0025607 3300048911 Bacteria 4863
427 Ga0496108_0136484 3300048911 Bacteria 2111
428 Ga0496108_0491145 3300048911 Unclassified 1072
429 Ga0496109_0001493 3300048912 Bacteria 19441
430 Ga0496109_0001613 3300048912 Bacteria 18839
431 Ga0496109_0013104 3300048912 Bacteria 7173
432 Ga0496109_0093712 3300048912 Bacteria 2779
433 Ga0496109_0620131 3300048912 Unclassified 1018
434 Ga0496109_0681197 3300048912 Bacteria 965
435 Ga0496110_0007734 3300048913 Bacteria 8603
436 Ga0496110_0024457 3300048913 Bacteria 5147
437 Ga0496110_0079457 3300048913 Bacteria 2920
438 Ga0496110_0110228 3300048913 Bacteria 2473
439 Ga0496110_0116314 3300048913 Bacteria 2407
440 Ga0496110_0196106 3300048913 Bacteria 1834
441 Ga0496110_0374586 3300048913 Bacteria 1297
442 Ga0496111_0001925 3300048914 Bacteria 12275
443 Ga0496111_0024373 3300048914 Bacteria 4259
444 Ga0496111_0034962 3300048914 Bacteria 3589
445 Ga0496111_0113638 3300048914 Bacteria 1995
446 Ga0496112_0002136 3300048915 Bacteria 15694
447 Ga0496112_0016767 3300048915 Bacteria 6870
448 Ga0496112_0109477 3300048915 Bacteria 2733
449 Ga0496112_0402180 3300048915 Bacteria 1309
450 Ga0496113_0041658 3300048916 Bacteria 3390
451 Ga0496113_0125173 3300048916 Bacteria 2012
452 Ga0496114_0002146 3300048917 Bacteria 14999
453 Ga0496114_0017395 3300048917 Bacteria 5802
454 Ga0496114_0073919 3300048917 Bacteria 2869
455 Ga0496115_0041450 3300048918 Bacteria 3665
456 Ga0501031_0000169 3300049568 Bacteria 37021
457 Ga0501031_0036347 3300049568 Bacteria 3212
458 Ga0501031_0157499 3300049568 Bacteria 1484
459 Ga0501032_0009928 3300049569 Bacteria 6874
460 Ga0501032_0014219 3300049569 Bacteria 5637
461 Ga0501032_0049936 3300049569 Bacteria 2821
462 Ga0501032_0211453 3300049569 Bacteria 1264
463 Ga0501033_0000134 3300049570 Bacteria 71995
464 Ga0501033_0039090 3300049570 Bacteria 3544
465 Ga0501033_0047191 3300049570 Bacteria 3202
466 Ga0501033_0183080 3300049570 Bacteria 1501
467 Ga0501034_0088816 3300049571 Bacteria 3088
468 Ga0501034_0437773 3300049571 Bacteria 1226
469 Ga0501036_0000103 3300049572 Bacteria 53573
470 Ga0501036_0006769 3300049572 Bacteria 9310
471 Ga0501036_0059966 3300049572 Bacteria 3223
472 Ga0501037_0000202 3300049573 Bacteria 53677
473 Ga0501037_0031478 3300049573 Bacteria 3916
474 Ga0501037_0300818 3300049573 Bacteria 1114
475 Ga0501038_0000810 3300049574 Bacteria 27751
476 Ga0501038_0055468 3300049574 Bacteria 3404
477 Ga0501038_0091326 3300049574 Bacteria 2551
478 Ga0501038_0104131 3300049574 Bacteria 2358
479 Ga0501039_0003119 3300049575 Bacteria 12396
480 Ga0501039_0050997 3300049575 Bacteria 3202
481 Ga0501039_0180852 3300049575 Bacteria 1658
482 Ga0501040_0002176 3300049576 Bacteria 12638
483 Ga0501040_0035499 3300049576 Bacteria 3381
484 Ga0501040_0266584 3300049576 Bacteria 1222
