F466100

General Info

Members Datasets Scaffolds Average Seq Length
581 270 581 183

Family's Representative Sequence

Representative Sequence 3300046525|Ga0495663_0136464|Ga0495663_0136464_49_645
Length 198
Sequence MKIALFFAPLKERKEMAEPLGGLIRTTRVIDRFTDTTGSWIAWLNVPLVLAVSYEVFARYLFNAPTIWSFDVTYMLYGTIFMLGAAYALHKGAHIRTDFFYEKWSVKTKGMVDSISYVVFFFPSLILFLAASGNEAWYAWTIHETSEQTPWRPILWPYKAVVPVTCVLLMLQGVSEVIKSVYAWRTGVELEHKEKIEI

Samples

Sample ID Description Type Environment
1 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
157 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
158 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
159 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
160 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
161 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
162 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
172 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
173 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
174 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
177 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
178 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
179 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
180 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
181 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
182 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
183 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
184 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
185 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
186 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
215 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
216 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
239 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
240 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
241 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
242 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
243 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
244 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
245 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
246 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
252 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 0.17
Rhizosphere 99.31
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10039004 3300002244 Bacteria 843
2 rootL2_10098582 3300003322 Bacteria 1443
3 Ga0065704_10048997 3300005289 Bacteria 772
4 Ga0065715_10539767 3300005293 Bacteria 735
5 Ga0065707_10162417 3300005295 Bacteria 1552
6 Ga0065707_10173005 3300005295 Bacteria 1471
7 Ga0065707_10236602 3300005295 Bacteria 1162
8 Ga0065707_10304391 3300005295 Bacteria 995
9 Ga0070683_100884718 3300005329 Bacteria 857
10 Ga0070690_100067372 3300005330 Bacteria 2319
11 Ga0070690_100099247 3300005330 Bacteria 1928
12 Ga0070690_100162476 3300005330 Bacteria 1531
13 Ga0068869_100084760 3300005334 Bacteria 2372
14 Ga0070666_10079352 3300005335 Bacteria 2242
15 Ga0070680_100004944 3300005336 Bacteria 10037
16 Ga0070680_100181943 3300005336 Bacteria 1770
17 Ga0070680_100208195 3300005336 Bacteria 1650
18 Ga0070680_101071012 3300005336 Unclassified 697
19 Ga0070682_100032167 3300005337 Bacteria 3179
20 Ga0068868_100076429 3300005338 Bacteria 2677
21 Ga0070689_100016666 3300005340 Bacteria 5379
22 Ga0070689_100100240 3300005340 Bacteria 2291
23 Ga0070689_100234177 3300005340 Bacteria 1510
24 Ga0070689_100272462 3300005340 Bacteria 1402
25 Ga0070691_10032606 3300005341 Bacteria 2448
26 Ga0070692_10003772 3300005345 Bacteria 6231
27 Ga0070692_10031298 3300005345 Bacteria 2667
28 Ga0070668_100010867 3300005347 Bacteria 6774
29 Ga0070669_100005087 3300005353 Bacteria 9509
30 Ga0070669_100489702 3300005353 Bacteria 1019
31 Ga0070675_100013865 3300005354 Bacteria 6346
32 Ga0070674_100137328 3300005356 Bacteria 1831
33 Ga0070673_100445932 3300005364 Bacteria 1163
34 Ga0070673_100767185 3300005364 Bacteria 889
35 Ga0070688_100100107 3300005365 Bacteria 1909
36 Ga0070688_100617286 3300005365 Bacteria 832
37 Ga0070703_10019000 3300005406 Bacteria 1991
38 Ga0070714_100075644 3300005435 Bacteria 2922
39 Ga0070713_100632592 3300005436 Bacteria 1018
40 Ga0070701_10024217 3300005438 Bacteria 2935
41 Ga0070701_10284738 3300005438 Bacteria 1010
42 Ga0070705_100000974 3300005440 Bacteria 16059
43 Ga0070705_100001341 3300005440 Bacteria 13133
44 Ga0070700_100030484 3300005441 Bacteria 3224
45 Ga0070700_100049744 3300005441 Bacteria 2603
46 Ga0070700_100848559 3300005441 Bacteria 739
47 Ga0070694_100001628 3300005444 Bacteria 13178
48 Ga0070694_100023032 3300005444 Bacteria 3998
49 Ga0070694_100151778 3300005444 Bacteria 1693
50 Ga0070694_100191082 3300005444 Bacteria 1520
51 Ga0070694_100284050 3300005444 Bacteria 1263
52 Ga0070694_101103594 3300005444 Bacteria 662
53 Ga0070708_100281739 3300005445 Bacteria 1565
54 Ga0070678_101275075 3300005456 Bacteria 683
55 Ga0070681_10001134 3300005458 Bacteria 22908
56 Ga0070681_10806653 3300005458 Bacteria 856
57 Ga0068867_100001149 3300005459 Bacteria 18088
58 Ga0068867_100019717 3300005459 Bacteria 4805
59 Ga0068867_100308954 3300005459 Bacteria 1306
60 Ga0070706_100378908 3300005467 Bacteria 1318
61 Ga0070707_100097822 3300005468 Bacteria 2843
62 Ga0070698_100057229 3300005471 Bacteria 3946
63 Ga0070699_100589686 3300005518 Bacteria 1013
64 Ga0070679_100016778 3300005530 Bacteria 7077
65 Ga0070679_100432236 3300005530 Bacteria 1262
66 Ga0070697_100015045 3300005536 Bacteria 6073
67 Ga0070697_100371343 3300005536 Bacteria 1238
68 Ga0070697_100557792 3300005536 Bacteria 1005
69 Ga0068853_100420705 3300005539 Bacteria 1253
70 Ga0070672_100556129 3300005543 Bacteria 996
71 Ga0070686_100039307 3300005544 Bacteria 2947
72 Ga0070686_100061149 3300005544 Bacteria 2433
73 Ga0070686_100187000 3300005544 Bacteria 1476
74 Ga0070695_100005191 3300005545 Bacteria 7683
75 Ga0070695_100036044 3300005545 Bacteria 3111
76 Ga0070695_100122869 3300005545 Bacteria 1779
77 Ga0070695_100125896 3300005545 Bacteria 1759
78 Ga0070695_100458107 3300005545 Bacteria 979
79 Ga0070696_100000273 3300005546 Bacteria 30956
80 Ga0070696_100000739 3300005546 Bacteria 20870
81 Ga0070696_100000933 3300005546 Bacteria 18945
82 Ga0070696_100054645 3300005546 Bacteria 2783
83 Ga0070696_100137589 3300005546 Bacteria 1782
84 Ga0070696_100159155 3300005546 Bacteria 1663
85 Ga0070696_100281171 3300005546 Bacteria 1269
86 Ga0070693_100001421 3300005547 Bacteria 10813
87 Ga0070693_100185568 3300005547 Unclassified 1342
88 Ga0070704_100000093 3300005549 Bacteria 30795
89 Ga0070704_100000515 3300005549 Bacteria 18450
90 Ga0070704_100100001 3300005549 Bacteria 2182
91 Ga0070704_100109326 3300005549 Bacteria 2101
92 Ga0070704_100267208 3300005549 Bacteria 1411
93 Ga0070704_100273896 3300005549 Bacteria 1395
94 Ga0070704_100544011 3300005549 Bacteria 1014
95 Ga0068855_100006371 3300005563 Bacteria 14381
96 Ga0068857_100224249 3300005577 Bacteria 1717
97 Ga0068854_100017141 3300005578 Bacteria 4843
98 Ga0068856_100007368 3300005614 Bacteria 10738
99 Ga0070702_100000565 3300005615 Bacteria 13487
100 Ga0070702_100245594 3300005615 Bacteria 1210
101 Ga0070702_100431023 3300005615 Bacteria 951
102 Ga0068859_100008910 3300005617 Bacteria 10132
103 Ga0068859_100054296 3300005617 Bacteria 4029
104 Ga0068859_100102868 3300005617 Bacteria 2914
105 Ga0068859_100223324 3300005617 Bacteria 1971
106 Ga0068864_100164190 3300005618 Bacteria 2021
107 Ga0068866_10000746 3300005718 Bacteria 14720
108 Ga0068866_10276385 3300005718 Bacteria 1039
109 Ga0068861_100001913 3300005719 Bacteria 13403
110 Ga0068861_100001922 3300005719 Bacteria 13372
111 Ga0068861_101278643 3300005719 Bacteria 712
112 Ga0068870_10039986 3300005840 Bacteria 2429
113 Ga0068870_10147941 3300005840 Bacteria 1381
114 Ga0068870_10324015 3300005840 Bacteria 980
115 Ga0068863_100362787 3300005841 Bacteria 1413
116 Ga0068860_100008118 3300005843 Bacteria 10455
117 Ga0068862_100017829 3300005844 Bacteria 5911
118 Ga0068862_100038786 3300005844 Bacteria 4042
119 Ga0068862_100622332 3300005844 Bacteria 1039
120 Ga0081538_10035515 3300005981 Bacteria 3272
121 Ga0081539_10000365 3300005985 Bacteria 99063
122 Ga0070716_100095464 3300006173 Bacteria 1810
123 Ga0075362_10198970 3300006177 Bacteria 975
124 Ga0097621_100001187 3300006237 Bacteria 18061
125 Ga0097621_100004204 3300006237 Bacteria 9992
126 Ga0068871_100024686 3300006358 Bacteria 4664
127 Ga0068871_100025566 3300006358 Bacteria 4596
128 Ga0075428_100000502 3300006844 Bacteria 39707
