F466100
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 581 | 270 | 581 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300046525|Ga0495663_0136464|Ga0495663_0136464_49_645 |
| Length | 198 |
| Sequence | MKIALFFAPLKERKEMAEPLGGLIRTTRVIDRFTDTTGSWIAWLNVPLVLAVSYEVFARYLFNAPTIWSFDVTYMLYGTIFMLGAAYALHKGAHIRTDFFYEKWSVKTKGMVDSISYVVFFFPSLILFLAASGNEAWYAWTIHETSEQTPWRPILWPYKAVVPVTCVLLMLQGVSEVIKSVYAWRTGVELEHKEKIEI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 151 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 152 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 153 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 154 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 155 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 156 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 157 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 158 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 159 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 160 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 161 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 162 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 165 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 166 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 169 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 172 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 173 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 174 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 176 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 177 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 178 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 179 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 180 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 181 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 182 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 183 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 184 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 185 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 186 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 187 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 188 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 189 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 215 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 216 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 217 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 240 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 241 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 242 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 243 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 244 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 245 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 247 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 252 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 253 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 257 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 269 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.17 |
| Nodule | 0 |
| Rhizoplane | 0.17 |
| Rhizosphere | 99.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24742J22300_10039004 | 3300002244 | Bacteria | 843 |
| 2 | rootL2_10098582 | 3300003322 | Bacteria | 1443 |
| 3 | Ga0065704_10048997 | 3300005289 | Bacteria | 772 |
| 4 | Ga0065715_10539767 | 3300005293 | Bacteria | 735 |
| 5 | Ga0065707_10162417 | 3300005295 | Bacteria | 1552 |
| 6 | Ga0065707_10173005 | 3300005295 | Bacteria | 1471 |
| 7 | Ga0065707_10236602 | 3300005295 | Bacteria | 1162 |
| 8 | Ga0065707_10304391 | 3300005295 | Bacteria | 995 |
| 9 | Ga0070683_100884718 | 3300005329 | Bacteria | 857 |
| 10 | Ga0070690_100067372 | 3300005330 | Bacteria | 2319 |
| 11 | Ga0070690_100099247 | 3300005330 | Bacteria | 1928 |
| 12 | Ga0070690_100162476 | 3300005330 | Bacteria | 1531 |
| 13 | Ga0068869_100084760 | 3300005334 | Bacteria | 2372 |
| 14 | Ga0070666_10079352 | 3300005335 | Bacteria | 2242 |
| 15 | Ga0070680_100004944 | 3300005336 | Bacteria | 10037 |
| 16 | Ga0070680_100181943 | 3300005336 | Bacteria | 1770 |
| 17 | Ga0070680_100208195 | 3300005336 | Bacteria | 1650 |
| 18 | Ga0070680_101071012 | 3300005336 | Unclassified | 697 |
| 19 | Ga0070682_100032167 | 3300005337 | Bacteria | 3179 |
| 20 | Ga0068868_100076429 | 3300005338 | Bacteria | 2677 |
| 21 | Ga0070689_100016666 | 3300005340 | Bacteria | 5379 |
| 22 | Ga0070689_100100240 | 3300005340 | Bacteria | 2291 |
| 23 | Ga0070689_100234177 | 3300005340 | Bacteria | 1510 |
| 24 | Ga0070689_100272462 | 3300005340 | Bacteria | 1402 |
| 25 | Ga0070691_10032606 | 3300005341 | Bacteria | 2448 |
| 26 | Ga0070692_10003772 | 3300005345 | Bacteria | 6231 |
| 27 | Ga0070692_10031298 | 3300005345 | Bacteria | 2667 |
| 28 | Ga0070668_100010867 | 3300005347 | Bacteria | 6774 |
| 29 | Ga0070669_100005087 | 3300005353 | Bacteria | 9509 |
| 30 | Ga0070669_100489702 | 3300005353 | Bacteria | 1019 |
| 31 | Ga0070675_100013865 | 3300005354 | Bacteria | 6346 |
| 32 | Ga0070674_100137328 | 3300005356 | Bacteria | 1831 |
| 33 | Ga0070673_100445932 | 3300005364 | Bacteria | 1163 |
| 34 | Ga0070673_100767185 | 3300005364 | Bacteria | 889 |
| 35 | Ga0070688_100100107 | 3300005365 | Bacteria | 1909 |
| 36 | Ga0070688_100617286 | 3300005365 | Bacteria | 832 |
| 37 | Ga0070703_10019000 | 3300005406 | Bacteria | 1991 |
| 38 | Ga0070714_100075644 | 3300005435 | Bacteria | 2922 |
| 39 | Ga0070713_100632592 | 3300005436 | Bacteria | 1018 |
| 40 | Ga0070701_10024217 | 3300005438 | Bacteria | 2935 |
| 41 | Ga0070701_10284738 | 3300005438 | Bacteria | 1010 |
| 42 | Ga0070705_100000974 | 3300005440 | Bacteria | 16059 |
| 43 | Ga0070705_100001341 | 3300005440 | Bacteria | 13133 |
| 44 | Ga0070700_100030484 | 3300005441 | Bacteria | 3224 |
| 45 | Ga0070700_100049744 | 3300005441 | Bacteria | 2603 |
| 46 | Ga0070700_100848559 | 3300005441 | Bacteria | 739 |