485 Ga0501041_0001639 3300049577 Bacteria 12510
486 Ga0501041_0027753 3300049577 Bacteria 3412
487 Ga0501041_0083815 3300049577 Bacteria 1965
488 Ga0501042_0011088 3300049578 Bacteria 6070
489 Ga0501042_0035196 3300049578 Bacteria 3552
490 Ga0501042_0054263 3300049578 Bacteria 2858
491 Ga0501043_0000118 3300049579 Bacteria 73474
492 Ga0501043_0079327 3300049579 Bacteria 2579
493 Ga0501043_0258027 3300049579 Bacteria 1341
494 Ga0501046_0067442 3300049580 Bacteria 2786
495 Ga0501046_0077016 3300049580 Bacteria 2582
496 Ga0501047_0005188 3300049581 Bacteria 12227
497 Ga0501047_0057220 3300049581 Bacteria 3770
498 Ga0501047_0168673 3300049581 Bacteria 2058
499 Ga0501048_0036161 3300049582 Bacteria 3550
500 Ga0501048_0063676 3300049582 Bacteria 2607
501 Ga0501048_0073649 3300049582 Bacteria 2410
502 Ga0501067_0000248 3300049583 Bacteria 29669
503 Ga0501067_0000503 3300049583 Bacteria 21490
504 Ga0501067_0014472 3300049583 Bacteria 4367
505 Ga0501067_0022198 3300049583 Bacteria 3512
506 Ga0501067_0113271 3300049583 Bacteria 1508
507 Ga0501068_0007203 3300049584 Bacteria 6159
508 Ga0501068_0045140 3300049584 Bacteria 2654
509 Ga0501068_0334124 3300049584 Bacteria 972
510 Ga0501069_0001020 3300049585 Bacteria 13356
511 Ga0501069_0007812 3300049585 Bacteria 5616
512 Ga0501069_0011733 3300049585 Bacteria 4646
513 Ga0501069_0024869 3300049585 Bacteria 3269
514 Ga0501069_0036600 3300049585 Bacteria 2707
515 Ga0501069_0038712 3300049585 Bacteria 2632
516 Ga0501070_0022338 3300049586 Bacteria 5300
517 Ga0501070_0043221 3300049586 Bacteria 3750
518 Ga0501071_0010009 3300049587 Bacteria 6337
519 Ga0501071_0014713 3300049587 Bacteria 5354
520 Ga0501071_0053278 3300049587 Bacteria 2918
521 Ga0501072_0022448 3300049588 Bacteria 4895
522 Ga0501072_0050154 3300049588 Bacteria 3286
523 Ga0501073_0008338 3300049589 Bacteria 7687
524 Ga0501074_0006791 3300049590 Bacteria 8261
525 Ga0501074_0018310 3300049590 Bacteria 5087
526 Ga0501074_0039775 3300049590 Bacteria 3405
527 Ga0501075_0012341 3300049591 Bacteria 6070
528 Ga0501075_0037369 3300049591 Bacteria 3627
529 Ga0501076_0020067 3300049592 Bacteria 5112
530 Ga0501076_0053391 3300049592 Bacteria 3202
531 Ga0501076_0358729 3300049592 Bacteria 1197
532 Ga0501077_0001086 3300049593 Bacteria 16403
533 Ga0501077_0230841 3300049593 Bacteria 1176
534 Ga0501079_0020017 3300049741 Bacteria 5112
535 Ga0501079_0022530 3300049741 Bacteria 4831
536 Ga0501079_0038561 3300049741 Bacteria 3684
537 Ga0501079_0362103 3300049741 Bacteria 1137
538 Ga0501080_0009566 3300049742 Bacteria 8848
539 Ga0501080_0015723 3300049742 Bacteria 6979
540 Ga0501080_0029170 3300049742 Bacteria 5136
541 Ga0501080_0115680 3300049742 Bacteria 2486
542 Ga0501081_0009509 3300049743 Bacteria 6337
543 Ga0501081_0032263 3300049743 Bacteria 3552