129 Ga0075428_100002035 3300006844 Bacteria 21794
130 Ga0075428_100341990 3300006844 Bacteria 1606
131 Ga0075428_100455879 3300006844 Bacteria 1369
132 Ga0075428_100524127 3300006844 Bacteria 1267
133 Ga0075428_100593693 3300006844 Bacteria 1183
134 Ga0075428_101171261 3300006844 Bacteria 811
135 Ga0075430_100000620 3300006846 Bacteria 27115
136 Ga0075430_100007238 3300006846 Bacteria 9371
137 Ga0075430_100014819 3300006846 Bacteria 6639
138 Ga0075430_100248243 3300006846 Bacteria 1475
139 Ga0075430_100641390 3300006846 Bacteria 876
140 Ga0075431_100066156 3300006847 Bacteria 3731
141 Ga0075431_100074130 3300006847 Bacteria 3512
142 Ga0075431_100128621 3300006847 Bacteria 2613
143 Ga0075431_100145990 3300006847 Bacteria 2438
144 Ga0075431_100603829 3300006847 Bacteria 1081
145 Ga0075431_100707544 3300006847 Bacteria 985
146 Ga0075433_10000611 3300006852 Bacteria 23830
147 Ga0075433_10233296 3300006852 Bacteria 1634
148 Ga0075433_10322407 3300006852 Bacteria 1367
149 Ga0075433_10441807 3300006852 Bacteria 1147
150 Ga0075434_100000406 3300006871 Bacteria 31740
151 Ga0075434_100007989 3300006871 Bacteria 9807
152 Ga0075434_100064318 3300006871 Bacteria 3652
153 Ga0075429_100000081 3300006880 Bacteria 49207
154 Ga0075429_100000145 3300006880 Bacteria 43529
155 Ga0075429_100078877 3300006880 Bacteria 2870
156 Ga0075429_100123110 3300006880 Bacteria 2267
157 Ga0075429_100128615 3300006880 Bacteria 2216
158 Ga0075429_100250289 3300006880 Bacteria 1552
159 Ga0068865_100000922 3300006881 Bacteria 16653
160 Ga0068865_100001100 3300006881 Bacteria 15603
161 Ga0075436_100000375 3300006914 Bacteria 28483
162 Ga0075436_100000513 3300006914 Bacteria 25110
163 Ga0075436_100275724 3300006914 Bacteria 1202
164 Ga0097620_100008910 3300006931 Bacteria 10132
165 Ga0097620_100054294 3300006931 Bacteria 4029
166 Ga0097620_100102861 3300006931 Bacteria 2914
167 Ga0097620_100223334 3300006931 Bacteria 1971
168 Ga0075435_100000668 3300007076 Bacteria 21181
169 Ga0075435_100000820 3300007076 Bacteria 19375
170 Ga0075435_100038536 3300007076 Bacteria 3810
171 Ga0075435_100094652 3300007076 Bacteria 2469
172 Ga0075435_100122190 3300007076 Bacteria 2174
173 Ga0075435_100194868 3300007076 Bacteria 1716
174 Ga0099794_10018041 3300007265 Bacteria 3158
175 Ga0099794_10027883 3300007265 Bacteria 2622
176 Ga0099794_10240426 3300007265 Bacteria 933
177 Ga0105240_10374347 3300009093 Bacteria 1609
178 Ga0111539_10022821 3300009094 Bacteria 7686
179 Ga0111539_10096189 3300009094 Bacteria 3478
180 Ga0111539_10141863 3300009094 Bacteria 2812
181 Ga0111539_10220095 3300009094 Bacteria 2211
182 Ga0111539_10368556 3300009094 Bacteria 1672
183 Ga0111539_10869191 3300009094 Bacteria 1049
184 Ga0111539_11318386 3300009094 Bacteria 838
185 Ga0105245_10004790 3300009098 Bacteria 11943
186 Ga0105245_10125608 3300009098 Bacteria 2401
187 Ga0114129_10000393 3300009147 Bacteria 51077
188 Ga0114129_10002113 3300009147 Bacteria 27369
189 Ga0114129_10076304 3300009147 Bacteria 4667
190 Ga0114129_10196261 3300009147 Bacteria 2737
191 Ga0114129_10471699 3300009147 Bacteria 1643
192 Ga0114129_12808972 3300009147 Bacteria 578
193 Ga0105243_10016884 3300009148 Bacteria 5520
194 Ga0105243_10047896 3300009148 Bacteria 3367
195 Ga0105243_10231139 3300009148 Bacteria 1641
196 Ga0105243_11198363 3300009148 Unclassified 772
197 Ga0105241_10077029 3300009174 Unclassified 2602
198 Ga0105242_10000296 3300009176 Bacteria 39554
199 Ga0105242_10008018 3300009176 Bacteria 8134
200 Ga0105242_11420768 3300009176 Bacteria 722
201 Ga0105248_10824065 3300009177 Bacteria 1047
202 Ga0105249_10001763 3300009553 Bacteria 18843
203 Ga0105239_10495774 3300010375 Bacteria 1388
204 Ga0105246_10048210 3300011119 Bacteria 2912
205 Ga0157378_10003195 3300013297 Bacteria 14558
206 Ga0157378_10260458 3300013297 Bacteria 1664
207 Ga0163162_10147275 3300013306 Bacteria 2471
208 Ga0157372_10613611 3300013307 Bacteria 1268
209 Ga0157375_10840041 3300013308 Bacteria 1065
210 Ga0157375_11010906 3300013308 Bacteria 971
211 Ga0157380_10029114 3300014326 Bacteria 4220
212 Ga0157380_10279714 3300014326 Bacteria 1526
213 Ga0157377_10034443 3300014745 Bacteria 2770
214 Ga0157379_10053730 3300014968 Bacteria 3599
215 Ga0157376_10011070 3300014969 Bacteria 6633
216 Ga0207653_10007973 3300025885 Bacteria 3301
217 Ga0207653_10019105 3300025885 Bacteria 2161
218 Ga0207642_10014619 3300025899 Bacteria 2901
219 Ga0207642_10265018 3300025899 Bacteria 981
220 Ga0207688_10069086 3300025901 Bacteria 2002
221 Ga0207688_10135061 3300025901 Bacteria 1448
222 Ga0207680_10187394 3300025903 Bacteria 1402
223 Ga0207685_10152804 3300025905 Bacteria 1046
224 Ga0207643_10039448 3300025908 Bacteria 2656
225 Ga0207643_10048143 3300025908 Bacteria 2414
226 Ga0207684_10239857 3300025910 Bacteria 1564
227 Ga0207707_10008207 3300025912 Bacteria 9062
228 Ga0207707_10156666 3300025912 Bacteria 1992
229 Ga0207707_11284380 3300025912 Unclassified 589
230 Ga0207660_10033615 3300025917 Bacteria 3549
231 Ga0207660_10074307 3300025917 Bacteria 2481
232 Ga0207660_10216392 3300025917 Bacteria 1502
233 Ga0207660_10631775 3300025917 Bacteria 873
234 Ga0207662_10000024 3300025918 Bacteria 70677
235 Ga0207662_10246786 3300025918 Bacteria 1171
236 Ga0207662_10287659 3300025918 Bacteria 1089
237 Ga0207662_10356794 3300025918 Bacteria 983
238 Ga0207652_10581920 3300025921 Bacteria 1005
239 Ga0207646_10549906 3300025922 Bacteria 1038
240 Ga0207681_10001419 3300025923 Bacteria 15459
241 Ga0207659_10055430 3300025926 Bacteria 2835
242 Ga0207687_10030729 3300025927 Bacteria 3624
243 Ga0207687_10582823 3300025927 Bacteria 941
244 Ga0207700_10343191 3300025928 Bacteria 1299
245 Ga0207706_10102730 3300025933 Bacteria 2515
246 Ga0207686_10001177 3300025934 Bacteria 15116
247 Ga0207686_10010567 3300025934 Bacteria 5030
248 Ga0207709_10009182 3300025935 Bacteria 5447
249 Ga0207709_10010644 3300025935 Bacteria 5067
250 Ga0207709_10460929 3300025935 Bacteria 984
251 Ga0207670_10002055 3300025936 Bacteria 10541
252 Ga0207670_10164267 3300025936 Bacteria 1660
253 Ga0207670_10203145 3300025936 Bacteria 1507
254 Ga0207669_10062535 3300025937 Bacteria 2293
255 Ga0207704_10000918 3300025938 Bacteria 13025
256 Ga0207704_10003103 3300025938 Bacteria 7512
257 Ga0207665_10046937 3300025939 Bacteria 2895
258 Ga0207691_10214908 3300025940 Bacteria 1669
259 Ga0207691_10562949 3300025940 Bacteria 966
260 Ga0207689_10063599 3300025942 Bacteria 3035
261 Ga0207689_10068059 3300025942 Bacteria 2926
262 Ga0207667_10005789 3300025949 Bacteria 15080
263 Ga0207651_10019775 3300025960 Bacteria 4046
264 Ga0207651_10609819 3300025960 Bacteria 955
265 Ga0207712_10013044 3300025961 Bacteria 5323
266 Ga0207712_10022123 3300025961 Bacteria 4184
267 Ga0207668_10012611 3300025972 Bacteria 5180
268 Ga0207640_10007225 3300025981 Bacteria 6125
269 Ga0207677_10000875 3300026023 Bacteria 17082
270 Ga0207703_10199071 3300026035 Bacteria 1779
271 Ga0207639_10642603 3300026041 Bacteria 981
272 Ga0207708_10002074 3300026075 Bacteria 14763
273 Ga0207708_10374779 3300026075 Bacteria 1172
274 Ga0207708_10543052 3300026075 Bacteria 979
275 Ga0207708_10547219 3300026075 Bacteria 976
276 Ga0207708_10694568 3300026075 Unclassified 869
277 Ga0207702_10209225 3300026078 Bacteria 1812
278 Ga0207641_10133363 3300026088 Bacteria 2233
279 Ga0207648_10005161 3300026089 Bacteria 13223
280 Ga0207648_10014513 3300026089 Bacteria 7275
281 Ga0207648_10049940 3300026089 Bacteria 3658
282 Ga0207648_11112681 3300026089 Bacteria 741
283 Ga0207676_10272943 3300026095 Bacteria 1532
284 Ga0207676_10702801 3300026095 Bacteria 980
285 Ga0207674_10142260 3300026116 Bacteria 2358
286 Ga0207675_100000954 3300026118 Bacteria 28821
287 Ga0207675_100002609 3300026118 Bacteria 17841
288 Ga0207683_10102509 3300026121 Bacteria 2556
289 Ga0209969_1004100 3300027360 Bacteria 2036
290 Ga0209969_1016375 3300027360 Bacteria 1087
291 Ga0209967_1003038 3300027364 Bacteria 2199
292 Ga0209981_1030401 3300027378 Bacteria 791
293 Ga0209996_1010823 3300027395 Bacteria 1213
294 Ga0209996_1022382 3300027395 Bacteria 894
295 Ga0210000_1004382 3300027462 Bacteria 2040
296 Ga0210000_1016163 3300027462 Bacteria 1126
297 Ga0209995_1001101 3300027471 Bacteria 4155
298 Ga0209995_1016483 3300027471 Bacteria 1214
299 Ga0209995_1037772 3300027471 Bacteria 813
300 Ga0209968_1022480 3300027526 Bacteria 1029
301 Ga0209999_1007147 3300027543 Bacteria 2009
302 Ga0209999_1010557 3300027543 Bacteria 1669
303 Ga0210002_1055064 3300027617 Bacteria 689
304 Ga0209966_1001585 3300027695 Bacteria 3913
305 Ga0209966_1019647 3300027695 Bacteria 1303