| 47 | Ga0070694_100001628 | 3300005444 | Bacteria | 13178 |
| 48 | Ga0070694_100023032 | 3300005444 | Bacteria | 3998 |
| 49 | Ga0070694_100151778 | 3300005444 | Bacteria | 1693 |
| 50 | Ga0070694_100191082 | 3300005444 | Bacteria | 1520 |
| 51 | Ga0070694_100284050 | 3300005444 | Bacteria | 1263 |
| 52 | Ga0070694_101103594 | 3300005444 | Bacteria | 662 |
| 53 | Ga0070708_100281739 | 3300005445 | Bacteria | 1565 |
| 54 | Ga0070678_101275075 | 3300005456 | Bacteria | 683 |
| 55 | Ga0070681_10001134 | 3300005458 | Bacteria | 22908 |
| 56 | Ga0070681_10806653 | 3300005458 | Bacteria | 856 |
| 57 | Ga0068867_100001149 | 3300005459 | Bacteria | 18088 |
| 58 | Ga0068867_100019717 | 3300005459 | Bacteria | 4805 |
| 59 | Ga0068867_100308954 | 3300005459 | Bacteria | 1306 |
| 60 | Ga0070706_100378908 | 3300005467 | Bacteria | 1318 |
| 61 | Ga0070707_100097822 | 3300005468 | Bacteria | 2843 |
| 62 | Ga0070698_100057229 | 3300005471 | Bacteria | 3946 |
| 63 | Ga0070699_100589686 | 3300005518 | Bacteria | 1013 |
| 64 | Ga0070679_100016778 | 3300005530 | Bacteria | 7077 |
| 65 | Ga0070679_100432236 | 3300005530 | Bacteria | 1262 |
| 66 | Ga0070697_100015045 | 3300005536 | Bacteria | 6073 |
| 67 | Ga0070697_100371343 | 3300005536 | Bacteria | 1238 |
| 68 | Ga0070697_100557792 | 3300005536 | Bacteria | 1005 |
| 69 | Ga0068853_100420705 | 3300005539 | Bacteria | 1253 |
| 70 | Ga0070672_100556129 | 3300005543 | Bacteria | 996 |
| 71 | Ga0070686_100039307 | 3300005544 | Bacteria | 2947 |
| 72 | Ga0070686_100061149 | 3300005544 | Bacteria | 2433 |
| 73 | Ga0070686_100187000 | 3300005544 | Bacteria | 1476 |
| 74 | Ga0070695_100005191 | 3300005545 | Bacteria | 7683 |
| 75 | Ga0070695_100036044 | 3300005545 | Bacteria | 3111 |
| 76 | Ga0070695_100122869 | 3300005545 | Bacteria | 1779 |
| 77 | Ga0070695_100125896 | 3300005545 | Bacteria | 1759 |
| 78 | Ga0070695_100458107 | 3300005545 | Bacteria | 979 |
| 79 | Ga0070696_100000273 | 3300005546 | Bacteria | 30956 |
| 80 | Ga0070696_100000739 | 3300005546 | Bacteria | 20870 |
| 81 | Ga0070696_100000933 | 3300005546 | Bacteria | 18945 |
| 82 | Ga0070696_100054645 | 3300005546 | Bacteria | 2783 |
| 83 | Ga0070696_100137589 | 3300005546 | Bacteria | 1782 |
| 84 | Ga0070696_100159155 | 3300005546 | Bacteria | 1663 |
| 85 | Ga0070696_100281171 | 3300005546 | Bacteria | 1269 |
| 86 | Ga0070693_100001421 | 3300005547 | Bacteria | 10813 |
| 87 | Ga0070693_100185568 | 3300005547 | Unclassified | 1342 |
| 88 | Ga0070704_100000093 | 3300005549 | Bacteria | 30795 |
| 89 | Ga0070704_100000515 | 3300005549 | Bacteria | 18450 |
| 90 | Ga0070704_100100001 | 3300005549 | Bacteria | 2182 |
| 91 | Ga0070704_100109326 | 3300005549 | Bacteria | 2101 |
| 92 | Ga0070704_100267208 | 3300005549 | Bacteria | 1411 |
| 93 | Ga0070704_100273896 | 3300005549 | Bacteria | 1395 |
| 94 | Ga0070704_100544011 | 3300005549 | Bacteria | 1014 |
| 95 | Ga0068855_100006371 | 3300005563 | Bacteria | 14381 |
| 96 | Ga0068857_100224249 | 3300005577 | Bacteria | 1717 |
| 97 | Ga0068854_100017141 | 3300005578 | Bacteria | 4843 |
| 98 | Ga0068856_100007368 | 3300005614 | Bacteria | 10738 |
| 99 | Ga0070702_100000565 | 3300005615 | Bacteria | 13487 |
| 100 | Ga0070702_100245594 | 3300005615 | Bacteria | 1210 |
| 101 | Ga0070702_100431023 | 3300005615 | Bacteria | 951 |
| 102 | Ga0068859_100008910 | 3300005617 | Bacteria | 10132 |
| 103 | Ga0068859_100054296 | 3300005617 | Bacteria | 4029 |
| 104 | Ga0068859_100102868 | 3300005617 | Bacteria | 2914 |
| 105 | Ga0068859_100223324 | 3300005617 | Bacteria | 1971 |
| 106 | Ga0068864_100164190 | 3300005618 | Bacteria | 2021 |
| 107 | Ga0068866_10000746 | 3300005718 | Bacteria | 14720 |
| 108 | Ga0068866_10276385 | 3300005718 | Bacteria | 1039 |
| 109 | Ga0068861_100001913 | 3300005719 | Bacteria | 13403 |
| 110 | Ga0068861_100001922 | 3300005719 | Bacteria | 13372 |
| 111 | Ga0068861_101278643 | 3300005719 | Bacteria | 712 |
| 112 | Ga0068870_10039986 | 3300005840 | Bacteria | 2429 |
| 113 | Ga0068870_10147941 | 3300005840 | Bacteria | 1381 |
| 114 | Ga0068870_10324015 | 3300005840 | Bacteria | 980 |
| 115 | Ga0068863_100362787 | 3300005841 | Bacteria | 1413 |
| 116 | Ga0068860_100008118 | 3300005843 | Bacteria | 10455 |
| 117 | Ga0068862_100017829 | 3300005844 | Bacteria | 5911 |
| 118 | Ga0068862_100038786 | 3300005844 | Bacteria | 4042 |
| 119 | Ga0068862_100622332 | 3300005844 | Bacteria | 1039 |
| 120 | Ga0081538_10035515 | 3300005981 | Bacteria | 3272 |
| 121 | Ga0081539_10000365 | 3300005985 | Bacteria | 99063 |
| 122 | Ga0070716_100095464 | 3300006173 | Bacteria | 1810 |
| 123 | Ga0075362_10198970 | 3300006177 | Bacteria | 975 |
| 124 | Ga0097621_100001187 | 3300006237 | Bacteria | 18061 |
| 125 | Ga0097621_100004204 | 3300006237 | Bacteria | 9992 |
| 126 | Ga0068871_100024686 | 3300006358 | Bacteria | 4664 |
| 127 | Ga0068871_100025566 | 3300006358 | Bacteria | 4596 |
| 128 | Ga0075428_100000502 | 3300006844 | Bacteria | 39707 |
| 129 | Ga0075428_100002035 | 3300006844 | Bacteria | 21794 |
| 130 | Ga0075428_100341990 | 3300006844 | Bacteria | 1606 |
| 131 | Ga0075428_100455879 | 3300006844 | Bacteria | 1369 |
| 132 | Ga0075428_100524127 | 3300006844 | Bacteria | 1267 |
| 133 | Ga0075428_100593693 | 3300006844 | Bacteria | 1183 |
| 134 | Ga0075428_101171261 | 3300006844 | Bacteria | 811 |
| 135 | Ga0075430_100000620 | 3300006846 | Bacteria | 27115 |
| 136 | Ga0075430_100007238 | 3300006846 | Bacteria | 9371 |
| 137 | Ga0075430_100014819 | 3300006846 | Bacteria | 6639 |
| 138 | Ga0075430_100248243 | 3300006846 | Bacteria | 1475 |
| 139 | Ga0075430_100641390 | 3300006846 | Bacteria | 876 |
| 140 | Ga0075431_100066156 | 3300006847 | Bacteria | 3731 |
| 141 | Ga0075431_100074130 | 3300006847 | Bacteria | 3512 |
| 142 | Ga0075431_100128621 | 3300006847 | Bacteria | 2613 |
| 143 | Ga0075431_100145990 | 3300006847 | Bacteria | 2438 |
| 144 | Ga0075431_100603829 | 3300006847 | Bacteria | 1081 |
| 145 | Ga0075431_100707544 | 3300006847 | Bacteria | 985 |