544 Ga0501083_0011537 3300049744 Bacteria 6198
545 Ga0501083_0031197 3300049744 Bacteria 3657
546 Ga0501035_0003300 3300049822 Bacteria 15468
547 Ga0501035_0076476 3300049822 Bacteria 2960
548 Ga0501035_0109731 3300049822 Bacteria 2418
549 Ga0501044_0075691 3300049823 Bacteria 3417
550 Ga0501044_0119924 3300049823 Bacteria 2632
551 Ga0501045_0000049 3300049824 Bacteria 51937
552 Ga0501045_0002638 3300049824 Bacteria 12219
553 Ga0501045_0123503 3300049824 Bacteria 1922
554 nmdc:mga05p37_401998_c1 3300050507 Bacteria 1599
555 nmdc:mga09592_303239_c1 3300050508 Bacteria 1385
556 nmdc:mga06r32_249812_c1 3300050510 Bacteria 1761
557 nmdc:mga08y16_166235_c1 3300050511 Bacteria 2292
558 nmdc:mga08y16_9935_c1 3300050511 Bacteria 9988
559 nmdc:mga0n895_239643_c1 3300050512 Bacteria 1840
560 nmdc:mga0rr50_628712_c1 3300050513 Bacteria 916
561 nmdc:mga0a205_480999_c1 3300050515 Unclassified 1100
562 nmdc:mga0a205_584763_c1 3300050515 Unclassified 970
563 Ga0495601_0073808 3300053077 Bacteria 2182
564 Ga0495601_0200449 3300053077 Bacteria 1304
565 Ga0495612_0015791 3300053078 Bacteria 3027
566 Ga0501084_0016113 3300054114 Bacteria 6204
567 Ga0501084_0018435 3300054114 Bacteria 5809
568 Ga0501084_0034891 3300054114 Bacteria 4207
569 Ga0501084_0134090 3300054114 Bacteria 2084
570 Ga0501084_0147641 3300054114 Bacteria 1981
571 Ga0590077_023101 3300059426 Bacteria 1329
572 Ga0501082_0002432 3300060353 Bacteria 16346
573 Ga0501082_0024204 3300060353 Bacteria 5236
574 Ga0501082_0047943 3300060353 Bacteria 3682
575 Ga0501082_0099029 3300060353 Bacteria 2520
576 Ga0501082_0168917 3300060353 Bacteria 1901
577 Ga0466962_0012454 3300061719 Bacteria 4088
578 Ga0530510_0000049 3300061734 Bacteria 55964
579 Ga0530510_0024938 3300061734 Bacteria 4273
580 Ga0530510_0030674 3300061734 Bacteria 3863
581 Ga0530510_0144864 3300061734 Bacteria 1752
582 Ga0530510_0357505 3300061734 Unclassified 1097
583 Ga0070680_100016154
584 JGI25406J46586_10040655
585 JGI25406J46586_10040919
586 JGI25407J50210_10001233
587 JGI25407J50210_10017659
588 JGI25407J50210_10029251
589 Ga0070658_10011680
590 Ga0070658_10374622
591 Ga0070658_10384111
592 Ga0070683_100008018
593 Ga0070683_100027928
594 Ga0070683_100038034
595 Ga0070683_100056161
596 Ga0070683_100116339
597 Ga0070683_100118404
598 Ga0070683_100126719
599 Ga0070690_100098875
600 Ga0070680_100052035
601 Ga0070680_100080516
602 Ga0070680_100129294
603 Ga0070680_100270840
604 Ga0068868_100063433
605 Ga0068868_100272731
606 Ga0070660_100037061
607 Ga0070660_100053195
608 Ga0070660_100078561
609 Ga0070691_10043813
610 Ga0070691_10143602
611 Ga0070661_100007123
612 Ga0070661_100027116
613 Ga0070661_100040274
614 Ga0070661_100145894
615 Ga0070692_10017845
616 Ga0070692_10037227
617 Ga0070671_100172636
618 Ga0070674_100016122
619 Ga0070659_100043999