306 Ga0207428_10009302 3300027907 Bacteria 8817
307 Ga0207428_10028030 3300027907 Bacteria 4682
308 Ga0207428_10036346 3300027907 Bacteria 4018
309 Ga0268265_10004469 3300028380 Bacteria 9692
310 Ga0268265_10009414 3300028380 Bacteria 6597
311 Ga0268265_10335398 3300028380 Unclassified 1375
312 Ga0268265_10360989 3300028380 Bacteria 1330
313 Ga0268264_10000841 3300028381 Bacteria 32855
314 Ga0268264_10741826 3300028381 Bacteria 978
315 Ga0307408_100078396 3300031548 Bacteria 2462
316 Ga0307408_100539331 3300031548 Bacteria 1028
317 Ga0307413_10475038 3300031824 Bacteria 998
318 Ga0307410_10820010 3300031852 Bacteria 792
319 Ga0307407_10584124 3300031903 Bacteria 830
320 Ga0307409_100208017 3300031995 Bacteria 1756
321 Ga0307416_100409488 3300032002 Bacteria 1396
322 Ga0307416_100428887 3300032002 Bacteria 1369
323 Ga0307416_100568855 3300032002 Bacteria 1209
324 Ga0307411_10152968 3300032005 Bacteria 1717
325 Ga0307411_10206451 3300032005 Bacteria 1513
326 Ga0373930_0046016 3300034816 Bacteria 941
327 Ga0373948_0002713 3300034817 Bacteria 2647
328 Ga0373950_0007812 3300034818 Bacteria 1669
329 Ga0373938_0025120 3300034957 Bacteria 1237
330 Ga0373928_0018806 3300035084 Bacteria 1436
331 Ga0373929_0069443 3300035085 Bacteria 840
332 Ga0373940_0024050 3300035088 Bacteria 1577
333 Ga0373932_0001177 3300035112 Bacteria 7478
334 Ga0373936_0202024 3300035113 Bacteria 877
335 Ga0373939_0049430 3300035114 Unclassified 1300
336 Ga0373941_0014998 3300035115 Bacteria 2082
337 Ga0373941_0055604 3300035115 Bacteria 1272
338 Ga0373941_0171538 3300035115 Bacteria 809
339 Ga0373961_0002326 3300035241 Bacteria 4967
340 Ga0373961_0152895 3300035241 Bacteria 787
341 Ga0373962_0077378 3300035242 Bacteria 1004
342 Ga0373931_0000177 3300035691 Bacteria 27824
343 Ga0373931_0012034 3300035691 Bacteria 4188
344 Ga0373931_0026008 3300035691 Bacteria 2975
345 Ga0373931_0187183 3300035691 Bacteria 1229
346 Ga0373931_0386226 3300035691 Bacteria 884
347 Ga0373937_0127278 3300036401 Bacteria 2377
348 Ga0439439_0031632 3300041406 Bacteria 1349
349 Ga0439453_0027668 3300041408 Bacteria 1057
350 Ga0439461_0049558 3300041410 Bacteria 928
351 Ga0451804_1068127 3300041463 Bacteria 959
352 Ga0451853_1506806 3300041512 Bacteria 1485
353 Ga0439441_013204 3300042001 Bacteria 1430
354 Ga0439443_001907 3300042003 Bacteria 2405
355 Ga0439450_070826 3300042008 Bacteria 855
356 Ga0439451_005225 3300042009 Bacteria 2642
357 Ga0439462_0097402 3300042015 Bacteria 809
358 Ga0439446_0003451 3300042156 Bacteria 3927
359 Ga0439434_0003761 3300042435 Bacteria 4434
360 Ga0439434_0170684 3300042435 Bacteria 726
361 Ga0439435_0000966 3300042436 Bacteria 5009
362 Ga0439435_0018938 3300042436 Bacteria 1757
363 Ga0439444_0000672 3300042437 Bacteria 4001
364 Ga0439444_0009256 3300042437 Bacteria 1549
365 Ga0439459_0016797 3300042438 Bacteria 1356
366 Ga0439460_0001831 3300042461 Bacteria 5068
367 Ga0451577_0164051 3300042876 Bacteria 2002
368 Ga0451576_0009298 3300045051 Bacteria 11411
369 Ga0451576_0020989 3300045051 Bacteria 7107
370 Ga0451576_0026259 3300045051 Bacteria 6265
371 Ga0495603_0192646 3300046455 Bacteria 1179
372 Ga0495662_0043151 3300046476 Bacteria 2177
373 Ga0495608_0037973 3300046511 Bacteria 3237
374 Ga0495628_0009779 3300046516 Bacteria 8172
375 Ga0495630_0019320 3300046517 Bacteria 5008
376 Ga0495630_0827260 3300046517 Bacteria 706
377 Ga0495663_0136464 3300046525 Bacteria 830
378 Ga0495666_0031461 3300046526 Bacteria 2600
379 Ga0495652_0031366 3300046529 Bacteria 4655
380 Ga0495640_0032561 3300046533 Bacteria 3712
381 Ga0495640_0088600 3300046533 Bacteria 2045
382 Ga0495586_0011534 3300046535 Bacteria 4701
383 Ga0495586_0027203 3300046535 Bacteria 3060
384 Ga0495598_0245694 3300046537 Unclassified 661
385 Ga0495621_0008822 3300046539 Bacteria 3037
386 Ga0495621_0078555 3300046539 Bacteria 1227
387 Ga0495621_0099042 3300046539 Bacteria 1107
388 Ga0495621_0117572 3300046539 Bacteria 1025
389 Ga0495667_0014782 3300046559 Bacteria 5275
390 Ga0495635_0073380 3300046663 Bacteria 2344
391 Ga0495659_0048579 3300046664 Bacteria 1538
392 Ga0495646_0141136 3300046680 Bacteria 1347
393 Ga0495658_0021201 3300046683 Bacteria 3423
394 Ga0495658_0034706 3300046683 Bacteria 2769
395 Ga0495669_0022285 3300046684 Bacteria 2751
396 Ga0495669_0046200 3300046684 Bacteria 1943
397 Ga0495669_0166321 3300046684 Bacteria 1048
398 Ga0495613_0008807 3300046689 Bacteria 7483
399 Ga0495624_0056350 3300046690 Bacteria 2473
400 Ga0495600_0012118 3300046809 Bacteria 5385
401 Ga0495581_0205766 3300047315 Bacteria 1151
402 Ga0495604_0017573 3300047317 Bacteria 5726
403 Ga0495636_0001613 3300047318 Bacteria 8574
404 Ga0495680_0004125 3300047322 Bacteria 13968
405 Ga0501291_019296 3300049514 Bacteria 1069
406 Ga0501298_009420 3300049521 Bacteria 1661
407 Ga0501299_029320 3300049522 Bacteria 1053
408 Ga0501031_0026854 3300049568 Bacteria 3753
409 Ga0501031_0285658 3300049568 Bacteria 1070
410 Ga0501033_0016766 3300049570 Bacteria 5542
411 Ga0501034_1345022 3300049571 Unclassified 590
412 Ga0501036_0008179 3300049572 Bacteria 8575
413 Ga0501036_0400854 3300049572 Bacteria 1144
414 Ga0501036_0734589 3300049572 Bacteria 815
415 Ga0501037_0012879 3300049573 Bacteria 6165
416 Ga0501037_0042031 3300049573 Bacteria 3360
417 Ga0501037_0202080 3300049573 Bacteria 1404
418 Ga0501038_0011271 3300049574 Bacteria 8163
419 Ga0501038_0034843 3300049574 Bacteria 4424
420 Ga0501039_0007682 3300049575 Bacteria 8231
421 Ga0501039_0020405 3300049575 Bacteria 5078
422 Ga0501039_0163118 3300049575 Bacteria 1752
423 Ga0501039_0190250 3300049575 Bacteria 1614
424 Ga0501039_0237314 3300049575 Bacteria 1434
425 Ga0501039_0251229 3300049575 Bacteria 1390
426 Ga0501039_0268630 3300049575 Unclassified 1341
427 Ga0501040_0006268 3300049576 Bacteria 7722
428 Ga0501040_0028332 3300049576 Bacteria 3775
429 Ga0501040_0030687 3300049576 Bacteria 3631
430 Ga0501040_0053644 3300049576 Bacteria 2762
431 Ga0501040_0105899 3300049576 Bacteria 1965
432 Ga0501041_0000358 3300049577 Bacteria 22614
433 Ga0501041_0007744 3300049577 Bacteria 6307
434 Ga0501042_0000291 3300049578 Bacteria 24757
435 Ga0501042_0096681 3300049578 Bacteria 2122
436 Ga0501042_0180846 3300049578 Bacteria 1521
437 Ga0501042_0309311 3300049578 Bacteria 1142
438 Ga0501042_0377229 3300049578 Bacteria 1027
439 Ga0501043_0048212 3300049579 Bacteria 3349
440 Ga0501043_0230598 3300049579 Bacteria 1430
441 Ga0501043_0417302 3300049579 Bacteria 1012
442 Ga0501046_0010378 3300049580 Bacteria 8003
443 Ga0501046_0073060 3300049580 Bacteria 2662
444 Ga0501047_1089663 3300049581 Bacteria 612
445 Ga0501048_0016337 3300049582 Bacteria 5469
446 Ga0501048_0520648 3300049582 Bacteria 853
447 Ga0501068_0109167 3300049584 Bacteria 1719
448 Ga0501069_0209621 3300049585 Bacteria 1131
449 Ga0501071_0004120 3300049587 Bacteria 9189
450 Ga0501071_0050912 3300049587 Bacteria 2983
451 Ga0501071_0053220 3300049587 Bacteria 2919
452 Ga0501071_0092717 3300049587 Bacteria 2220
453 Ga0501071_0399535 3300049587 Bacteria 1049
454 Ga0501072_0000720 3300049588 Bacteria 24044
455 Ga0501072_0001286 3300049588 Bacteria 18770
456 Ga0501072_0016019 3300049588 Bacteria 5749
457 Ga0501072_0133284 3300049588 Bacteria 1981
458 Ga0501072_0140334 3300049588 Bacteria 1926
459 Ga0501072_0148958 3300049588 Bacteria 1866
460 Ga0501072_0311253 3300049588 Bacteria 1252
461 Ga0501072_0366753 3300049588 Bacteria 1143
462 Ga0501074_0056482 3300049590 Bacteria 2829
463 Ga0501074_0408588 3300049590 Bacteria 963
464 Ga0501074_0723867 3300049590 Bacteria 702
465 Ga0501075_0005455 3300049591 Bacteria 8697
466 Ga0501075_0052774 3300049591 Bacteria 3057
467 Ga0501075_0060896 3300049591 Bacteria 2843
468 Ga0501075_0248915 3300049591 Bacteria 1354
469 Ga0501076_0002120 3300049592 Bacteria 13613
470 Ga0501076_0002813 3300049592 Bacteria 12033
471 Ga0501076_0003881 3300049592 Bacteria 10528
472 Ga0501076_0590243 3300049592 Bacteria 916
473 Ga0501077_0004484 3300049593 Bacteria 8478
474 Ga0501077_0020675 3300049593 Bacteria 4167
475 Ga0501077_0033120 3300049593 Bacteria 3290
476 Ga0501077_0130444 3300049593 Bacteria 1594
477 Ga0501209_049413 3300049656 Bacteria 1143
478 Ga0501216_047758 3300049660 Bacteria 835
479 Ga0501217_024459 3300049661 Bacteria 1445
480 Ga0501217_215945 3300049661 Bacteria 604
481 Ga0501249_029062 3300049679 Bacteria 1228
482 Ga0501219_011674 3300049703 Bacteria 673
483 Ga0501225_0039011 3300049705 Bacteria 1309
484 Ga0501234_038330 3300049707 Bacteria 782
485 Ga0501245_016687 3300049708 Bacteria 1116