| 146 | Ga0075433_10000611 | 3300006852 | Bacteria | 23830 |
| 147 | Ga0075433_10233296 | 3300006852 | Bacteria | 1634 |
| 148 | Ga0075433_10322407 | 3300006852 | Bacteria | 1367 |
| 149 | Ga0075433_10441807 | 3300006852 | Bacteria | 1147 |
| 150 | Ga0075434_100000406 | 3300006871 | Bacteria | 31740 |
| 151 | Ga0075434_100007989 | 3300006871 | Bacteria | 9807 |
| 152 | Ga0075434_100064318 | 3300006871 | Bacteria | 3652 |
| 153 | Ga0075429_100000081 | 3300006880 | Bacteria | 49207 |
| 154 | Ga0075429_100000145 | 3300006880 | Bacteria | 43529 |
| 155 | Ga0075429_100078877 | 3300006880 | Bacteria | 2870 |
| 156 | Ga0075429_100123110 | 3300006880 | Bacteria | 2267 |
| 157 | Ga0075429_100128615 | 3300006880 | Bacteria | 2216 |
| 158 | Ga0075429_100250289 | 3300006880 | Bacteria | 1552 |
| 159 | Ga0068865_100000922 | 3300006881 | Bacteria | 16653 |
| 160 | Ga0068865_100001100 | 3300006881 | Bacteria | 15603 |
| 161 | Ga0075436_100000375 | 3300006914 | Bacteria | 28483 |
| 162 | Ga0075436_100000513 | 3300006914 | Bacteria | 25110 |
| 163 | Ga0075436_100275724 | 3300006914 | Bacteria | 1202 |
| 164 | Ga0097620_100008910 | 3300006931 | Bacteria | 10132 |
| 165 | Ga0097620_100054294 | 3300006931 | Bacteria | 4029 |
| 166 | Ga0097620_100102861 | 3300006931 | Bacteria | 2914 |
| 167 | Ga0097620_100223334 | 3300006931 | Bacteria | 1971 |
| 168 | Ga0075435_100000668 | 3300007076 | Bacteria | 21181 |
| 169 | Ga0075435_100000820 | 3300007076 | Bacteria | 19375 |
| 170 | Ga0075435_100038536 | 3300007076 | Bacteria | 3810 |
| 171 | Ga0075435_100094652 | 3300007076 | Bacteria | 2469 |
| 172 | Ga0075435_100122190 | 3300007076 | Bacteria | 2174 |
| 173 | Ga0075435_100194868 | 3300007076 | Bacteria | 1716 |
| 174 | Ga0099794_10018041 | 3300007265 | Bacteria | 3158 |
| 175 | Ga0099794_10027883 | 3300007265 | Bacteria | 2622 |
| 176 | Ga0099794_10240426 | 3300007265 | Bacteria | 933 |
| 177 | Ga0105240_10374347 | 3300009093 | Bacteria | 1609 |
| 178 | Ga0111539_10022821 | 3300009094 | Bacteria | 7686 |
| 179 | Ga0111539_10096189 | 3300009094 | Bacteria | 3478 |
| 180 | Ga0111539_10141863 | 3300009094 | Bacteria | 2812 |
| 181 | Ga0111539_10220095 | 3300009094 | Bacteria | 2211 |
| 182 | Ga0111539_10368556 | 3300009094 | Bacteria | 1672 |
| 183 | Ga0111539_10869191 | 3300009094 | Bacteria | 1049 |
| 184 | Ga0111539_11318386 | 3300009094 | Bacteria | 838 |
| 185 | Ga0105245_10004790 | 3300009098 | Bacteria | 11943 |
| 186 | Ga0105245_10125608 | 3300009098 | Bacteria | 2401 |
| 187 | Ga0114129_10000393 | 3300009147 | Bacteria | 51077 |
| 188 | Ga0114129_10002113 | 3300009147 | Bacteria | 27369 |
| 189 | Ga0114129_10076304 | 3300009147 | Bacteria | 4667 |
| 190 | Ga0114129_10196261 | 3300009147 | Bacteria | 2737 |
| 191 | Ga0114129_10471699 | 3300009147 | Bacteria | 1643 |
| 192 | Ga0114129_12808972 | 3300009147 | Bacteria | 578 |
| 193 | Ga0105243_10016884 | 3300009148 | Bacteria | 5520 |
| 194 | Ga0105243_10047896 | 3300009148 | Bacteria | 3367 |
| 195 | Ga0105243_10231139 | 3300009148 | Bacteria | 1641 |
| 196 | Ga0105243_11198363 | 3300009148 | Unclassified | 772 |
| 197 | Ga0105241_10077029 | 3300009174 | Unclassified | 2602 |
| 198 | Ga0105242_10000296 | 3300009176 | Bacteria | 39554 |
| 199 | Ga0105242_10008018 | 3300009176 | Bacteria | 8134 |
| 200 | Ga0105242_11420768 | 3300009176 | Bacteria | 722 |
| 201 | Ga0105248_10824065 | 3300009177 | Bacteria | 1047 |
| 202 | Ga0105249_10001763 | 3300009553 | Bacteria | 18843 |
| 203 | Ga0105239_10495774 | 3300010375 | Bacteria | 1388 |
| 204 | Ga0105246_10048210 | 3300011119 | Bacteria | 2912 |
| 205 | Ga0157378_10003195 | 3300013297 | Bacteria | 14558 |
| 206 | Ga0157378_10260458 | 3300013297 | Bacteria | 1664 |
| 207 | Ga0163162_10147275 | 3300013306 | Bacteria | 2471 |
| 208 | Ga0157372_10613611 | 3300013307 | Bacteria | 1268 |
| 209 | Ga0157375_10840041 | 3300013308 | Bacteria | 1065 |
| 210 | Ga0157375_11010906 | 3300013308 | Bacteria | 971 |
| 211 | Ga0157380_10029114 | 3300014326 | Bacteria | 4220 |
| 212 | Ga0157380_10279714 | 3300014326 | Bacteria | 1526 |
| 213 | Ga0157377_10034443 | 3300014745 | Bacteria | 2770 |
| 214 | Ga0157379_10053730 | 3300014968 | Bacteria | 3599 |
| 215 | Ga0157376_10011070 | 3300014969 | Bacteria | 6633 |
| 216 | Ga0207653_10007973 | 3300025885 | Bacteria | 3301 |
| 217 | Ga0207653_10019105 | 3300025885 | Bacteria | 2161 |
| 218 | Ga0207642_10014619 | 3300025899 | Bacteria | 2901 |
| 219 | Ga0207642_10265018 | 3300025899 | Bacteria | 981 |
| 220 | Ga0207688_10069086 | 3300025901 | Bacteria | 2002 |
| 221 | Ga0207688_10135061 | 3300025901 | Bacteria | 1448 |
| 222 | Ga0207680_10187394 | 3300025903 | Bacteria | 1402 |
| 223 | Ga0207685_10152804 | 3300025905 | Bacteria | 1046 |
| 224 | Ga0207643_10039448 | 3300025908 | Bacteria | 2656 |
| 225 | Ga0207643_10048143 | 3300025908 | Bacteria | 2414 |
| 226 | Ga0207684_10239857 | 3300025910 | Bacteria | 1564 |
| 227 | Ga0207707_10008207 | 3300025912 | Bacteria | 9062 |
| 228 | Ga0207707_10156666 | 3300025912 | Bacteria | 1992 |
| 229 | Ga0207707_11284380 | 3300025912 | Unclassified | 589 |
| 230 | Ga0207660_10033615 | 3300025917 | Bacteria | 3549 |
| 231 | Ga0207660_10074307 | 3300025917 | Bacteria | 2481 |
| 232 | Ga0207660_10216392 | 3300025917 | Bacteria | 1502 |
| 233 | Ga0207660_10631775 | 3300025917 | Bacteria | 873 |
| 234 | Ga0207662_10000024 | 3300025918 | Bacteria | 70677 |
| 235 | Ga0207662_10246786 | 3300025918 | Bacteria | 1171 |
| 236 | Ga0207662_10287659 | 3300025918 | Bacteria | 1089 |
| 237 | Ga0207662_10356794 | 3300025918 | Bacteria | 983 |
| 238 | Ga0207652_10581920 | 3300025921 | Bacteria | 1005 |
| 239 | Ga0207646_10549906 | 3300025922 | Bacteria | 1038 |
| 240 | Ga0207681_10001419 | 3300025923 | Bacteria | 15459 |
| 241 | Ga0207659_10055430 | 3300025926 | Bacteria | 2835 |
| 242 | Ga0207687_10030729 | 3300025927 | Bacteria | 3624 |
| 243 | Ga0207687_10582823 | 3300025927 | Bacteria | 941 |
| 244 | Ga0207700_10343191 | 3300025928 | Bacteria | 1299 |