620 Ga0070659_100063890
621 Ga0070659_100302319
622 Ga0070714_100037786
623 Ga0070714_100282435
624 Ga0070713_100180257
625 Ga0070705_100284461
626 Ga0070694_100034592
627 Ga0070708_100080520
628 Ga0070678_100006097
629 Ga0070678_100222412
630 Ga0070678_100232696
631 Ga0070678_100331178
632 Ga0070681_10000028
633 Ga0070681_10007661
634 Ga0070681_10008977
635 Ga0070681_10025369
636 Ga0070681_10030842
637 Ga0070681_10171421
638 Ga0070681_10203690
639 Ga0070681_10582992
640 Ga0068867_100224125
641 Ga0070707_100065245
642 Ga0070698_100009434
643 Ga0070699_100061547
644 Ga0070679_100000092
645 Ga0070679_100010518
646 Ga0070679_100034720
647 Ga0070679_100085820
648 Ga0070679_100124935
649 Ga0070679_100126520
650 Ga0070684_100000697
651 Ga0070684_100019943
652 Ga0070684_100059431
653 Ga0070684_100105914
654 Ga0070684_100133881
655 Ga0070684_100222176
656 Ga0070684_100272755
657 Ga0070684_100288533
658 Ga0070684_100312518
659 Ga0068853_100034382
660 Ga0070672_100249467
661 Ga0070686_100033434
662 Ga0070686_100288176
663 Ga0070695_100088917
664 Ga0070696_100072876
665 Ga0070696_100077639
666 Ga0070693_100281067
667 Ga0070665_100003484
668 Ga0070665_100267247
669 Ga0068855_100014350
670 Ga0068855_100018060
671 Ga0068855_100077474
672 Ga0068855_100163281
673 Ga0068855_100409011
674 Ga0070664_100023660
675 Ga0070664_100165149
676 Ga0068857_100008743
677 Ga0068857_100041977
678 Ga0068854_100035562
679 Ga0068856_100007244
680 Ga0068856_100049256
681 Ga0068856_100074113
682 Ga0070702_100033840
683 Ga0070702_100082242
684 Ga0068852_100126006
685 Ga0068852_100199283
686 Ga0068852_100199959
687 Ga0068864_100036351
688 Ga0068861_100235188
689 Ga0068858_100078360
690 Ga0068860_100469005
691 Ga0081455_10007004
692 Ga0081455_10030588
693 Ga0081455_10031806
694 Ga0081455_10061234
695 Ga0081455_10076554
696 Ga0081538_10000040
697 Ga0081538_10000198
698 Ga0081538_10000420
699 Ga0081538_10000791
700 Ga0081538_10007592
701 Ga0081538_10010103
702 Ga0081539_10001192
703 Ga0081539_10001699
704 Ga0070717_10023352
705 Ga0070712_100004608
706 Ga0075428_100192948
707 Ga0075431_100072281
708 Ga0075433_10517584
709 Ga0075434_100136326
710 Ga0075429_100313494
711 Ga0068865_100256312
712 Ga0068865_100312930
713 Ga0075435_100081220
714 Ga0075435_100260445
715 Ga0111539_10021125
716 Ga0111539_10128297
717 Ga0105245_10005679
718 Ga0105245_10079401
719 Ga0105245_10096957
720 Ga0105243_10047338
721 Ga0105243_10101512
722 Ga0105243_10114146
723 Ga0105243_10175161
724 Ga0105241_10089221
725 Ga0105241_10120613
726 Ga0105242_10023299
727 Ga0105242_10041109
728 Ga0105242_10102437
729 Ga0105248_10148879
730 Ga0105237_10013298
731 Ga0105237_10091393
732 Ga0105238_10043857
733 Ga0105238_10219172
734 Ga0105239_10130606
735 Ga0105239_10178452
736 Ga0105239_10235360
737 Ga0105239_10338668