486 Ga0501079_0013275 3300049741 Bacteria 6280
487 Ga0501079_0015686 3300049741 Bacteria 5787
488 Ga0501079_0088100 3300049741 Bacteria 2403
489 Ga0501079_0253768 3300049741 Bacteria 1375
490 Ga0501080_0109009 3300049742 Bacteria 2566
491 Ga0501080_0138422 3300049742 Bacteria 2252
492 Ga0501080_0151342 3300049742 Bacteria 2144
493 Ga0501080_0290203 3300049742 Bacteria 1485
494 Ga0501081_0002739 3300049743 Bacteria 11163
495 Ga0501081_0003592 3300049743 Bacteria 9924
496 Ga0501081_0010072 3300049743 Bacteria 6165
497 Ga0501081_0226647 3300049743 Bacteria 1360
498 Ga0501081_0232757 3300049743 Unclassified 1342
499 Ga0501083_0113734 3300049744 Bacteria 1778
500 Ga0501083_0327977 3300049744 Bacteria 995
501 Ga0501083_0541927 3300049744 Bacteria 757
502 Ga0501280_095625 3300049776 Bacteria 565
503 Ga0501283_056889 3300049779 Bacteria 701
504 Ga0501035_0010832 3300049822 Bacteria 8445
505 Ga0501035_0092695 3300049822 Bacteria 2658
506 Ga0501035_0104044 3300049822 Bacteria 2490
507 Ga0501044_0333287 3300049823 Bacteria 1440
508 Ga0501045_0005295 3300049824 Bacteria 8938
509 Ga0501045_0366137 3300049824 Bacteria 1073
510 Ga0501226_015909 3300049853 Bacteria 829
511 nmdc:mga05p37_2146_c1 3300050507 Bacteria 23034
512 nmdc:mga05p37_266246_c1 3300050507 Bacteria 2049
513 nmdc:mga05p37_572138_c1 3300050507 Bacteria 1281
514 nmdc:mga05p37_74562_c1 3300050507 Bacteria 4176
515 nmdc:mga05p37_775_c1 3300050507 Bacteria 35507
516 nmdc:mga09592_109817_c1 3300050508 Bacteria 2366
517 nmdc:mga09592_126809_c1 3300050508 Bacteria 2194
518 nmdc:mga09592_1359803_c1 3300050508 Bacteria 582
519 nmdc:mga09592_148_c1 3300050508 Bacteria 47706
520 nmdc:mga09592_253145_c1 3300050508 Bacteria 1527
521 nmdc:mga09592_26_c1 3300050508 Bacteria 84260
522 nmdc:mga09592_34000_c1 3300050508 Bacteria 4260
523 nmdc:mga09592_422796_c1 3300050508 Bacteria 1151
524 nmdc:mga09592_87291_c1 3300050508 Bacteria 2663
525 nmdc:mga0qj67_1004775_c1 3300050509 Bacteria 654
526 nmdc:mga0qj67_12222_c1 3300050509 Bacteria 6463
527 nmdc:mga0qj67_350279_c1 3300050509 Bacteria 1194
528 nmdc:mga0qj67_38899_c1 3300050509 Bacteria 3733
529 nmdc:mga0qj67_58443_c1 3300050509 Bacteria 3058
530 nmdc:mga0qj67_715866_c1 3300050509 Bacteria 796
531 nmdc:mga0qj67_740_c1 3300050509 Bacteria 22151
532 nmdc:mga0qj67_873766_c1 3300050509 Unclassified 709
533 nmdc:mga0qj67_933637_c1 3300050509 Bacteria 683
534 nmdc:mga06r32_124849_c2 3300050510 Bacteria 792
535 nmdc:mga06r32_21812_c1 3300050510 Bacteria 5914
536 nmdc:mga06r32_248162_c1 3300050510 Bacteria 1768
537 nmdc:mga06r32_33186_c1 3300050510 Bacteria 4861
538 nmdc:mga06r32_354814_c1 3300050510 Bacteria 1451
539 nmdc:mga06r32_451746_c1 3300050510 Bacteria 1265
540 nmdc:mga06r32_81914_c1 3300050510 Bacteria 3143
541 nmdc:mga06r32_89483_c1 3300050510 Bacteria 3006
542 nmdc:mga08y16_142861_c1 3300050511 Bacteria 2488
543 nmdc:mga08y16_1941_c1 3300050511 Bacteria 21104
544 nmdc:mga08y16_21668_c1 3300050511 Bacteria 6784
545 nmdc:mga08y16_220096_c1 3300050511 Bacteria 1966
546 nmdc:mga08y16_377830_c1 3300050511 Bacteria 1453
547 nmdc:mga08y16_79226_c1 3300050511 Bacteria 3424
548 nmdc:mga08y16_864518_c1 3300050511 Bacteria 893
549 nmdc:mga08y16_873553_c1 3300050511 Bacteria 887
550 nmdc:mga08y16_916981_c1 3300050511 Bacteria 861
551 nmdc:mga0n895_1820_c1 3300050512 Bacteria 16236
552 nmdc:mga0n895_83407_c1 3300050512 Bacteria 3188
553 nmdc:mga0n895_924_c1 3300050512 Bacteria 21172
554 nmdc:mga0rr50_1686_c1 3300050513 Bacteria 12197
555 nmdc:mga0rr50_2253_c1 3300050513 Bacteria 10830
556 nmdc:mga0rr50_4538_c1 3300050513 Bacteria 8177
557 nmdc:mga08x19_280598_c1 3300050514 Bacteria 1154
558 nmdc:mga08x19_418697_c1 3300050514 Bacteria 941
559 nmdc:mga08x19_46296_c1 3300050514 Bacteria 2453
560 nmdc:mga08x19_820_c1 3300050514 Bacteria 19741
561 nmdc:mga08x19_834_c1 3300050514 Bacteria 19567
562 nmdc:mga08x19_8472_c1 3300050514 Bacteria 6124
563 nmdc:mga0a205_1015089_c1 3300050515 Bacteria 677
564 nmdc:mga0a205_14210_c1 3300050515 Bacteria 7425
565 nmdc:mga0a205_642632_c1 3300050515 Bacteria 912
566 nmdc:mga0a205_821_c1 3300050515 Bacteria 25293
567 Ga0495612_0043897 3300053078 Bacteria 1828
568 Ga0501084_0000832 3300054114 Bacteria 23774
569 Ga0501084_0031510 3300054114 Bacteria 4433
570 Ga0501084_0036193 3300054114 Bacteria 4124
571 Ga0501084_0079464 3300054114 Bacteria 2749
572 Ga0501084_1106066 3300054114 Bacteria 665
573 Ga0590077_012905 3300059426 Bacteria 1734
574 Ga0590077_025698 3300059426 Bacteria 1270
575 Ga0501082_0013472 3300060353 Bacteria 7024
576 Ga0501082_0016106 3300060353 Bacteria 6431
577 Ga0501082_0154999 3300060353 Bacteria 1990
578 Ga0501082_0330478 3300060353 Bacteria 1328
579 Ga0530510_0000042 3300061734 Bacteria 58436
580 Ga0530510_0002067 3300061734 Bacteria 13794
581 Ga0530510_0003012 3300061734 Bacteria 11558

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0010832 Ga0501035_0010832_1479_1979 166
2 3300046684 Ga0495669_0166321 Ga0495669_0166321_111_659 167
3 3300050507 nmdc:mga05p37_266246_c1 nmdc:mga05p37_266246_c1_1269_1820 170
4 3300050509 nmdc:mga0qj67_715866_c1 nmdc:mga0qj67_715866_c1_17_529 170
5 3300046455 Ga0495603_0192646 Ga0495603_0192646_11_529 172
6 3300049776 Ga0501280_095625 Ga0501280_095625_20_541 173
7 3300049593 Ga0501077_0033120 Ga0501077_0033120_2517_3044 175
8 3300009094 Ga0111539_10141863 Ga0111539_101418633 176
9 3300009148 Ga0105243_10047896 Ga0105243_100478963 176
10 3300009553 Ga0105249_10001763 Ga0105249_1000176310 176
11 3300013306 Ga0163162_10147275 Ga0163162_101472753 176
12 3300013308 Ga0157375_10840041 Ga0157375_108400412 176
13 3300014326 Ga0157380_10029114 Ga0157380_100291142 176
14 3300050511 nmdc:mga08y16_21668_c1 nmdc:mga08y16_21668_c1_924_1454 176
15 3300050515 nmdc:mga0a205_1015089_c1 nmdc:mga0a205_1015089_c1_13_543 176
16 3300005295 Ga0065707_10236602 Ga0065707_102366022 179
17 3300005336 Ga0070680_101071012 Ga0070680_1010710121 180
18 3300005458 Ga0070681_10806653 Ga0070681_108066532 180
19 3300006844 Ga0075428_100002035 Ga0075428_10000203522 180
20 3300006880 Ga0075429_100250289 Ga0075429_1002502892 180
21 3300009094 Ga0111539_10022821 Ga0111539_100228213 180
22 3300025917 Ga0207660_10631775 Ga0207660_106317752 180
23 3300027907 Ga0207428_10028030 Ga0207428_100280303 180
24 3300049573 Ga0501037_0012879 Ga0501037_0012879_2595_3143 180
25 3300049574 Ga0501038_0034843 Ga0501038_0034843_3719_4267 180
26 3300049576 Ga0501040_0053644 Ga0501040_0053644_356_904 180
27 3300049577 Ga0501041_0007744 Ga0501041_0007744_449_997 180
28 3300049579 Ga0501043_0230598 Ga0501043_0230598_429_977 180
29 3300049581 Ga0501047_1089663 Ga0501047_1089663_28_576 180
30 3300049584 Ga0501068_0109167 Ga0501068_0109167_588_1136 180
31 3300049587 Ga0501071_0092717 Ga0501071_0092717_578_1126 180
32 3300049588 Ga0501072_0133284 Ga0501072_0133284_607_1155 180
33 3300049591 Ga0501075_0248915 Ga0501075_0248915_765_1313 180
34 3300049592 Ga0501076_0002813 Ga0501076_0002813_2593_3141 180
35 3300049593 Ga0501077_0130444 Ga0501077_0130444_327_875 180
36 3300049741 Ga0501079_0088100 Ga0501079_0088100_412_960 180
37 3300049742 Ga0501080_0109009 Ga0501080_0109009_1271_1819 180
38 3300049743 Ga0501081_0003592 Ga0501081_0003592_8575_9123 180
39 3300049744 Ga0501083_0541927 Ga0501083_0541927_183_731 180
40 3300049822 Ga0501035_0092695 Ga0501035_0092695_1733_2281 180
41 3300050508 nmdc:mga09592_87291_c1 nmdc:mga09592_87291_c1_1627_2169 180
42 3300050511 nmdc:mga08y16_1941_c1 nmdc:mga08y16_1941_c1_2218_2760 180
43 3300054114 Ga0501084_0031510 Ga0501084_0031510_1411_1959 180
44 3300060353 Ga0501082_0016106 Ga0501082_0016106_2594_3142 180
45 3300003322 rootL2_10098582 rootL2_100985822 182
46 3300005340 Ga0070689_100272462 Ga0070689_1002724622 182
47 3300005545 Ga0070695_100125896 Ga0070695_1001258962 182
48 3300005549 Ga0070704_100267208 Ga0070704_1002672082 182
49 3300009094 Ga0111539_10096189 Ga0111539_100961892 182
50 3300009147 Ga0114129_10471699 Ga0114129_104716992 182
51 3300009147 Ga0114129_12808972 Ga0114129_128089721 182
52 3300026121 Ga0207683_10102509 Ga0207683_101025092 182
53 3300027617 Ga0210002_1055064 Ga0210002_10550641 182
54 3300035691 Ga0373931_0386226 Ga0373931_0386226_153_704 182
55 3300041463 Ga0451804_1068127 Ga0451804_1068127_244_795 182
56 3300042876 Ga0451577_0164051 Ga0451577_0164051_822_1373 182
57 3300045051 Ga0451576_0026259 Ga0451576_0026259_4918_5469 182
58 3300046539 Ga0495621_0117572 Ga0495621_0117572_293_844 182
59 3300046664 Ga0495659_0048579 Ga0495659_0048579_798_1349 182