| 245 | Ga0207706_10102730 | 3300025933 | Bacteria | 2515 |
| 246 | Ga0207686_10001177 | 3300025934 | Bacteria | 15116 |
| 247 | Ga0207686_10010567 | 3300025934 | Bacteria | 5030 |
| 248 | Ga0207709_10009182 | 3300025935 | Bacteria | 5447 |
| 249 | Ga0207709_10010644 | 3300025935 | Bacteria | 5067 |
| 250 | Ga0207709_10460929 | 3300025935 | Bacteria | 984 |
| 251 | Ga0207670_10002055 | 3300025936 | Bacteria | 10541 |
| 252 | Ga0207670_10164267 | 3300025936 | Bacteria | 1660 |
| 253 | Ga0207670_10203145 | 3300025936 | Bacteria | 1507 |
| 254 | Ga0207669_10062535 | 3300025937 | Bacteria | 2293 |
| 255 | Ga0207704_10000918 | 3300025938 | Bacteria | 13025 |
| 256 | Ga0207704_10003103 | 3300025938 | Bacteria | 7512 |
| 257 | Ga0207665_10046937 | 3300025939 | Bacteria | 2895 |
| 258 | Ga0207691_10214908 | 3300025940 | Bacteria | 1669 |
| 259 | Ga0207691_10562949 | 3300025940 | Bacteria | 966 |
| 260 | Ga0207689_10063599 | 3300025942 | Bacteria | 3035 |
| 261 | Ga0207689_10068059 | 3300025942 | Bacteria | 2926 |
| 262 | Ga0207667_10005789 | 3300025949 | Bacteria | 15080 |
| 263 | Ga0207651_10019775 | 3300025960 | Bacteria | 4046 |
| 264 | Ga0207651_10609819 | 3300025960 | Bacteria | 955 |
| 265 | Ga0207712_10013044 | 3300025961 | Bacteria | 5323 |
| 266 | Ga0207712_10022123 | 3300025961 | Bacteria | 4184 |
| 267 | Ga0207668_10012611 | 3300025972 | Bacteria | 5180 |
| 268 | Ga0207640_10007225 | 3300025981 | Bacteria | 6125 |
| 269 | Ga0207677_10000875 | 3300026023 | Bacteria | 17082 |
| 270 | Ga0207703_10199071 | 3300026035 | Bacteria | 1779 |
| 271 | Ga0207639_10642603 | 3300026041 | Bacteria | 981 |
| 272 | Ga0207708_10002074 | 3300026075 | Bacteria | 14763 |
| 273 | Ga0207708_10374779 | 3300026075 | Bacteria | 1172 |
| 274 | Ga0207708_10543052 | 3300026075 | Bacteria | 979 |
| 275 | Ga0207708_10547219 | 3300026075 | Bacteria | 976 |
| 276 | Ga0207708_10694568 | 3300026075 | Unclassified | 869 |
| 277 | Ga0207702_10209225 | 3300026078 | Bacteria | 1812 |
| 278 | Ga0207641_10133363 | 3300026088 | Bacteria | 2233 |
| 279 | Ga0207648_10005161 | 3300026089 | Bacteria | 13223 |
| 280 | Ga0207648_10014513 | 3300026089 | Bacteria | 7275 |
| 281 | Ga0207648_10049940 | 3300026089 | Bacteria | 3658 |
| 282 | Ga0207648_11112681 | 3300026089 | Bacteria | 741 |
| 283 | Ga0207676_10272943 | 3300026095 | Bacteria | 1532 |
| 284 | Ga0207676_10702801 | 3300026095 | Bacteria | 980 |
| 285 | Ga0207674_10142260 | 3300026116 | Bacteria | 2358 |
| 286 | Ga0207675_100000954 | 3300026118 | Bacteria | 28821 |
| 287 | Ga0207675_100002609 | 3300026118 | Bacteria | 17841 |
| 288 | Ga0207683_10102509 | 3300026121 | Bacteria | 2556 |
| 289 | Ga0209969_1004100 | 3300027360 | Bacteria | 2036 |
| 290 | Ga0209969_1016375 | 3300027360 | Bacteria | 1087 |
| 291 | Ga0209967_1003038 | 3300027364 | Bacteria | 2199 |
| 292 | Ga0209981_1030401 | 3300027378 | Bacteria | 791 |
| 293 | Ga0209996_1010823 | 3300027395 | Bacteria | 1213 |
| 294 | Ga0209996_1022382 | 3300027395 | Bacteria | 894 |
| 295 | Ga0210000_1004382 | 3300027462 | Bacteria | 2040 |
| 296 | Ga0210000_1016163 | 3300027462 | Bacteria | 1126 |
| 297 | Ga0209995_1001101 | 3300027471 | Bacteria | 4155 |
| 298 | Ga0209995_1016483 | 3300027471 | Bacteria | 1214 |
| 299 | Ga0209995_1037772 | 3300027471 | Bacteria | 813 |
| 300 | Ga0209968_1022480 | 3300027526 | Bacteria | 1029 |
| 301 | Ga0209999_1007147 | 3300027543 | Bacteria | 2009 |
| 302 | Ga0209999_1010557 | 3300027543 | Bacteria | 1669 |
| 303 | Ga0210002_1055064 | 3300027617 | Bacteria | 689 |
| 304 | Ga0209966_1001585 | 3300027695 | Bacteria | 3913 |
| 305 | Ga0209966_1019647 | 3300027695 | Bacteria | 1303 |
| 306 | Ga0207428_10009302 | 3300027907 | Bacteria | 8817 |
| 307 | Ga0207428_10028030 | 3300027907 | Bacteria | 4682 |
| 308 | Ga0207428_10036346 | 3300027907 | Bacteria | 4018 |
| 309 | Ga0268265_10004469 | 3300028380 | Bacteria | 9692 |
| 310 | Ga0268265_10009414 | 3300028380 | Bacteria | 6597 |
| 311 | Ga0268265_10335398 | 3300028380 | Unclassified | 1375 |
| 312 | Ga0268265_10360989 | 3300028380 | Bacteria | 1330 |
| 313 | Ga0268264_10000841 | 3300028381 | Bacteria | 32855 |
| 314 | Ga0268264_10741826 | 3300028381 | Bacteria | 978 |
| 315 | Ga0307408_100078396 | 3300031548 | Bacteria | 2462 |
| 316 | Ga0307408_100539331 | 3300031548 | Bacteria | 1028 |
| 317 | Ga0307413_10475038 | 3300031824 | Bacteria | 998 |
| 318 | Ga0307410_10820010 | 3300031852 | Bacteria | 792 |
| 319 | Ga0307407_10584124 | 3300031903 | Bacteria | 830 |
| 320 | Ga0307409_100208017 | 3300031995 | Bacteria | 1756 |
| 321 | Ga0307416_100409488 | 3300032002 | Bacteria | 1396 |
| 322 | Ga0307416_100428887 | 3300032002 | Bacteria | 1369 |
| 323 | Ga0307416_100568855 | 3300032002 | Bacteria | 1209 |
| 324 | Ga0307411_10152968 | 3300032005 | Bacteria | 1717 |
| 325 | Ga0307411_10206451 | 3300032005 | Bacteria | 1513 |
| 326 | Ga0373930_0046016 | 3300034816 | Bacteria | 941 |
| 327 | Ga0373948_0002713 | 3300034817 | Bacteria | 2647 |
| 328 | Ga0373950_0007812 | 3300034818 | Bacteria | 1669 |
| 329 | Ga0373938_0025120 | 3300034957 | Bacteria | 1237 |
| 330 | Ga0373928_0018806 | 3300035084 | Bacteria | 1436 |
| 331 | Ga0373929_0069443 | 3300035085 | Bacteria | 840 |
| 332 | Ga0373940_0024050 | 3300035088 | Bacteria | 1577 |
| 333 | Ga0373932_0001177 | 3300035112 | Bacteria | 7478 |
| 334 | Ga0373936_0202024 | 3300035113 | Bacteria | 877 |
| 335 | Ga0373939_0049430 | 3300035114 | Unclassified | 1300 |
| 336 | Ga0373941_0014998 | 3300035115 | Bacteria | 2082 |
| 337 | Ga0373941_0055604 | 3300035115 | Bacteria | 1272 |
| 338 | Ga0373941_0171538 | 3300035115 | Bacteria | 809 |
| 339 | Ga0373961_0002326 | 3300035241 | Bacteria | 4967 |
| 340 | Ga0373961_0152895 | 3300035241 | Bacteria | 787 |
| 341 | Ga0373962_0077378 | 3300035242 | Bacteria | 1004 |
| 342 | Ga0373931_0000177 | 3300035691 | Bacteria | 27824 |
| 343 | Ga0373931_0012034 | 3300035691 | Bacteria | 4188 |
| 344 | Ga0373931_0026008 | 3300035691 | Bacteria | 2975 |
| 345 | Ga0373931_0187183 | 3300035691 | Bacteria | 1229 |