738 Ga0105246_10459897
739 Ga0157373_10137589
740 Ga0157373_10167290
741 Ga0157371_10108427
742 Ga0157370_10032471
743 Ga0157370_10032977
744 Ga0157370_10079404
745 Ga0157369_10003200
746 Ga0157369_10045038
747 Ga0157369_10045588
748 Ga0157369_10068684
749 Ga0157369_10223475
750 Ga0157369_10485612
751 Ga0157374_10096625
752 Ga0157372_10018459
753 Ga0157372_10064366
754 Ga0157372_10717091
755 Ga0157375_10133198
756 Ga0157375_10348646
757 Ga0182008_10059024
758 Ga0157379_10136344
759 Ga0197907_11127039
760 Ga0206356_10985998
761 Ga0206354_10756337
762 Ga0206353_10247030
763 Ga0206353_11840393
764 Ga0207688_10052450
765 Ga0207705_10020815
766 Ga0207705_10239887
767 Ga0207684_10028666
768 Ga0207654_10085255
769 Ga0207654_10107244
770 Ga0207707_10000584
771 Ga0207707_10004431
772 Ga0207707_10008862
773 Ga0207707_10011148
774 Ga0207707_10012057
775 Ga0207707_10028270
776 Ga0207707_10205730
777 Ga0207707_10246884
778 Ga0207693_10011588
779 Ga0207663_10094850
780 Ga0207660_10001153
781 Ga0207660_10006758
782 Ga0207660_10025139
783 Ga0207657_10003370
784 Ga0207657_10014969
785 Ga0207657_10026178
786 Ga0207657_10048331
787 Ga0207657_10073444
788 Ga0207657_10116755
789 Ga0207657_10382139
790 Ga0207649_10007027
791 Ga0207649_10058745
792 Ga0207649_10066849
793 Ga0207649_10073513
794 Ga0207652_10000092
795 Ga0207652_10003220
796 Ga0207652_10024144
797 Ga0207646_10060981
798 Ga0207681_10362599
799 Ga0207694_10058139
800 Ga0207694_10282252
801 Ga0207659_10145017
802 Ga0207687_10011226
803 Ga0207687_10057084
804 Ga0207700_10276551
805 Ga0207700_10628097
806 Ga0207664_10032083
807 Ga0207644_10101930
808 Ga0207644_10298765
809 Ga0207690_10004864
810 Ga0207690_10021267
811 Ga0207690_10052588
812 Ga0207690_10423333
813 Ga0207706_10150516
814 Ga0207706_10273563
815 Ga0207686_10062486
816 Ga0207686_10413671
817 Ga0207709_10100325
818 Ga0207709_10107078
819 Ga0207669_10103738
820 Ga0207669_10151702
821 Ga0207704_10088792
822 Ga0207704_10232727
823 Ga0207711_10281344
824 Ga0207689_10013768
825 Ga0207661_10002379
826 Ga0207661_10042088
827 Ga0207661_10051532
828 Ga0207661_10059328
829 Ga0207661_10077036
830 Ga0207661_10200821
831 Ga0207661_10235419
832 Ga0207679_10122357
833 Ga0207679_10318685
834 Ga0207667_10031916
835 Ga0207667_10098057
836 Ga0207667_10137224
837 Ga0207712_10100309
838 Ga0207668_10021996
839 Ga0207677_10052679
840 Ga0207677_10248179
841 Ga0207703_10017503
842 Ga0207678_10068016
843 Ga0207708_10010743
844 Ga0207702_10003367
845 Ga0207702_10060671
846 Ga0207702_10070253
847 Ga0207648_10041172
848 Ga0207648_10244629
849 Ga0207648_10326143
850 Ga0207676_10026994
851 Ga0207674_10014793
852 Ga0207674_10047429
853 Ga0207674_10106206
854 Ga0207674_10125298
855 Ga0207674_10599308
856 Ga0207675_100212276
857 Ga0207683_10011424
858 Ga0207698_10018563