60 3300046684 Ga0495669_0022285 Ga0495669_0022285_1614_2165 182
61 3300049575 Ga0501039_0190250 Ga0501039_0190250_1028_1579 182
62 3300049578 Ga0501042_0377229 Ga0501042_0377229_161_712 182
63 3300049743 Ga0501081_0226647 Ga0501081_0226647_38_589 182
64 3300050508 nmdc:mga09592_253145_c1 nmdc:mga09592_253145_c1_554_1102 182
65 3300050510 nmdc:mga06r32_451746_c1 nmdc:mga06r32_451746_c1_249_797 182
66 3300050511 nmdc:mga08y16_79226_c1 nmdc:mga08y16_79226_c1_2204_2755 182
67 3300060353 Ga0501082_0330478 Ga0501082_0330478_562_1113 182
68 3300005289 Ga0065704_10048997 Ga0065704_100489972 183
69 3300005293 Ga0065715_10539767 Ga0065715_105397671 183
70 3300005295 Ga0065707_10304391 Ga0065707_103043912 183
71 3300005329 Ga0070683_100884718 Ga0070683_1008847181 183
72 3300005330 Ga0070690_100067372 Ga0070690_1000673722 183
73 3300005330 Ga0070690_100099247 Ga0070690_1000992471 183
74 3300005335 Ga0070666_10079352 Ga0070666_100793522 183
75 3300005336 Ga0070680_100004944 Ga0070680_1000049442 183
76 3300005336 Ga0070680_100208195 Ga0070680_1002081952 183
77 3300005337 Ga0070682_100032167 Ga0070682_1000321673 183
78 3300005338 Ga0068868_100076429 Ga0068868_1000764292 183
79 3300005340 Ga0070689_100016666 Ga0070689_1000166662 183
80 3300005340 Ga0070689_100234177 Ga0070689_1002341772 183
81 3300005341 Ga0070691_10032606 Ga0070691_100326062 183
82 3300005345 Ga0070692_10031298 Ga0070692_100312983 183
83 3300005364 Ga0070673_100767185 Ga0070673_1007671851 183
84 3300005365 Ga0070688_100617286 Ga0070688_1006172861 183
85 3300005406 Ga0070703_10019000 Ga0070703_100190002 183
86 3300005435 Ga0070714_100075644 Ga0070714_1000756443 183
87 3300005436 Ga0070713_100632592 Ga0070713_1006325922 183
88 3300005438 Ga0070701_10024217 Ga0070701_100242172 183
89 3300005440 Ga0070705_100000974 Ga0070705_1000009742 183
90 3300005440 Ga0070705_100001341 Ga0070705_1000013412 183
91 3300005441 Ga0070700_100030484 Ga0070700_1000304842 183
92 3300005444 Ga0070694_100001628 Ga0070694_10000162813 183
93 3300005444 Ga0070694_100023032 Ga0070694_1000230324 183
94 3300005444 Ga0070694_100151778 Ga0070694_1001517782 183
95 3300005444 Ga0070694_100284050 Ga0070694_1002840502 183
96 3300005445 Ga0070708_100281739 Ga0070708_1002817392 183
97 3300005456 Ga0070678_101275075 Ga0070678_1012750751 183
98 3300005458 Ga0070681_10001134 Ga0070681_1000113414 183
99 3300005459 Ga0068867_100019717 Ga0068867_1000197174 183
100 3300005459 Ga0068867_100308954 Ga0068867_1003089542 183
101 3300005467 Ga0070706_100378908 Ga0070706_1003789082 183
102 3300005468 Ga0070707_100097822 Ga0070707_1000978221 183
103 3300005471 Ga0070698_100057229 Ga0070698_1000572292 183
104 3300005518 Ga0070699_100589686 Ga0070699_1005896861 183
105 3300005530 Ga0070679_100016778 Ga0070679_1000167782 183
106 3300005530 Ga0070679_100432236 Ga0070679_1004322362 183
107 3300005536 Ga0070697_100015045 Ga0070697_1000150455 183
108 3300005536 Ga0070697_100371343 Ga0070697_1003713431 183
109 3300005536 Ga0070697_100557792 Ga0070697_1005577922 183
110 3300005539 Ga0068853_100420705 Ga0068853_1004207052 183
111 3300005544 Ga0070686_100039307 Ga0070686_1000393072 183
112 3300005544 Ga0070686_100061149 Ga0070686_1000611492 183
113 3300005544 Ga0070686_100187000 Ga0070686_1001870002 183
114 3300005545 Ga0070695_100005191 Ga0070695_1000051913 183
115 3300005545 Ga0070695_100036044 Ga0070695_1000360442 183
116 3300005545 Ga0070695_100122869 Ga0070695_1001228692 183
117 3300005545 Ga0070695_100458107 Ga0070695_1004581072 183
118 3300005546 Ga0070696_100000273 Ga0070696_10000027318 183
119 3300005546 Ga0070696_100000739 Ga0070696_10000073912 183
120 3300005546 Ga0070696_100000933 Ga0070696_1000009339 183
121 3300005546 Ga0070696_100054645 Ga0070696_1000546453 183
122 3300005546 Ga0070696_100137589 Ga0070696_1001375892 183
123 3300005546 Ga0070696_100159155 Ga0070696_1001591552 183
124 3300005547 Ga0070693_100001421 Ga0070693_1000014212 183
125 3300005547 Ga0070693_100185568 Ga0070693_1001855682 183
126 3300005549 Ga0070704_100000093 Ga0070704_10000009316 183
127 3300005549 Ga0070704_100000515 Ga0070704_1000005152 183
128 3300005549 Ga0070704_100100001 Ga0070704_1001000012 183
129 3300005549 Ga0070704_100109326 Ga0070704_1001093262 183
130 3300005549 Ga0070704_100273896 Ga0070704_1002738961 183
131 3300005549 Ga0070704_100544011 Ga0070704_1005440111 183
132 3300005563 Ga0068855_100006371 Ga0068855_10000637116 183
133 3300005577 Ga0068857_100224249 Ga0068857_1002242492 183
134 3300005578 Ga0068854_100017141 Ga0068854_1000171412 183
135 3300005614 Ga0068856_100007368 Ga0068856_1000073683 183
136 3300005615 Ga0070702_100000565 Ga0070702_10000056513 183
137 3300005615 Ga0070702_100431023 Ga0070702_1004310232 183
138 3300005617 Ga0068859_100008910 Ga0068859_1000089109 183
139 3300005617 Ga0068859_100054296 Ga0068859_1000542963 183
140 3300005617 Ga0068859_100102868 Ga0068859_1001028682 183
141 3300005618 Ga0068864_100164190 Ga0068864_1001641902 183
142 3300005718 Ga0068866_10000746 Ga0068866_1000074617 183
143 3300005719 Ga0068861_100001913 Ga0068861_1000019132 183
144 3300005719 Ga0068861_101278643 Ga0068861_1012786431 183
145 3300005840 Ga0068870_10039986 Ga0068870_100399862 183
146 3300005840 Ga0068870_10324015 Ga0068870_103240151 183
147 3300005841 Ga0068863_100362787 Ga0068863_1003627872 183
148 3300005843 Ga0068860_100008118 Ga0068860_1000081188 183
149 3300005844 Ga0068862_100038786 Ga0068862_1000387862 183
150 3300005844 Ga0068862_100622332 Ga0068862_1006223322 183
151 3300005981 Ga0081538_10035515 Ga0081538_100355152 183
152 3300005985 Ga0081539_10000365 Ga0081539_1000036572 183
153 3300006173 Ga0070716_100095464 Ga0070716_1000954642 183
154 3300006177 Ga0075362_10198970 Ga0075362_101989701 183
155 3300006237 Ga0097621_100001187 Ga0097621_1000011872 183
156 3300006237 Ga0097621_100004204 Ga0097621_10000420411 183
157 3300006358 Ga0068871_100024686 Ga0068871_1000246863 183
158 3300006358 Ga0068871_100025566 Ga0068871_1000255665 183
159 3300006844 Ga0075428_100000502 Ga0075428_1000005024 183
160 3300006844 Ga0075428_100341990 Ga0075428_1003419902 183
161 3300006844 Ga0075428_100524127 Ga0075428_1005241272 183
162 3300006844 Ga0075428_100593693 Ga0075428_1005936932 183
163 3300006844 Ga0075428_101171261 Ga0075428_1011712612 183
164 3300006846 Ga0075430_100000620 Ga0075430_10000062022 183
165 3300006846 Ga0075430_100007238 Ga0075430_1000072386 183
166 3300006846 Ga0075430_100014819 Ga0075430_1000148199 183
167 3300006846 Ga0075430_100248243 Ga0075430_1002482432 183
168 3300006846 Ga0075430_100641390 Ga0075430_1006413901 183
169 3300006847 Ga0075431_100066156 Ga0075431_1000661561 183
170 3300006847 Ga0075431_100074130 Ga0075431_1000741304 183
171 3300006847 Ga0075431_100128621 Ga0075431_1001286212 183
172 3300006847 Ga0075431_100145990 Ga0075431_1001459903 183
173 3300006847 Ga0075431_100603829 Ga0075431_1006038292 183
174 3300006847 Ga0075431_100707544 Ga0075431_1007075442 183
175 3300006852 Ga0075433_10000611 Ga0075433_1000061122 183
176 3300006852 Ga0075433_10233296 Ga0075433_102332962 183
177 3300006852 Ga0075433_10322407 Ga0075433_103224072 183
178 3300006852 Ga0075433_10441807 Ga0075433_104418072 183
179 3300006871 Ga0075434_100000406 Ga0075434_10000040616 183
180 3300006871 Ga0075434_100007989 Ga0075434_1000079892 183
181 3300006871 Ga0075434_100064318 Ga0075434_1000643182 183
182 3300006880 Ga0075429_100000081 Ga0075429_10000008132 183
183 3300006880 Ga0075429_100000145 Ga0075429_1000001452 183
184 3300006880 Ga0075429_100078877 Ga0075429_1000788772 183
185 3300006880 Ga0075429_100123110 Ga0075429_1001231102 183
186 3300006880 Ga0075429_100128615 Ga0075429_1001286152 183
187 3300006881 Ga0068865_100001100 Ga0068865_1000011002 183
188 3300006914 Ga0075436_100000375 Ga0075436_10000037522 183
189 3300006914 Ga0075436_100000513 Ga0075436_1000005136 183
190 3300006914 Ga0075436_100275724 Ga0075436_1002757242 183
191 3300006931 Ga0097620_100008910 Ga0097620_1000089103 183
192 3300006931 Ga0097620_100054294 Ga0097620_1000542943 183
193 3300006931 Ga0097620_100102861 Ga0097620_1001028612 183
194 3300007076 Ga0075435_100000668 Ga0075435_10000066811 183
195 3300007076 Ga0075435_100000820 Ga0075435_1000008204 183
196 3300007076 Ga0075435_100038536 Ga0075435_1000385363 183
197 3300007076 Ga0075435_100094652 Ga0075435_1000946522 183
198 3300007076 Ga0075435_100122190 Ga0075435_1001221902 183
199 3300007076 Ga0075435_100194868 Ga0075435_1001948682 183
200 3300007265 Ga0099794_10018041 Ga0099794_100180412 183
201 3300007265 Ga0099794_10027883 Ga0099794_100278832 183