| 346 | Ga0373931_0386226 | 3300035691 | Bacteria | 884 |
| 347 | Ga0373937_0127278 | 3300036401 | Bacteria | 2377 |
| 348 | Ga0439439_0031632 | 3300041406 | Bacteria | 1349 |
| 349 | Ga0439453_0027668 | 3300041408 | Bacteria | 1057 |
| 350 | Ga0439461_0049558 | 3300041410 | Bacteria | 928 |
| 351 | Ga0451804_1068127 | 3300041463 | Bacteria | 959 |
| 352 | Ga0451853_1506806 | 3300041512 | Bacteria | 1485 |
| 353 | Ga0439441_013204 | 3300042001 | Bacteria | 1430 |
| 354 | Ga0439443_001907 | 3300042003 | Bacteria | 2405 |
| 355 | Ga0439450_070826 | 3300042008 | Bacteria | 855 |
| 356 | Ga0439451_005225 | 3300042009 | Bacteria | 2642 |
| 357 | Ga0439462_0097402 | 3300042015 | Bacteria | 809 |
| 358 | Ga0439446_0003451 | 3300042156 | Bacteria | 3927 |
| 359 | Ga0439434_0003761 | 3300042435 | Bacteria | 4434 |
| 360 | Ga0439434_0170684 | 3300042435 | Bacteria | 726 |
| 361 | Ga0439435_0000966 | 3300042436 | Bacteria | 5009 |
| 362 | Ga0439435_0018938 | 3300042436 | Bacteria | 1757 |
| 363 | Ga0439444_0000672 | 3300042437 | Bacteria | 4001 |
| 364 | Ga0439444_0009256 | 3300042437 | Bacteria | 1549 |
| 365 | Ga0439459_0016797 | 3300042438 | Bacteria | 1356 |
| 366 | Ga0439460_0001831 | 3300042461 | Bacteria | 5068 |
| 367 | Ga0451577_0164051 | 3300042876 | Bacteria | 2002 |
| 368 | Ga0451576_0009298 | 3300045051 | Bacteria | 11411 |
| 369 | Ga0451576_0020989 | 3300045051 | Bacteria | 7107 |
| 370 | Ga0451576_0026259 | 3300045051 | Bacteria | 6265 |
| 371 | Ga0495603_0192646 | 3300046455 | Bacteria | 1179 |
| 372 | Ga0495662_0043151 | 3300046476 | Bacteria | 2177 |
| 373 | Ga0495608_0037973 | 3300046511 | Bacteria | 3237 |
| 374 | Ga0495628_0009779 | 3300046516 | Bacteria | 8172 |
| 375 | Ga0495630_0019320 | 3300046517 | Bacteria | 5008 |
| 376 | Ga0495630_0827260 | 3300046517 | Bacteria | 706 |
| 377 | Ga0495663_0136464 | 3300046525 | Bacteria | 830 |
| 378 | Ga0495666_0031461 | 3300046526 | Bacteria | 2600 |
| 379 | Ga0495652_0031366 | 3300046529 | Bacteria | 4655 |
| 380 | Ga0495640_0032561 | 3300046533 | Bacteria | 3712 |
| 381 | Ga0495640_0088600 | 3300046533 | Bacteria | 2045 |
| 382 | Ga0495586_0011534 | 3300046535 | Bacteria | 4701 |
| 383 | Ga0495586_0027203 | 3300046535 | Bacteria | 3060 |
| 384 | Ga0495598_0245694 | 3300046537 | Unclassified | 661 |
| 385 | Ga0495621_0008822 | 3300046539 | Bacteria | 3037 |
| 386 | Ga0495621_0078555 | 3300046539 | Bacteria | 1227 |
| 387 | Ga0495621_0099042 | 3300046539 | Bacteria | 1107 |
| 388 | Ga0495621_0117572 | 3300046539 | Bacteria | 1025 |
| 389 | Ga0495667_0014782 | 3300046559 | Bacteria | 5275 |
| 390 | Ga0495635_0073380 | 3300046663 | Bacteria | 2344 |
| 391 | Ga0495659_0048579 | 3300046664 | Bacteria | 1538 |
| 392 | Ga0495646_0141136 | 3300046680 | Bacteria | 1347 |
| 393 | Ga0495658_0021201 | 3300046683 | Bacteria | 3423 |
| 394 | Ga0495658_0034706 | 3300046683 | Bacteria | 2769 |
| 395 | Ga0495669_0022285 | 3300046684 | Bacteria | 2751 |
| 396 | Ga0495669_0046200 | 3300046684 | Bacteria | 1943 |
| 397 | Ga0495669_0166321 | 3300046684 | Bacteria | 1048 |
| 398 | Ga0495613_0008807 | 3300046689 | Bacteria | 7483 |
| 399 | Ga0495624_0056350 | 3300046690 | Bacteria | 2473 |
| 400 | Ga0495600_0012118 | 3300046809 | Bacteria | 5385 |
| 401 | Ga0495581_0205766 | 3300047315 | Bacteria | 1151 |
| 402 | Ga0495604_0017573 | 3300047317 | Bacteria | 5726 |
| 403 | Ga0495636_0001613 | 3300047318 | Bacteria | 8574 |
| 404 | Ga0495680_0004125 | 3300047322 | Bacteria | 13968 |
| 405 | Ga0501291_019296 | 3300049514 | Bacteria | 1069 |
| 406 | Ga0501298_009420 | 3300049521 | Bacteria | 1661 |
| 407 | Ga0501299_029320 | 3300049522 | Bacteria | 1053 |
| 408 | Ga0501031_0026854 | 3300049568 | Bacteria | 3753 |
| 409 | Ga0501031_0285658 | 3300049568 | Bacteria | 1070 |
| 410 | Ga0501033_0016766 | 3300049570 | Bacteria | 5542 |
| 411 | Ga0501034_1345022 | 3300049571 | Unclassified | 590 |
| 412 | Ga0501036_0008179 | 3300049572 | Bacteria | 8575 |
| 413 | Ga0501036_0400854 | 3300049572 | Bacteria | 1144 |
| 414 | Ga0501036_0734589 | 3300049572 | Bacteria | 815 |
| 415 | Ga0501037_0012879 | 3300049573 | Bacteria | 6165 |
| 416 | Ga0501037_0042031 | 3300049573 | Bacteria | 3360 |
| 417 | Ga0501037_0202080 | 3300049573 | Bacteria | 1404 |
| 418 | Ga0501038_0011271 | 3300049574 | Bacteria | 8163 |
| 419 | Ga0501038_0034843 | 3300049574 | Bacteria | 4424 |
| 420 | Ga0501039_0007682 | 3300049575 | Bacteria | 8231 |
| 421 | Ga0501039_0020405 | 3300049575 | Bacteria | 5078 |
| 422 | Ga0501039_0163118 | 3300049575 | Bacteria | 1752 |
| 423 | Ga0501039_0190250 | 3300049575 | Bacteria | 1614 |
| 424 | Ga0501039_0237314 | 3300049575 | Bacteria | 1434 |
| 425 | Ga0501039_0251229 | 3300049575 | Bacteria | 1390 |
| 426 | Ga0501039_0268630 | 3300049575 | Unclassified | 1341 |
| 427 | Ga0501040_0006268 | 3300049576 | Bacteria | 7722 |
| 428 | Ga0501040_0028332 | 3300049576 | Bacteria | 3775 |
| 429 | Ga0501040_0030687 | 3300049576 | Bacteria | 3631 |
| 430 | Ga0501040_0053644 | 3300049576 | Bacteria | 2762 |
| 431 | Ga0501040_0105899 | 3300049576 | Bacteria | 1965 |
| 432 | Ga0501041_0000358 | 3300049577 | Bacteria | 22614 |
| 433 | Ga0501041_0007744 | 3300049577 | Bacteria | 6307 |
| 434 | Ga0501042_0000291 | 3300049578 | Bacteria | 24757 |
| 435 | Ga0501042_0096681 | 3300049578 | Bacteria | 2122 |
| 436 | Ga0501042_0180846 | 3300049578 | Bacteria | 1521 |
| 437 | Ga0501042_0309311 | 3300049578 | Bacteria | 1142 |
| 438 | Ga0501042_0377229 | 3300049578 | Bacteria | 1027 |
| 439 | Ga0501043_0048212 | 3300049579 | Bacteria | 3349 |
| 440 | Ga0501043_0230598 | 3300049579 | Bacteria | 1430 |
| 441 | Ga0501043_0417302 | 3300049579 | Bacteria | 1012 |
| 442 | Ga0501046_0010378 | 3300049580 | Bacteria | 8003 |
| 443 | Ga0501046_0073060 | 3300049580 | Bacteria | 2662 |
| 444 | Ga0501047_1089663 | 3300049581 | Bacteria | 612 |
| 445 | Ga0501048_0016337 | 3300049582 | Bacteria | 5469 |
| 446 | Ga0501048_0520648 | 3300049582 | Bacteria | 853 |