859 Ga0207698_10143727
860 Ga0207698_10308777
861 Ga0207428_10055757
862 Ga0268266_10019891
863 Ga0268266_10123308
864 Ga0268265_10139158
865 Ga0268264_10432227
866 Ga0265319_1022547
867 Ga0265318_10051869
868 Ga0265338_10198451
869 Ga0265320_10035734
870 Ga0307408_100062449
871 Ga0307405_10191844
872 Ga0307413_10012124
873 Ga0307406_10038150
874 Ga0307407_10010395
875 Ga0307409_100061941
876 Ga0307409_100158013
877 Ga0307416_100041612
878 Ga0307416_100117236
879 Ga0307415_100434458
880 Ga0373937_0110038
881 Ga0395899_0003167
882 Ga0395899_0007782
883 Ga0395899_0067172
884 Ga0395900_0002183
885 Ga0395900_0004812
886 Ga0395900_0262203
887 Ga0395900_0562882
888 Ga0395898_0002275
889 Ga0395898_0008244
890 Ga0395898_0048679
891 Ga0395898_0069980
892 Ga0395898_0431349
893 Ga0395905_0004089
894 Ga0395905_0038457
895 Ga0395905_0052088
896 Ga0395905_0138295
897 Ga0436364_0017677
898 Ga0395901_0002719
899 Ga0395901_0009600
900 Ga0395901_0017150
901 Ga0395901_0050242
902 Ga0395901_0114861
903 Ga0395901_0340499
904 Ga0395901_0367891
905 Ga0395901_0733655
906 Ga0436363_0683500
907 Ga0451833_0714431
908 Ga0450920_036566
909 Ga0466966_0014258
910 Ga0466961_0025694
911 Ga0466961_0028556
912 Ga0466961_0081392
913 Ga0466961_0209166
914 Ga0466963_0000247
915 Ga0466963_0017451
916 Ga0466963_0034819
917 Ga0466963_0070249
918 Ga0466963_0314971
919 Ga0466964_0109982
920 Ga0466957_0206036
921 Ga0466957_0342529
922 Ga0466960_0159019
923 Ga0466959_0026653
924 Ga0466959_0106589
925 Ga0451576_0267969
926 Ga0466958_0003549
927 Ga0466967_0001788
928 Ga0466967_0019689
929 Ga0466967_0023856
930 Ga0466967_0044040
931 Ga0466967_0086246
932 Ga0466967_0364206
933 Ga0466967_0774447
934 Ga0495592_0017643
935 Ga0495641_0012380
936 Ga0495651_0004887
937 Ga0495653_0010741
938 Ga0495664_0112818
939 Ga0495664_0225816
940 Ga0495583_0085025
941 Ga0495608_0019149
942 Ga0495618_0018512
943 Ga0495618_0115902
944 Ga0495628_0000061
945 Ga0495628_0033136
946 Ga0495628_0073094
947 Ga0495628_0324401
948 Ga0495631_0075661
949 Ga0495666_0047579
950 Ga0495652_0040662
951 Ga0495652_0051693
952 Ga0495640_0001520
953 Ga0495587_0068208
954 Ga0495609_0155047
955 Ga0495621_0131616
956 Ga0495645_0121605
957 Ga0495645_0177677
958 Ga0495656_0055466
959 Ga0495634_0047781
960 Ga0495634_0097724
961 Ga0495635_0154326
962 Ga0495599_0059381
963 Ga0495647_0043591
964 Ga0495647_0116477
965 Ga0495658_0195779
966 Ga0495613_0057044
967 Ga0495604_0087982
968 Ga0495604_0157040
969 Ga0495674_0007533
970 Ga0495674_0108168
971 Ga0495680_0003583
972 Ga0495675_0112794
973 Ga0495684_0055128
974 Ga0495684_0286922
975 Ga0495602_0002656
976 Ga0495602_0050547
977 Ga0495602_0293805
978 Ga0495602_0403652
979 Ga0496100_0008880
980 Ga0496100_0077182
981 Ga0496100_0101190
982 Ga0496100_0108952
983 Ga0496100_0183740