202 3300007265 Ga0099794_10240426 Ga0099794_102404261 183
203 3300009093 Ga0105240_10374347 Ga0105240_103743472 183
204 3300009094 Ga0111539_10368556 Ga0111539_103685562 183
205 3300009094 Ga0111539_10869191 Ga0111539_108691912 183
206 3300009094 Ga0111539_11318386 Ga0111539_113183862 183
207 3300009098 Ga0105245_10004790 Ga0105245_100047909 183
208 3300009098 Ga0105245_10125608 Ga0105245_101256082 183
209 3300009147 Ga0114129_10000393 Ga0114129_1000039341 183
210 3300009147 Ga0114129_10002113 Ga0114129_1000211324 183
211 3300009147 Ga0114129_10076304 Ga0114129_100763043 183
212 3300009147 Ga0114129_10196261 Ga0114129_101962612 183
213 3300009148 Ga0105243_10016884 Ga0105243_100168842 183
214 3300009148 Ga0105243_10231139 Ga0105243_102311392 183
215 3300009148 Ga0105243_11198363 Ga0105243_111983631 183
216 3300009174 Ga0105241_10077029 Ga0105241_100770291 183
217 3300009176 Ga0105242_10000296 Ga0105242_1000029631 183
218 3300009176 Ga0105242_10008018 Ga0105242_100080184 183
219 3300009176 Ga0105242_11420768 Ga0105242_114207681 183
220 3300009177 Ga0105248_10824065 Ga0105248_108240652 183
221 3300010375 Ga0105239_10495774 Ga0105239_104957742 183
222 3300011119 Ga0105246_10048210 Ga0105246_100482102 183
223 3300013297 Ga0157378_10003195 Ga0157378_100031952 183
224 3300013307 Ga0157372_10613611 Ga0157372_106136112 183
225 3300013308 Ga0157375_11010906 Ga0157375_110109062 183
226 3300014326 Ga0157380_10279714 Ga0157380_102797142 183
227 3300014968 Ga0157379_10053730 Ga0157379_100537302 183
228 3300014969 Ga0157376_10011070 Ga0157376_100110706 183
229 3300025885 Ga0207653_10019105 Ga0207653_100191052 183
230 3300025899 Ga0207642_10014619 Ga0207642_100146192 183
231 3300025901 Ga0207688_10069086 Ga0207688_100690862 183
232 3300025903 Ga0207680_10187394 Ga0207680_101873942 183
233 3300025905 Ga0207685_10152804 Ga0207685_101528042 183
234 3300025908 Ga0207643_10039448 Ga0207643_100394482 183
235 3300025910 Ga0207684_10239857 Ga0207684_102398572 183
236 3300025912 Ga0207707_10008207 Ga0207707_100082073 183
237 3300025912 Ga0207707_10156666 Ga0207707_101566662 183
238 3300025912 Ga0207707_11284380 Ga0207707_112843801 183
239 3300025917 Ga0207660_10074307 Ga0207660_100743072 183
240 3300025918 Ga0207662_10000024 Ga0207662_1000002472 183
241 3300025918 Ga0207662_10246786 Ga0207662_102467862 183
242 3300025918 Ga0207662_10287659 Ga0207662_102876592 183
243 3300025921 Ga0207652_10581920 Ga0207652_105819202 183
244 3300025922 Ga0207646_10549906 Ga0207646_105499062 183
245 3300025927 Ga0207687_10030729 Ga0207687_100307293 183
246 3300025927 Ga0207687_10582823 Ga0207687_105828232 183
247 3300025928 Ga0207700_10343191 Ga0207700_103431912 183
248 3300025934 Ga0207686_10001177 Ga0207686_1000117713 183
249 3300025934 Ga0207686_10010567 Ga0207686_100105674 183
250 3300025935 Ga0207709_10010644 Ga0207709_100106442 183
251 3300025935 Ga0207709_10460929 Ga0207709_104609292 183
252 3300025936 Ga0207670_10002055 Ga0207670_100020556 183
253 3300025936 Ga0207670_10164267 Ga0207670_101642672 183
254 3300025938 Ga0207704_10000918 Ga0207704_1000091813 183
255 3300025939 Ga0207665_10046937 Ga0207665_100469372 183
256 3300025942 Ga0207689_10068059 Ga0207689_100680592 183
257 3300025949 Ga0207667_10005789 Ga0207667_100057899 183
258 3300025960 Ga0207651_10609819 Ga0207651_106098192 183
259 3300025961 Ga0207712_10022123 Ga0207712_100221232 183
260 3300025981 Ga0207640_10007225 Ga0207640_100072256 183
261 3300026023 Ga0207677_10000875 Ga0207677_1000087517 183
262 3300026035 Ga0207703_10199071 Ga0207703_101990712 183
263 3300026041 Ga0207639_10642603 Ga0207639_106426031 183
264 3300026075 Ga0207708_10002074 Ga0207708_100020742 183
265 3300026075 Ga0207708_10547219 Ga0207708_105472192 183
266 3300026075 Ga0207708_10694568 Ga0207708_106945681 183
267 3300026078 Ga0207702_10209225 Ga0207702_102092252 183
268 3300026088 Ga0207641_10133363 Ga0207641_101333632 183
269 3300026089 Ga0207648_10005161 Ga0207648_1000516114 183
270 3300026089 Ga0207648_10049940 Ga0207648_100499404 183
271 3300026089 Ga0207648_11112681 Ga0207648_111126811 183
272 3300026095 Ga0207676_10272943 Ga0207676_102729432 183
273 3300026095 Ga0207676_10702801 Ga0207676_107028012 183
274 3300026116 Ga0207674_10142260 Ga0207674_101422602 183
275 3300026118 Ga0207675_100002609 Ga0207675_10000260920 183
276 3300027360 Ga0209969_1004100 Ga0209969_10041002 183
277 3300027360 Ga0209969_1016375 Ga0209969_10163752 183
278 3300027364 Ga0209967_1003038 Ga0209967_10030382 183
279 3300027378 Ga0209981_1030401 Ga0209981_10304011 183
280 3300027395 Ga0209996_1010823 Ga0209996_10108232 183
281 3300027395 Ga0209996_1022382 Ga0209996_10223822 183
282 3300027462 Ga0210000_1004382 Ga0210000_10043822 183
283 3300027462 Ga0210000_1016163 Ga0210000_10161632 183
284 3300027471 Ga0209995_1001101 Ga0209995_10011013 183
285 3300027471 Ga0209995_1016483 Ga0209995_10164832 183
286 3300027471 Ga0209995_1037772 Ga0209995_10377722 183
287 3300027526 Ga0209968_1022480 Ga0209968_10224802 183
288 3300027543 Ga0209999_1007147 Ga0209999_10071472 183
289 3300027543 Ga0209999_1010557 Ga0209999_10105572 183
290 3300027695 Ga0209966_1001585 Ga0209966_10015852 183
291 3300027695 Ga0209966_1019647 Ga0209966_10196472 183
292 3300027907 Ga0207428_10009302 Ga0207428_1000930210 183
293 3300028380 Ga0268265_10004469 Ga0268265_100044692 183
294 3300028380 Ga0268265_10335398 Ga0268265_103353982 183
295 3300028380 Ga0268265_10360989 Ga0268265_103609892 183
296 3300028381 Ga0268264_10000841 Ga0268264_100008411 183
297 3300028381 Ga0268264_10741826 Ga0268264_107418261 183
298 3300031548 Ga0307408_100078396 Ga0307408_1000783962 183
299 3300031548 Ga0307408_100539331 Ga0307408_1005393312 183
300 3300031824 Ga0307413_10475038 Ga0307413_104750382 183
301 3300031852 Ga0307410_10820010 Ga0307410_108200101 183
302 3300031903 Ga0307407_10584124 Ga0307407_105841241 183
303 3300031995 Ga0307409_100208017 Ga0307409_1002080172 183
304 3300032002 Ga0307416_100409488 Ga0307416_1004094882 183
305 3300032002 Ga0307416_100428887 Ga0307416_1004288872 183
306 3300032002 Ga0307416_100568855 Ga0307416_1005688552 183
307 3300032005 Ga0307411_10152968 Ga0307411_101529682 183
308 3300032005 Ga0307411_10206451 Ga0307411_102064511 183
309 3300034816 Ga0373930_0046016 Ga0373930_0046016_339_890 183
310 3300034817 Ga0373948_0002713 Ga0373948_0002713_179_730 183
311 3300034818 Ga0373950_0007812 Ga0373950_0007812_339_890 183
312 3300034957 Ga0373938_0025120 Ga0373938_0025120_557_1108 183
313 3300035084 Ga0373928_0018806 Ga0373928_0018806_79_630 183
314 3300035088 Ga0373940_0024050 Ga0373940_0024050_339_890 183
315 3300035112 Ga0373932_0001177 Ga0373932_0001177_5157_5708 183
316 3300035113 Ga0373936_0202024 Ga0373936_0202024_127_678 183
317 3300035114 Ga0373939_0049430 Ga0373939_0049430_65_616 183
318 3300035115 Ga0373941_0014998 Ga0373941_0014998_215_766 183
319 3300035115 Ga0373941_0055604 Ga0373941_0055604_12_566 183
320 3300035115 Ga0373941_0171538 Ga0373941_0171538_198_749 183
321 3300035241 Ga0373961_0002326 Ga0373961_0002326_4245_4796 183
322 3300035241 Ga0373961_0152895 Ga0373961_0152895_204_755 183
323 3300035242 Ga0373962_0077378 Ga0373962_0077378_37_588 183
324 3300035691 Ga0373931_0000177 Ga0373931_0000177_16401_16952 183
325 3300035691 Ga0373931_0012034 Ga0373931_0012034_3223_3774 183
326 3300035691 Ga0373931_0026008 Ga0373931_0026008_954_1508 183
327 3300035691 Ga0373931_0187183 Ga0373931_0187183_128_679 183
328 3300036401 Ga0373937_0127278 Ga0373937_0127278_79_630 183
329 3300041406 Ga0439439_0031632 Ga0439439_0031632_23_574 183
330 3300041408 Ga0439453_0027668 Ga0439453_0027668_138_689 183
331 3300041410 Ga0439461_0049558 Ga0439461_0049558_211_762 183
332 3300041512 Ga0451853_1506806 Ga0451853_1506806_586_1137 183
333 3300042001 Ga0439441_013204 Ga0439441_013204_281_832 183
334 3300042003 Ga0439443_001907 Ga0439443_001907_849_1400 183
335 3300042008 Ga0439450_070826 Ga0439450_070826_18_569 183
336 3300042009 Ga0439451_005225 Ga0439451_005225_371_922 183
337 3300042015 Ga0439462_0097402 Ga0439462_0097402_59_610 183
338 3300042156 Ga0439446_0003451 Ga0439446_0003451_308_859 183
339 3300042435 Ga0439434_0003761 Ga0439434_0003761_1472_2023 183
340 3300042435 Ga0439434_0170684 Ga0439434_0170684_155_706 183
341 3300042436 Ga0439435_0000966 Ga0439435_0000966_977_1528 183
342 3300042436 Ga0439435_0018938 Ga0439435_0018938_106_657 183
343 3300042437 Ga0439444_0000672 Ga0439444_0000672_1152_1703 183
344 3300042437 Ga0439444_0009256 Ga0439444_0009256_286_837 183
345 3300042438 Ga0439459_0016797 Ga0439459_0016797_248_799 183