| 447 | Ga0501068_0109167 | 3300049584 | Bacteria | 1719 |
| 448 | Ga0501069_0209621 | 3300049585 | Bacteria | 1131 |
| 449 | Ga0501071_0004120 | 3300049587 | Bacteria | 9189 |
| 450 | Ga0501071_0050912 | 3300049587 | Bacteria | 2983 |
| 451 | Ga0501071_0053220 | 3300049587 | Bacteria | 2919 |
| 452 | Ga0501071_0092717 | 3300049587 | Bacteria | 2220 |
| 453 | Ga0501071_0399535 | 3300049587 | Bacteria | 1049 |
| 454 | Ga0501072_0000720 | 3300049588 | Bacteria | 24044 |
| 455 | Ga0501072_0001286 | 3300049588 | Bacteria | 18770 |
| 456 | Ga0501072_0016019 | 3300049588 | Bacteria | 5749 |
| 457 | Ga0501072_0133284 | 3300049588 | Bacteria | 1981 |
| 458 | Ga0501072_0140334 | 3300049588 | Bacteria | 1926 |
| 459 | Ga0501072_0148958 | 3300049588 | Bacteria | 1866 |
| 460 | Ga0501072_0311253 | 3300049588 | Bacteria | 1252 |
| 461 | Ga0501072_0366753 | 3300049588 | Bacteria | 1143 |
| 462 | Ga0501074_0056482 | 3300049590 | Bacteria | 2829 |
| 463 | Ga0501074_0408588 | 3300049590 | Bacteria | 963 |
| 464 | Ga0501074_0723867 | 3300049590 | Bacteria | 702 |
| 465 | Ga0501075_0005455 | 3300049591 | Bacteria | 8697 |
| 466 | Ga0501075_0052774 | 3300049591 | Bacteria | 3057 |
| 467 | Ga0501075_0060896 | 3300049591 | Bacteria | 2843 |
| 468 | Ga0501075_0248915 | 3300049591 | Bacteria | 1354 |
| 469 | Ga0501076_0002120 | 3300049592 | Bacteria | 13613 |
| 470 | Ga0501076_0002813 | 3300049592 | Bacteria | 12033 |
| 471 | Ga0501076_0003881 | 3300049592 | Bacteria | 10528 |
| 472 | Ga0501076_0590243 | 3300049592 | Bacteria | 916 |
| 473 | Ga0501077_0004484 | 3300049593 | Bacteria | 8478 |
| 474 | Ga0501077_0020675 | 3300049593 | Bacteria | 4167 |
| 475 | Ga0501077_0033120 | 3300049593 | Bacteria | 3290 |
| 476 | Ga0501077_0130444 | 3300049593 | Bacteria | 1594 |
| 477 | Ga0501209_049413 | 3300049656 | Bacteria | 1143 |
| 478 | Ga0501216_047758 | 3300049660 | Bacteria | 835 |
| 479 | Ga0501217_024459 | 3300049661 | Bacteria | 1445 |
| 480 | Ga0501217_215945 | 3300049661 | Bacteria | 604 |
| 481 | Ga0501249_029062 | 3300049679 | Bacteria | 1228 |
| 482 | Ga0501219_011674 | 3300049703 | Bacteria | 673 |
| 483 | Ga0501225_0039011 | 3300049705 | Bacteria | 1309 |
| 484 | Ga0501234_038330 | 3300049707 | Bacteria | 782 |
| 485 | Ga0501245_016687 | 3300049708 | Bacteria | 1116 |
| 486 | Ga0501079_0013275 | 3300049741 | Bacteria | 6280 |
| 487 | Ga0501079_0015686 | 3300049741 | Bacteria | 5787 |
| 488 | Ga0501079_0088100 | 3300049741 | Bacteria | 2403 |
| 489 | Ga0501079_0253768 | 3300049741 | Bacteria | 1375 |
| 490 | Ga0501080_0109009 | 3300049742 | Bacteria | 2566 |
| 491 | Ga0501080_0138422 | 3300049742 | Bacteria | 2252 |
| 492 | Ga0501080_0151342 | 3300049742 | Bacteria | 2144 |
| 493 | Ga0501080_0290203 | 3300049742 | Bacteria | 1485 |
| 494 | Ga0501081_0002739 | 3300049743 | Bacteria | 11163 |
| 495 | Ga0501081_0003592 | 3300049743 | Bacteria | 9924 |
| 496 | Ga0501081_0010072 | 3300049743 | Bacteria | 6165 |
| 497 | Ga0501081_0226647 | 3300049743 | Bacteria | 1360 |
| 498 | Ga0501081_0232757 | 3300049743 | Unclassified | 1342 |
| 499 | Ga0501083_0113734 | 3300049744 | Bacteria | 1778 |
| 500 | Ga0501083_0327977 | 3300049744 | Bacteria | 995 |
| 501 | Ga0501083_0541927 | 3300049744 | Bacteria | 757 |
| 502 | Ga0501280_095625 | 3300049776 | Bacteria | 565 |
| 503 | Ga0501283_056889 | 3300049779 | Bacteria | 701 |
| 504 | Ga0501035_0010832 | 3300049822 | Bacteria | 8445 |
| 505 | Ga0501035_0092695 | 3300049822 | Bacteria | 2658 |
| 506 | Ga0501035_0104044 | 3300049822 | Bacteria | 2490 |
| 507 | Ga0501044_0333287 | 3300049823 | Bacteria | 1440 |
| 508 | Ga0501045_0005295 | 3300049824 | Bacteria | 8938 |
| 509 | Ga0501045_0366137 | 3300049824 | Bacteria | 1073 |
| 510 | Ga0501226_015909 | 3300049853 | Bacteria | 829 |
| 511 | nmdc:mga05p37_2146_c1 | 3300050507 | Bacteria | 23034 |
| 512 | nmdc:mga05p37_266246_c1 | 3300050507 | Bacteria | 2049 |
| 513 | nmdc:mga05p37_572138_c1 | 3300050507 | Bacteria | 1281 |
| 514 | nmdc:mga05p37_74562_c1 | 3300050507 | Bacteria | 4176 |
| 515 | nmdc:mga05p37_775_c1 | 3300050507 | Bacteria | 35507 |
| 516 | nmdc:mga09592_109817_c1 | 3300050508 | Bacteria | 2366 |
| 517 | nmdc:mga09592_126809_c1 | 3300050508 | Bacteria | 2194 |
| 518 | nmdc:mga09592_1359803_c1 | 3300050508 | Bacteria | 582 |
| 519 | nmdc:mga09592_148_c1 | 3300050508 | Bacteria | 47706 |
| 520 | nmdc:mga09592_253145_c1 | 3300050508 | Bacteria | 1527 |
| 521 | nmdc:mga09592_26_c1 | 3300050508 | Bacteria | 84260 |
| 522 | nmdc:mga09592_34000_c1 | 3300050508 | Bacteria | 4260 |
| 523 | nmdc:mga09592_422796_c1 | 3300050508 | Bacteria | 1151 |
| 524 | nmdc:mga09592_87291_c1 | 3300050508 | Bacteria | 2663 |
| 525 | nmdc:mga0qj67_1004775_c1 | 3300050509 | Bacteria | 654 |
| 526 | nmdc:mga0qj67_12222_c1 | 3300050509 | Bacteria | 6463 |
| 527 | nmdc:mga0qj67_350279_c1 | 3300050509 | Bacteria | 1194 |
| 528 | nmdc:mga0qj67_38899_c1 | 3300050509 | Bacteria | 3733 |
| 529 | nmdc:mga0qj67_58443_c1 | 3300050509 | Bacteria | 3058 |
| 530 | nmdc:mga0qj67_715866_c1 | 3300050509 | Bacteria | 796 |
| 531 | nmdc:mga0qj67_740_c1 | 3300050509 | Bacteria | 22151 |
| 532 | nmdc:mga0qj67_873766_c1 | 3300050509 | Unclassified | 709 |
| 533 | nmdc:mga0qj67_933637_c1 | 3300050509 | Bacteria | 683 |
| 534 | nmdc:mga06r32_124849_c2 | 3300050510 | Bacteria | 792 |
| 535 | nmdc:mga06r32_21812_c1 | 3300050510 | Bacteria | 5914 |
| 536 | nmdc:mga06r32_248162_c1 | 3300050510 | Bacteria | 1768 |
| 537 | nmdc:mga06r32_33186_c1 | 3300050510 | Bacteria | 4861 |
| 538 | nmdc:mga06r32_354814_c1 | 3300050510 | Bacteria | 1451 |
| 539 | nmdc:mga06r32_451746_c1 | 3300050510 | Bacteria | 1265 |
| 540 | nmdc:mga06r32_81914_c1 | 3300050510 | Bacteria | 3143 |
| 541 | nmdc:mga06r32_89483_c1 | 3300050510 | Bacteria | 3006 |
| 542 | nmdc:mga08y16_142861_c1 | 3300050511 | Bacteria | 2488 |
| 543 | nmdc:mga08y16_1941_c1 | 3300050511 | Bacteria | 21104 |
| 544 | nmdc:mga08y16_21668_c1 | 3300050511 | Bacteria | 6784 |
| 545 | nmdc:mga08y16_220096_c1 | 3300050511 | Bacteria | 1966 |