984 Ga0496101_0004538
985 Ga0496101_0008537
986 Ga0496101_0008544
987 Ga0496101_0277787
988 Ga0496101_0312875
989 Ga0496102_0001674
990 Ga0496102_0004302
991 Ga0496102_0024250
992 Ga0496103_0002939
993 Ga0496103_0036541
994 Ga0496103_0058116
995 Ga0496104_0005990
996 Ga0496104_0043066
997 Ga0496104_0466654
998 Ga0496105_0001400
999 Ga0496105_0009591
1000 Ga0496106_0003750
1001 Ga0496106_0040919
1002 Ga0496106_0047886
1003 Ga0496107_0004559
1004 Ga0496107_0053530
1005 Ga0496107_0087280
1006 Ga0496107_0128440
1007 Ga0496108_0025237
1008 Ga0496108_0025607
1009 Ga0496108_0136484
1010 Ga0496108_0491145
1011 Ga0496109_0001493
1012 Ga0496109_0001613
1013 Ga0496109_0013104
1014 Ga0496109_0093712
1015 Ga0496109_0620131
1016 Ga0496109_0681197
1017 Ga0496110_0007734
1018 Ga0496110_0024457
1019 Ga0496110_0079457
1020 Ga0496110_0110228
1021 Ga0496110_0116314
1022 Ga0496110_0196106
1023 Ga0496110_0374586
1024 Ga0496111_0001925
1025 Ga0496111_0024373
1026 Ga0496111_0034962
1027 Ga0496111_0113638
1028 Ga0496112_0002136
1029 Ga0496112_0016767
1030 Ga0496112_0109477
1031 Ga0496112_0402180
1032 Ga0496113_0041658
1033 Ga0496113_0125173
1034 Ga0496114_0002146
1035 Ga0496114_0017395
1036 Ga0496114_0073919
1037 Ga0496115_0041450
1038 Ga0501031_0000169
1039 Ga0501031_0036347
1040 Ga0501031_0157499
1041 Ga0501032_0009928
1042 Ga0501032_0014219
1043 Ga0501032_0049936
1044 Ga0501032_0211453
1045 Ga0501033_0000134
1046 Ga0501033_0039090
1047 Ga0501033_0047191
1048 Ga0501033_0183080
1049 Ga0501034_0088816
1050 Ga0501034_0437773
1051 Ga0501036_0000103
1052 Ga0501036_0006769
1053 Ga0501036_0059966
1054 Ga0501037_0000202
1055 Ga0501037_0031478
1056 Ga0501037_0300818
1057 Ga0501038_0000810
1058 Ga0501038_0055468
1059 Ga0501038_0091326
1060 Ga0501038_0104131
1061 Ga0501039_0003119
1062 Ga0501039_0050997
1063 Ga0501039_0180852
1064 Ga0501040_0002176
1065 Ga0501040_0035499
1066 Ga0501040_0266584
1067 Ga0501041_0001639
1068 Ga0501041_0027753
1069 Ga0501041_0083815
1070 Ga0501042_0011088
1071 Ga0501042_0035196
1072 Ga0501042_0054263
1073 Ga0501043_0000118
1074 Ga0501043_0079327
1075 Ga0501043_0258027
1076 Ga0501046_0067442
1077 Ga0501046_0077016
1078 Ga0501047_0005188
1079 Ga0501047_0057220
1080 Ga0501047_0168673
1081 Ga0501048_0036161
1082 Ga0501048_0063676
1083 Ga0501048_0073649
1084 Ga0501067_0000248
1085 Ga0501067_0000503
1086 Ga0501067_0014472
1087 Ga0501067_0022198
1088 Ga0501067_0113271
1089 Ga0501068_0007203
1090 Ga0501068_0045140
1091 Ga0501068_0334124
1092 Ga0501069_0001020
1093 Ga0501069_0007812
1094 Ga0501069_0011733
1095 Ga0501069_0024869
1096 Ga0501069_0036600
1097 Ga0501069_0038712
1098 Ga0501070_0022338
1099 Ga0501070_0043221
1100 Ga0501071_0010009
1101 Ga0501071_0014713
1102 Ga0501071_0053278
1103 Ga0501072_0022448
1104 Ga0501072_0050154
1105 Ga0501073_0008338