346 3300042461 Ga0439460_0001831 Ga0439460_0001831_2074_2625 183
347 3300045051 Ga0451576_0009298 Ga0451576_0009298_1059_1610 183
348 3300045051 Ga0451576_0020989 Ga0451576_0020989_5303_5854 183
349 3300046476 Ga0495662_0043151 Ga0495662_0043151_366_917 183
350 3300046511 Ga0495608_0037973 Ga0495608_0037973_2014_2565 183
351 3300046516 Ga0495628_0009779 Ga0495628_0009779_7559_8110 183
352 3300046517 Ga0495630_0019320 Ga0495630_0019320_1803_2354 183
353 3300046517 Ga0495630_0827260 Ga0495630_0827260_44_595 183
354 3300046525 Ga0495663_0136464 Ga0495663_0136464_49_645 183
355 3300046526 Ga0495666_0031461 Ga0495666_0031461_1999_2550 183
356 3300046529 Ga0495652_0031366 Ga0495652_0031366_4085_4636 183
357 3300046533 Ga0495640_0032561 Ga0495640_0032561_2021_2572 183
358 3300046533 Ga0495640_0088600 Ga0495640_0088600_655_1206 183
359 3300046535 Ga0495586_0011534 Ga0495586_0011534_510_1061 183
360 3300046535 Ga0495586_0027203 Ga0495586_0027203_49_600 183
361 3300046539 Ga0495621_0008822 Ga0495621_0008822_1473_2024 183
362 3300046539 Ga0495621_0078555 Ga0495621_0078555_312_908 183
363 3300046539 Ga0495621_0099042 Ga0495621_0099042_10_564 183
364 3300046559 Ga0495667_0014782 Ga0495667_0014782_1917_2468 183
365 3300046663 Ga0495635_0073380 Ga0495635_0073380_185_736 183
366 3300046680 Ga0495646_0141136 Ga0495646_0141136_159_710 183
367 3300046683 Ga0495658_0021201 Ga0495658_0021201_405_956 183
368 3300046683 Ga0495658_0034706 Ga0495658_0034706_179_730 183
369 3300046689 Ga0495613_0008807 Ga0495613_0008807_2167_2718 183
370 3300046690 Ga0495624_0056350 Ga0495624_0056350_827_1378 183
371 3300046809 Ga0495600_0012118 Ga0495600_0012118_3064_3615 183
372 3300047315 Ga0495581_0205766 Ga0495581_0205766_169_720 183
373 3300047317 Ga0495604_0017573 Ga0495604_0017573_4023_4574 183
374 3300047318 Ga0495636_0001613 Ga0495636_0001613_3258_3809 183
375 3300047322 Ga0495680_0004125 Ga0495680_0004125_11567_12118 183
376 3300049514 Ga0501291_019296 Ga0501291_019296_54_605 183
377 3300049521 Ga0501298_009420 Ga0501298_009420_325_882 183
378 3300049522 Ga0501299_029320 Ga0501299_029320_241_792 183
379 3300049568 Ga0501031_0026854 Ga0501031_0026854_2087_2638 183
380 3300049568 Ga0501031_0285658 Ga0501031_0285658_449_1000 183
381 3300049570 Ga0501033_0016766 Ga0501033_0016766_2645_3196 183
382 3300049571 Ga0501034_1345022 Ga0501034_1345022_13_564 183
383 3300049572 Ga0501036_0008179 Ga0501036_0008179_3234_3785 183
384 3300049572 Ga0501036_0400854 Ga0501036_0400854_459_1010 183
385 3300049572 Ga0501036_0734589 Ga0501036_0734589_228_779 183
386 3300049573 Ga0501037_0042031 Ga0501037_0042031_1105_1656 183
387 3300049573 Ga0501037_0202080 Ga0501037_0202080_144_695 183
388 3300049574 Ga0501038_0011271 Ga0501038_0011271_5153_5704 183
389 3300049575 Ga0501039_0007682 Ga0501039_0007682_2883_3434 183
390 3300049575 Ga0501039_0020405 Ga0501039_0020405_1426_1977 183
391 3300049575 Ga0501039_0163118 Ga0501039_0163118_559_1110 183
392 3300049575 Ga0501039_0237314 Ga0501039_0237314_149_706 183
393 3300049575 Ga0501039_0251229 Ga0501039_0251229_376_927 183
394 3300049575 Ga0501039_0268630 Ga0501039_0268630_759_1310 183
395 3300049576 Ga0501040_0006268 Ga0501040_0006268_2574_3125 183
396 3300049576 Ga0501040_0028332 Ga0501040_0028332_1210_1761 183
397 3300049576 Ga0501040_0030687 Ga0501040_0030687_1385_1936 183
398 3300049576 Ga0501040_0105899 Ga0501040_0105899_504_1055 183
399 3300049577 Ga0501041_0000358 Ga0501041_0000358_4791_5342 183
400 3300049578 Ga0501042_0000291 Ga0501042_0000291_21748_22299 183
401 3300049578 Ga0501042_0096681 Ga0501042_0096681_1297_1848 183
402 3300049578 Ga0501042_0180846 Ga0501042_0180846_642_1193 183
403 3300049578 Ga0501042_0309311 Ga0501042_0309311_377_928 183
404 3300049579 Ga0501043_0048212 Ga0501043_0048212_637_1188 183
405 3300049579 Ga0501043_0417302 Ga0501043_0417302_67_618 183
406 3300049580 Ga0501046_0010378 Ga0501046_0010378_4879_5430 183
407 3300049580 Ga0501046_0073060 Ga0501046_0073060_181_732 183
408 3300049582 Ga0501048_0016337 Ga0501048_0016337_3071_3622 183
409 3300049582 Ga0501048_0520648 Ga0501048_0520648_104_661 183
410 3300049585 Ga0501069_0209621 Ga0501069_0209621_398_952 183
411 3300049587 Ga0501071_0004120 Ga0501071_0004120_4815_5366 183
412 3300049587 Ga0501071_0050912 Ga0501071_0050912_918_1469 183
413 3300049587 Ga0501071_0053220 Ga0501071_0053220_753_1304 183
414 3300049587 Ga0501071_0399535 Ga0501071_0399535_235_786 183
415 3300049588 Ga0501072_0000720 Ga0501072_0000720_22566_23117 183
416 3300049588 Ga0501072_0001286 Ga0501072_0001286_11637_12188 183
417 3300049588 Ga0501072_0016019 Ga0501072_0016019_556_1107 183
418 3300049588 Ga0501072_0140334 Ga0501072_0140334_205_756 183
419 3300049588 Ga0501072_0148958 Ga0501072_0148958_462_1013 183
420 3300049588 Ga0501072_0311253 Ga0501072_0311253_174_725 183
421 3300049588 Ga0501072_0366753 Ga0501072_0366753_370_921 183
422 3300049590 Ga0501074_0056482 Ga0501074_0056482_1839_2390 183
423 3300049590 Ga0501074_0408588 Ga0501074_0408588_176_727 183
424 3300049590 Ga0501074_0723867 Ga0501074_0723867_75_626 183
425 3300049591 Ga0501075_0005455 Ga0501075_0005455_3234_3785 183
426 3300049591 Ga0501075_0052774 Ga0501075_0052774_444_995 183
427 3300049591 Ga0501075_0060896 Ga0501075_0060896_908_1459 183
428 3300049592 Ga0501076_0002120 Ga0501076_0002120_8396_8947 183
429 3300049592 Ga0501076_0003881 Ga0501076_0003881_4172_4723 183
430 3300049592 Ga0501076_0590243 Ga0501076_0590243_226_777 183
431 3300049593 Ga0501077_0004484 Ga0501077_0004484_5510_6061 183
432 3300049593 Ga0501077_0020675 Ga0501077_0020675_2469_3020 183
433 3300049656 Ga0501209_049413 Ga0501209_049413_265_816 183
434 3300049660 Ga0501216_047758 Ga0501216_047758_155_706 183
435 3300049661 Ga0501217_024459 Ga0501217_024459_607_1164 183
436 3300049661 Ga0501217_215945 Ga0501217_215945_24_575 183
437 3300049679 Ga0501249_029062 Ga0501249_029062_77_628 183
438 3300049703 Ga0501219_011674 Ga0501219_011674_30_581 183
439 3300049705 Ga0501225_0039011 Ga0501225_0039011_445_996 183
440 3300049707 Ga0501234_038330 Ga0501234_038330_162_713 183
441 3300049708 Ga0501245_016687 Ga0501245_016687_265_816 183
442 3300049741 Ga0501079_0013275 Ga0501079_0013275_421_972 183
443 3300049741 Ga0501079_0015686 Ga0501079_0015686_2192_2743 183
444 3300049741 Ga0501079_0253768 Ga0501079_0253768_367_918 183
445 3300049742 Ga0501080_0138422 Ga0501080_0138422_1026_1577 183
446 3300049742 Ga0501080_0151342 Ga0501080_0151342_1523_2074 183
447 3300049742 Ga0501080_0290203 Ga0501080_0290203_349_900 183
448 3300049743 Ga0501081_0002739 Ga0501081_0002739_5511_6062 183
449 3300049743 Ga0501081_0010072 Ga0501081_0010072_5596_6147 183
450 3300049743 Ga0501081_0232757 Ga0501081_0232757_563_1114 183
451 3300049744 Ga0501083_0113734 Ga0501083_0113734_1163_1714 183
452 3300049744 Ga0501083_0327977 Ga0501083_0327977_400_951 183
453 3300049779 Ga0501283_056889 Ga0501283_056889_14_565 183
454 3300049822 Ga0501035_0104044 Ga0501035_0104044_205_756 183
455 3300049823 Ga0501044_0333287 Ga0501044_0333287_153_704 183
456 3300049824 Ga0501045_0005295 Ga0501045_0005295_3386_3937 183
457 3300049824 Ga0501045_0366137 Ga0501045_0366137_65_616 183
458 3300049853 Ga0501226_015909 Ga0501226_015909_260_811 183
459 3300050507 nmdc:mga05p37_2146_c1 nmdc:mga05p37_2146_c1_10583_11134 183
460 3300050507 nmdc:mga05p37_572138_c1 nmdc:mga05p37_572138_c1_578_1129 183
461 3300050507 nmdc:mga05p37_74562_c1 nmdc:mga05p37_74562_c1_2622_3173 183
462 3300050507 nmdc:mga05p37_775_c1 nmdc:mga05p37_775_c1_8317_8868 183
463 3300050508 nmdc:mga09592_109817_c1 nmdc:mga09592_109817_c1_976_1527 183
464 3300050508 nmdc:mga09592_126809_c1 nmdc:mga09592_126809_c1_498_1049 183
465 3300050508 nmdc:mga09592_1359803_c1 nmdc:mga09592_1359803_c1_18_569 183
466 3300050508 nmdc:mga09592_148_c1 nmdc:mga09592_148_c1_35195_35746 183
467 3300050508 nmdc:mga09592_26_c1 nmdc:mga09592_26_c1_66875_67426 183
468 3300050508 nmdc:mga09592_34000_c1 nmdc:mga09592_34000_c1_1051_1602 183
469 3300050508 nmdc:mga09592_422796_c1 nmdc:mga09592_422796_c1_49_600 183
470 3300050509 nmdc:mga0qj67_1004775_c1 nmdc:mga0qj67_1004775_c1_78_629 183
471 3300050509 nmdc:mga0qj67_12222_c1 nmdc:mga0qj67_12222_c1_3990_4541 183
472 3300050509 nmdc:mga0qj67_350279_c1 nmdc:mga0qj67_350279_c1_572_1123 183
473 3300050509 nmdc:mga0qj67_38899_c1 nmdc:mga0qj67_38899_c1_71_622 183
474 3300050509 nmdc:mga0qj67_58443_c1 nmdc:mga0qj67_58443_c1_479_1030 183
475 3300050509 nmdc:mga0qj67_740_c1 nmdc:mga0qj67_740_c1_9514_10065 183