| 546 | nmdc:mga08y16_377830_c1 | 3300050511 | Bacteria | 1453 |
| 547 | nmdc:mga08y16_79226_c1 | 3300050511 | Bacteria | 3424 |
| 548 | nmdc:mga08y16_864518_c1 | 3300050511 | Bacteria | 893 |
| 549 | nmdc:mga08y16_873553_c1 | 3300050511 | Bacteria | 887 |
| 550 | nmdc:mga08y16_916981_c1 | 3300050511 | Bacteria | 861 |
| 551 | nmdc:mga0n895_1820_c1 | 3300050512 | Bacteria | 16236 |
| 552 | nmdc:mga0n895_83407_c1 | 3300050512 | Bacteria | 3188 |
| 553 | nmdc:mga0n895_924_c1 | 3300050512 | Bacteria | 21172 |
| 554 | nmdc:mga0rr50_1686_c1 | 3300050513 | Bacteria | 12197 |
| 555 | nmdc:mga0rr50_2253_c1 | 3300050513 | Bacteria | 10830 |
| 556 | nmdc:mga0rr50_4538_c1 | 3300050513 | Bacteria | 8177 |
| 557 | nmdc:mga08x19_280598_c1 | 3300050514 | Bacteria | 1154 |
| 558 | nmdc:mga08x19_418697_c1 | 3300050514 | Bacteria | 941 |
| 559 | nmdc:mga08x19_46296_c1 | 3300050514 | Bacteria | 2453 |
| 560 | nmdc:mga08x19_820_c1 | 3300050514 | Bacteria | 19741 |
| 561 | nmdc:mga08x19_834_c1 | 3300050514 | Bacteria | 19567 |
| 562 | nmdc:mga08x19_8472_c1 | 3300050514 | Bacteria | 6124 |
| 563 | nmdc:mga0a205_1015089_c1 | 3300050515 | Bacteria | 677 |
| 564 | nmdc:mga0a205_14210_c1 | 3300050515 | Bacteria | 7425 |
| 565 | nmdc:mga0a205_642632_c1 | 3300050515 | Bacteria | 912 |
| 566 | nmdc:mga0a205_821_c1 | 3300050515 | Bacteria | 25293 |
| 567 | Ga0495612_0043897 | 3300053078 | Bacteria | 1828 |
| 568 | Ga0501084_0000832 | 3300054114 | Bacteria | 23774 |
| 569 | Ga0501084_0031510 | 3300054114 | Bacteria | 4433 |
| 570 | Ga0501084_0036193 | 3300054114 | Bacteria | 4124 |
| 571 | Ga0501084_0079464 | 3300054114 | Bacteria | 2749 |
| 572 | Ga0501084_1106066 | 3300054114 | Bacteria | 665 |
| 573 | Ga0590077_012905 | 3300059426 | Bacteria | 1734 |
| 574 | Ga0590077_025698 | 3300059426 | Bacteria | 1270 |
| 575 | Ga0501082_0013472 | 3300060353 | Bacteria | 7024 |
| 576 | Ga0501082_0016106 | 3300060353 | Bacteria | 6431 |
| 577 | Ga0501082_0154999 | 3300060353 | Bacteria | 1990 |
| 578 | Ga0501082_0330478 | 3300060353 | Bacteria | 1328 |
| 579 | Ga0530510_0000042 | 3300061734 | Bacteria | 58436 |
| 580 | Ga0530510_0002067 | 3300061734 | Bacteria | 13794 |
| 581 | Ga0530510_0003012 | 3300061734 | Bacteria | 11558 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049822 | Ga0501035_0010832 | Ga0501035_0010832_1479_1979 | 166 |
| 2 | 3300046684 | Ga0495669_0166321 | Ga0495669_0166321_111_659 | 167 |
| 3 | 3300050507 | nmdc:mga05p37_266246_c1 | nmdc:mga05p37_266246_c1_1269_1820 | 170 |
| 4 | 3300050509 | nmdc:mga0qj67_715866_c1 | nmdc:mga0qj67_715866_c1_17_529 | 170 |
| 5 | 3300046455 | Ga0495603_0192646 | Ga0495603_0192646_11_529 | 172 |
| 6 | 3300049776 | Ga0501280_095625 | Ga0501280_095625_20_541 | 173 |
| 7 | 3300049593 | Ga0501077_0033120 | Ga0501077_0033120_2517_3044 | 175 |
| 8 | 3300009094 | Ga0111539_10141863 | Ga0111539_101418633 | 176 |
| 9 | 3300009148 | Ga0105243_10047896 | Ga0105243_100478963 | 176 |
| 10 | 3300009553 | Ga0105249_10001763 | Ga0105249_1000176310 | 176 |
| 11 | 3300013306 | Ga0163162_10147275 | Ga0163162_101472753 | 176 |
| 12 | 3300013308 | Ga0157375_10840041 | Ga0157375_108400412 | 176 |
| 13 | 3300014326 | Ga0157380_10029114 | Ga0157380_100291142 | 176 |
| 14 | 3300050511 | nmdc:mga08y16_21668_c1 | nmdc:mga08y16_21668_c1_924_1454 | 176 |
| 15 | 3300050515 | nmdc:mga0a205_1015089_c1 | nmdc:mga0a205_1015089_c1_13_543 | 176 |
| 16 | 3300005295 | Ga0065707_10236602 | Ga0065707_102366022 | 179 |
| 17 | 3300005336 | Ga0070680_101071012 | Ga0070680_1010710121 | 180 |
| 18 | 3300005458 | Ga0070681_10806653 | Ga0070681_108066532 | 180 |
| 19 | 3300006844 | Ga0075428_100002035 | Ga0075428_10000203522 | 180 |
| 20 | 3300006880 | Ga0075429_100250289 | Ga0075429_1002502892 | 180 |
| 21 | 3300009094 | Ga0111539_10022821 | Ga0111539_100228213 | 180 |
| 22 | 3300025917 | Ga0207660_10631775 | Ga0207660_106317752 | 180 |
| 23 | 3300027907 | Ga0207428_10028030 | Ga0207428_100280303 | 180 |
| 24 | 3300049573 | Ga0501037_0012879 | Ga0501037_0012879_2595_3143 | 180 |
| 25 | 3300049574 | Ga0501038_0034843 | Ga0501038_0034843_3719_4267 | 180 |
| 26 | 3300049576 | Ga0501040_0053644 | Ga0501040_0053644_356_904 | 180 |
| 27 | 3300049577 | Ga0501041_0007744 | Ga0501041_0007744_449_997 | 180 |
| 28 | 3300049579 | Ga0501043_0230598 | Ga0501043_0230598_429_977 | 180 |
| 29 | 3300049581 | Ga0501047_1089663 | Ga0501047_1089663_28_576 | 180 |
| 30 | 3300049584 | Ga0501068_0109167 | Ga0501068_0109167_588_1136 | 180 |
| 31 | 3300049587 | Ga0501071_0092717 | Ga0501071_0092717_578_1126 | 180 |
| 32 | 3300049588 | Ga0501072_0133284 | Ga0501072_0133284_607_1155 | 180 |
| 33 | 3300049591 | Ga0501075_0248915 | Ga0501075_0248915_765_1313 | 180 |
| 34 | 3300049592 | Ga0501076_0002813 | Ga0501076_0002813_2593_3141 | 180 |
| 35 | 3300049593 | Ga0501077_0130444 | Ga0501077_0130444_327_875 | 180 |
| 36 | 3300049741 | Ga0501079_0088100 | Ga0501079_0088100_412_960 | 180 |
| 37 | 3300049742 | Ga0501080_0109009 | Ga0501080_0109009_1271_1819 | 180 |
| 38 | 3300049743 | Ga0501081_0003592 | Ga0501081_0003592_8575_9123 | 180 |
| 39 | 3300049744 | Ga0501083_0541927 | Ga0501083_0541927_183_731 | 180 |
| 40 | 3300049822 | Ga0501035_0092695 | Ga0501035_0092695_1733_2281 | 180 |
| 41 | 3300050508 | nmdc:mga09592_87291_c1 | nmdc:mga09592_87291_c1_1627_2169 | 180 |
| 42 | 3300050511 | nmdc:mga08y16_1941_c1 | nmdc:mga08y16_1941_c1_2218_2760 | 180 |
| 43 | 3300054114 | Ga0501084_0031510 | Ga0501084_0031510_1411_1959 | 180 |
| 44 | 3300060353 | Ga0501082_0016106 | Ga0501082_0016106_2594_3142 | 180 |
| 45 | 3300003322 | rootL2_10098582 | rootL2_100985822 | 182 |
| 46 | 3300005340 | Ga0070689_100272462 | Ga0070689_1002724622 | 182 |
| 47 | 3300005545 | Ga0070695_100125896 | Ga0070695_1001258962 | 182 |
| 48 | 3300005549 | Ga0070704_100267208 | Ga0070704_1002672082 | 182 |
| 49 | 3300009094 | Ga0111539_10096189 | Ga0111539_100961892 | 182 |
| 50 | 3300009147 | Ga0114129_10471699 | Ga0114129_104716992 | 182 |