1106 Ga0501074_0006791
1107 Ga0501074_0018310
1108 Ga0501074_0039775
1109 Ga0501075_0012341
1110 Ga0501075_0037369
1111 Ga0501076_0020067
1112 Ga0501076_0053391
1113 Ga0501076_0358729
1114 Ga0501077_0001086
1115 Ga0501077_0230841
1116 Ga0501079_0020017
1117 Ga0501079_0022530
1118 Ga0501079_0038561
1119 Ga0501079_0362103
1120 Ga0501080_0009566
1121 Ga0501080_0015723
1122 Ga0501080_0029170
1123 Ga0501080_0115680
1124 Ga0501081_0009509
1125 Ga0501081_0032263
1126 Ga0501083_0011537
1127 Ga0501083_0031197
1128 Ga0501035_0003300
1129 Ga0501035_0076476
1130 Ga0501035_0109731
1131 Ga0501044_0075691
1132 Ga0501044_0119924
1133 Ga0501045_0000049
1134 Ga0501045_0002638
1135 Ga0501045_0123503
1136 nmdc:mga05p37_401998_c1
1137 nmdc:mga09592_303239_c1
1138 nmdc:mga06r32_249812_c1
1139 nmdc:mga08y16_166235_c1
1140 nmdc:mga08y16_9935_c1
1141 nmdc:mga0n895_239643_c1
1142 nmdc:mga0rr50_628712_c1
1143 nmdc:mga0a205_480999_c1
1144 nmdc:mga0a205_584763_c1
1145 Ga0495601_0073808
1146 Ga0495601_0200449
1147 Ga0495612_0015791
1148 Ga0501084_0016113
1149 Ga0501084_0018435
1150 Ga0501084_0034891
1151 Ga0501084_0134090
1152 Ga0501084_0147641
1153 Ga0590077_023101
1154 Ga0501082_0002432
1155 Ga0501082_0024204
1156 Ga0501082_0047943
1157 Ga0501082_0099029
1158 Ga0501082_0168917
1159 Ga0466962_0012454
1160 Ga0530510_0000049
1161 Ga0530510_0024938
1162 Ga0530510_0030674
1163 Ga0530510_0144864
1164 Ga0530510_0357505

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oz1-assembly1.cif.gz_A cryo-em structure of abcg1 e242q mutant with atp and cholesteryl hemisuccinate bound 0.7125 4 277
8i3d-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 0.7058 4 280
8i38-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 in inward conformation 0.6966 4 281
7o16-assembly1.cif.gz_D abc transporter nosdfy, nucleotide-free in lipid nanodisc, r-domain 3 0.6946 4 281
8i3a-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 in outward conformation 0.6906 4 280
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6652 60 277 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6621 60 273 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.649 60 276 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4895 60 277 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4828 60 273 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A7V9CTA1-F1-model_v4 ABC transporter permease subunit 0.964 1 283 GO:0005886
GO:0140359
AF-A0A538DXG2-F1-model_v4 ABC transporter permease 0.9629 2 283 GO:0005886
GO:0140359
AF-A0A7V9CTA1-F1-model_v4 ABC transporter permease subunit 0.9606 1 283 GO:0005886
GO:0140359
AF-A0A7J9YQB9-F1-model_v4 ABC transporter permease subunit 0.9581 2 283 GO:0005886
GO:0140359
AF-A0A6J4TKT5-F1-model_v4 ABC transporter permease 0.9573 1 228 GO:0005886
GO:0140359

Map