476 3300050509 nmdc:mga0qj67_933637_c1 nmdc:mga0qj67_933637_c1_60_611 183
477 3300050510 nmdc:mga06r32_124849_c2 nmdc:mga06r32_124849_c2_208_759 183
478 3300050510 nmdc:mga06r32_21812_c1 nmdc:mga06r32_21812_c1_2319_2870 183
479 3300050510 nmdc:mga06r32_248162_c1 nmdc:mga06r32_248162_c1_795_1346 183
480 3300050510 nmdc:mga06r32_33186_c1 nmdc:mga06r32_33186_c1_3972_4523 183
481 3300050510 nmdc:mga06r32_354814_c1 nmdc:mga06r32_354814_c1_244_795 183
482 3300050510 nmdc:mga06r32_81914_c1 nmdc:mga06r32_81914_c1_2325_2876 183
483 3300050510 nmdc:mga06r32_89483_c1 nmdc:mga06r32_89483_c1_2425_2976 183
484 3300050511 nmdc:mga08y16_142861_c1 nmdc:mga08y16_142861_c1_644_1195 183
485 3300050511 nmdc:mga08y16_220096_c1 nmdc:mga08y16_220096_c1_619_1170 183
486 3300050511 nmdc:mga08y16_377830_c1 nmdc:mga08y16_377830_c1_456_1007 183
487 3300050511 nmdc:mga08y16_864518_c1 nmdc:mga08y16_864518_c1_91_642 183
488 3300050511 nmdc:mga08y16_873553_c1 nmdc:mga08y16_873553_c1_301_855 183
489 3300050512 nmdc:mga0n895_1820_c1 nmdc:mga0n895_1820_c1_6709_7260 183
490 3300050512 nmdc:mga0n895_83407_c1 nmdc:mga0n895_83407_c1_1818_2369 183
491 3300050512 nmdc:mga0n895_924_c1 nmdc:mga0n895_924_c1_6143_6694 183
492 3300050513 nmdc:mga0rr50_1686_c1 nmdc:mga0rr50_1686_c1_10444_10995 183
493 3300050513 nmdc:mga0rr50_2253_c1 nmdc:mga0rr50_2253_c1_3707_4258 183
494 3300050513 nmdc:mga0rr50_4538_c1 nmdc:mga0rr50_4538_c1_4376_4927 183
495 3300050514 nmdc:mga08x19_280598_c1 nmdc:mga08x19_280598_c1_317_868 183
496 3300050514 nmdc:mga08x19_418697_c1 nmdc:mga08x19_418697_c1_61_612 183
497 3300050514 nmdc:mga08x19_46296_c1 nmdc:mga08x19_46296_c1_1573_2124 183
498 3300050514 nmdc:mga08x19_820_c1 nmdc:mga08x19_820_c1_16711_17262 183
499 3300050514 nmdc:mga08x19_834_c1 nmdc:mga08x19_834_c1_63_614 183
500 3300050514 nmdc:mga08x19_8472_c1 nmdc:mga08x19_8472_c1_5365_5916 183
501 3300050515 nmdc:mga0a205_14210_c1 nmdc:mga0a205_14210_c1_3712_4263 183
502 3300050515 nmdc:mga0a205_642632_c1 nmdc:mga0a205_642632_c1_89_640 183
503 3300050515 nmdc:mga0a205_821_c1 nmdc:mga0a205_821_c1_18019_18570 183
504 3300053078 Ga0495612_0043897 Ga0495612_0043897_648_1199 183
505 3300054114 Ga0501084_0000832 Ga0501084_0000832_14827_15378 183
506 3300054114 Ga0501084_0036193 Ga0501084_0036193_2073_2624 183
507 3300054114 Ga0501084_0079464 Ga0501084_0079464_2154_2705 183
508 3300054114 Ga0501084_1106066 Ga0501084_1106066_89_640 183
509 3300059426 Ga0590077_012905 Ga0590077_012905_499_1050 183
510 3300059426 Ga0590077_025698 Ga0590077_025698_155_706 183
511 3300060353 Ga0501082_0013472 Ga0501082_0013472_92_643 183
512 3300060353 Ga0501082_0154999 Ga0501082_0154999_541_1092 183
513 3300061734 Ga0530510_0000042 Ga0530510_0000042_20752_21303 183
514 3300061734 Ga0530510_0002067 Ga0530510_0002067_4731_5282 183
515 3300061734 Ga0530510_0003012 Ga0530510_0003012_2451_3002 183
516 3300002244 JGI24742J22300_10039004 JGI24742J22300_100390042 184
517 3300005295 Ga0065707_10162417 Ga0065707_101624172 184
518 3300005295 Ga0065707_10173005 Ga0065707_101730052 184
519 3300005330 Ga0070690_100162476 Ga0070690_1001624762 184
520 3300005334 Ga0068869_100084760 Ga0068869_1000847602 184
521 3300005336 Ga0070680_100181943 Ga0070680_1001819432 184
522 3300005340 Ga0070689_100100240 Ga0070689_1001002402 184
523 3300005345 Ga0070692_10003772 Ga0070692_100037722 184
524 3300005347 Ga0070668_100010867 Ga0070668_1000108674 184
525 3300005353 Ga0070669_100005087 Ga0070669_1000050875 184
526 3300005353 Ga0070669_100489702 Ga0070669_1004897021 184
527 3300005354 Ga0070675_100013865 Ga0070675_1000138656 184
528 3300005356 Ga0070674_100137328 Ga0070674_1001373282 184
529 3300005364 Ga0070673_100445932 Ga0070673_1004459322 184
530 3300005365 Ga0070688_100100107 Ga0070688_1001001072 184
531 3300005438 Ga0070701_10284738 Ga0070701_102847382 184
532 3300005441 Ga0070700_100049744 Ga0070700_1000497442 184
533 3300005441 Ga0070700_100848559 Ga0070700_1008485591 184
534 3300005444 Ga0070694_100191082 Ga0070694_1001910822 184
535 3300005444 Ga0070694_101103594 Ga0070694_1011035941 184
536 3300005459 Ga0068867_100001149 Ga0068867_1000011498 184
537 3300005543 Ga0070672_100556129 Ga0070672_1005561292 184
538 3300005546 Ga0070696_100281171 Ga0070696_1002811712 184
539 3300005615 Ga0070702_100245594 Ga0070702_1002455941 184
540 3300005617 Ga0068859_100223324 Ga0068859_1002233242 184
541 3300005718 Ga0068866_10276385 Ga0068866_102763852 184
542 3300005719 Ga0068861_100001922 Ga0068861_1000019223 184
543 3300005840 Ga0068870_10147941 Ga0068870_101479412 184
544 3300005844 Ga0068862_100017829 Ga0068862_1000178293 184
545 3300006844 Ga0075428_100455879 Ga0075428_1004558792 184
546 3300006881 Ga0068865_100000922 Ga0068865_1000009222 184
547 3300006931 Ga0097620_100223334 Ga0097620_1002233342 184
548 3300009094 Ga0111539_10220095 Ga0111539_102200952 184
549 3300013297 Ga0157378_10260458 Ga0157378_102604582 184
550 3300014745 Ga0157377_10034443 Ga0157377_100344433 184
551 3300025885 Ga0207653_10007973 Ga0207653_100079733 184
552 3300025899 Ga0207642_10265018 Ga0207642_102650181 184
553 3300025901 Ga0207688_10135061 Ga0207688_101350612 184
554 3300025908 Ga0207643_10048143 Ga0207643_100481432 184
555 3300025917 Ga0207660_10033615 Ga0207660_100336152 184
556 3300025917 Ga0207660_10216392 Ga0207660_102163922 184
557 3300025918 Ga0207662_10356794 Ga0207662_103567941 184
558 3300025923 Ga0207681_10001419 Ga0207681_1000141913 184
559 3300025926 Ga0207659_10055430 Ga0207659_100554302 184
560 3300025933 Ga0207706_10102730 Ga0207706_101027303 184
561 3300025935 Ga0207709_10009182 Ga0207709_100091825 184
562 3300025936 Ga0207670_10203145 Ga0207670_102031452 184
563 3300025937 Ga0207669_10062535 Ga0207669_100625352 184
564 3300025938 Ga0207704_10003103 Ga0207704_100031035 184
565 3300025940 Ga0207691_10214908 Ga0207691_102149082 184
566 3300025940 Ga0207691_10562949 Ga0207691_105629492 184
567 3300025942 Ga0207689_10063599 Ga0207689_100635992 184
568 3300025960 Ga0207651_10019775 Ga0207651_100197752 184
569 3300025961 Ga0207712_10013044 Ga0207712_100130445 184
570 3300025972 Ga0207668_10012611 Ga0207668_100126115 184
571 3300026075 Ga0207708_10374779 Ga0207708_103747792 184
572 3300026075 Ga0207708_10543052 Ga0207708_105430522 184
573 3300026089 Ga0207648_10014513 Ga0207648_100145132 184
574 3300026118 Ga0207675_100000954 Ga0207675_10000095412 184
575 3300027907 Ga0207428_10036346 Ga0207428_100363463 184
576 3300028380 Ga0268265_10009414 Ga0268265_100094144 184
577 3300035085 Ga0373929_0069443 Ga0373929_0069443_20_574 184
578 3300046537 Ga0495598_0245694 Ga0495598_0245694_91_645 184
579 3300046684 Ga0495669_0046200 Ga0495669_0046200_300_854 184
580 3300050509 nmdc:mga0qj67_873766_c1 nmdc:mga0qj67_873766_c1_29_589 184
581 3300050511 nmdc:mga08y16_916981_c1 nmdc:mga08y16_916981_c1_147_701 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

48

182

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.8101 14 171
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.7919 14 171
6akg-assembly2.cif.gz_C crystal structure of mouse claudin-3 p134g mutant in complex with c-terminal fragment of clostridium perfringens enterotoxin 0.3967 59 163
6z0c-assembly1.cif.gz_A structure of in silico modelled artificial maquette-3 protein 0.3642 9 173
4ckg-assembly1.cif.gz_B helical reconstruction of acap1(bar-ph domain) decorated membrane tubules by cryo-electron microscopy 0.3588 9 172
ID Description Score Start End Superfamily
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6565 35 167 1.20.120.550
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6406 35 167 1.20.120.550
af_P78369_1_191_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5413 61 163 1.20.140.150
af_A0A178VGS0_23_184_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5171 27 173 1.20.140.150
af_A0A2R8Q922_1_191_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5066 48 163 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2E6NY68-F1-model_v4 TRAP transporter small permease protein 0.9453 14 172 GO:0005886
GO:0022857
AF-A0A0P7YB44-F1-model_v4 TRAP transporter small permease protein 0.9452 22 176 GO:0005886
GO:0022857
AF-A0A6M1LQ77-F1-model_v4 TRAP transporter small permease protein 0.944 11 177 GO:0005886
GO:0022857
AF-A0A7Y2CXB1-F1-model_v4 TRAP transporter small permease protein 0.9392 50 177 GO:0005886
GO:0022857
AF-A0A839Z9N2-F1-model_v4 TRAP transporter small permease protein 0.9347 11 177 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
81.45 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map