| 51 | 3300009147 | Ga0114129_12808972 | Ga0114129_128089721 | 182 |
| 52 | 3300026121 | Ga0207683_10102509 | Ga0207683_101025092 | 182 |
| 53 | 3300027617 | Ga0210002_1055064 | Ga0210002_10550641 | 182 |
| 54 | 3300035691 | Ga0373931_0386226 | Ga0373931_0386226_153_704 | 182 |
| 55 | 3300041463 | Ga0451804_1068127 | Ga0451804_1068127_244_795 | 182 |
| 56 | 3300042876 | Ga0451577_0164051 | Ga0451577_0164051_822_1373 | 182 |
| 57 | 3300045051 | Ga0451576_0026259 | Ga0451576_0026259_4918_5469 | 182 |
| 58 | 3300046539 | Ga0495621_0117572 | Ga0495621_0117572_293_844 | 182 |
| 59 | 3300046664 | Ga0495659_0048579 | Ga0495659_0048579_798_1349 | 182 |
| 60 | 3300046684 | Ga0495669_0022285 | Ga0495669_0022285_1614_2165 | 182 |
| 61 | 3300049575 | Ga0501039_0190250 | Ga0501039_0190250_1028_1579 | 182 |
| 62 | 3300049578 | Ga0501042_0377229 | Ga0501042_0377229_161_712 | 182 |
| 63 | 3300049743 | Ga0501081_0226647 | Ga0501081_0226647_38_589 | 182 |
| 64 | 3300050508 | nmdc:mga09592_253145_c1 | nmdc:mga09592_253145_c1_554_1102 | 182 |
| 65 | 3300050510 | nmdc:mga06r32_451746_c1 | nmdc:mga06r32_451746_c1_249_797 | 182 |
| 66 | 3300050511 | nmdc:mga08y16_79226_c1 | nmdc:mga08y16_79226_c1_2204_2755 | 182 |
| 67 | 3300060353 | Ga0501082_0330478 | Ga0501082_0330478_562_1113 | 182 |
| 68 | 3300005289 | Ga0065704_10048997 | Ga0065704_100489972 | 183 |
| 69 | 3300005293 | Ga0065715_10539767 | Ga0065715_105397671 | 183 |
| 70 | 3300005295 | Ga0065707_10304391 | Ga0065707_103043912 | 183 |
| 71 | 3300005329 | Ga0070683_100884718 | Ga0070683_1008847181 | 183 |
| 72 | 3300005330 | Ga0070690_100067372 | Ga0070690_1000673722 | 183 |
| 73 | 3300005330 | Ga0070690_100099247 | Ga0070690_1000992471 | 183 |
| 74 | 3300005335 | Ga0070666_10079352 | Ga0070666_100793522 | 183 |
| 75 | 3300005336 | Ga0070680_100004944 | Ga0070680_1000049442 | 183 |
| 76 | 3300005336 | Ga0070680_100208195 | Ga0070680_1002081952 | 183 |
| 77 | 3300005337 | Ga0070682_100032167 | Ga0070682_1000321673 | 183 |
| 78 | 3300005338 | Ga0068868_100076429 | Ga0068868_1000764292 | 183 |
| 79 | 3300005340 | Ga0070689_100016666 | Ga0070689_1000166662 | 183 |
| 80 | 3300005340 | Ga0070689_100234177 | Ga0070689_1002341772 | 183 |
| 81 | 3300005341 | Ga0070691_10032606 | Ga0070691_100326062 | 183 |
| 82 | 3300005345 | Ga0070692_10031298 | Ga0070692_100312983 | 183 |
| 83 | 3300005364 | Ga0070673_100767185 | Ga0070673_1007671851 | 183 |
| 84 | 3300005365 | Ga0070688_100617286 | Ga0070688_1006172861 | 183 |
| 85 | 3300005406 | Ga0070703_10019000 | Ga0070703_100190002 | 183 |
| 86 | 3300005435 | Ga0070714_100075644 | Ga0070714_1000756443 | 183 |
| 87 | 3300005436 | Ga0070713_100632592 | Ga0070713_1006325922 | 183 |
| 88 | 3300005438 | Ga0070701_10024217 | Ga0070701_100242172 | 183 |
| 89 | 3300005440 | Ga0070705_100000974 | Ga0070705_1000009742 | 183 |
| 90 | 3300005440 | Ga0070705_100001341 | Ga0070705_1000013412 | 183 |
| 91 | 3300005441 | Ga0070700_100030484 | Ga0070700_1000304842 | 183 |
| 92 | 3300005444 | Ga0070694_100001628 | Ga0070694_10000162813 | 183 |
| 93 | 3300005444 | Ga0070694_100023032 | Ga0070694_1000230324 | 183 |
| 94 | 3300005444 | Ga0070694_100151778 | Ga0070694_1001517782 | 183 |
| 95 | 3300005444 | Ga0070694_100284050 | Ga0070694_1002840502 | 183 |
| 96 | 3300005445 | Ga0070708_100281739 | Ga0070708_1002817392 | 183 |
| 97 | 3300005456 | Ga0070678_101275075 | Ga0070678_1012750751 | 183 |
| 98 | 3300005458 | Ga0070681_10001134 | Ga0070681_1000113414 | 183 |
| 99 | 3300005459 | Ga0068867_100019717 | Ga0068867_1000197174 | 183 |
| 100 | 3300005459 | Ga0068867_100308954 | Ga0068867_1003089542 | 183 |
| 101 | 3300005467 | Ga0070706_100378908 | Ga0070706_1003789082 | 183 |
| 102 | 3300005468 | Ga0070707_100097822 | Ga0070707_1000978221 | 183 |
| 103 | 3300005471 | Ga0070698_100057229 | Ga0070698_1000572292 | 183 |
| 104 | 3300005518 | Ga0070699_100589686 | Ga0070699_1005896861 | 183 |
| 105 | 3300005530 | Ga0070679_100016778 | Ga0070679_1000167782 | 183 |
| 106 | 3300005530 | Ga0070679_100432236 | Ga0070679_1004322362 | 183 |
| 107 | 3300005536 | Ga0070697_100015045 | Ga0070697_1000150455 | 183 |
| 108 | 3300005536 | Ga0070697_100371343 | Ga0070697_1003713431 | 183 |
| 109 | 3300005536 | Ga0070697_100557792 | Ga0070697_1005577922 | 183 |
| 110 | 3300005539 | Ga0068853_100420705 | Ga0068853_1004207052 | 183 |
| 111 | 3300005544 | Ga0070686_100039307 | Ga0070686_1000393072 | 183 |
| 112 | 3300005544 | Ga0070686_100061149 | Ga0070686_1000611492 | 183 |
| 113 | 3300005544 | Ga0070686_100187000 | Ga0070686_1001870002 | 183 |
| 114 | 3300005545 | Ga0070695_100005191 | Ga0070695_1000051913 | 183 |
| 115 | 3300005545 | Ga0070695_100036044 | Ga0070695_1000360442 | 183 |
| 116 | 3300005545 | Ga0070695_100122869 | Ga0070695_1001228692 | 183 |
| 117 | 3300005545 | Ga0070695_100458107 | Ga0070695_1004581072 | 183 |
| 118 | 3300005546 | Ga0070696_100000273 | Ga0070696_10000027318 | 183 |
| 119 | 3300005546 | Ga0070696_100000739 | Ga0070696_10000073912 | 183 |
| 120 | 3300005546 | Ga0070696_100000933 | Ga0070696_1000009339 | 183 |
| 121 | 3300005546 | Ga0070696_100054645 | Ga0070696_1000546453 | 183 |
| 122 | 3300005546 | Ga0070696_100137589 | Ga0070696_1001375892 | 183 |
| 123 | 3300005546 | Ga0070696_100159155 | Ga0070696_1001591552 | 183 |
| 124 | 3300005547 | Ga0070693_100001421 | Ga0070693_1000014212 | 183 |
| 125 | 3300005547 | Ga0070693_100185568 | Ga0070693_1001855682 | 183 |
| 126 | 3300005549 | Ga0070704_100000093 | Ga0070704_10000009316 | 183 |
| 127 | 3300005549 | Ga0070704_100000515 | Ga0070704_1000005152 | 183 |
| 128 | 3300005549 | Ga0070704_100100001 | Ga0070704_1001000012 | 183 |
| 129 | 3300005549 | Ga0070704_100109326 | Ga0070704_1001093262 | 183 |
| 130 | 3300005549 | Ga0070704_100273896 | Ga0070704_1002738961 | 183 |
| 131 | 3300005549 | Ga0070704_100544011 | Ga0070704_1005440111 | 183 |
| 132 | 3300005563 | Ga0068855_100006371 | Ga0068855_10000637116 | 183 |
| 133 | 3300005577 | Ga0068857_100224249 | Ga0068857_1002242492 | 183 |
| 134 | 3300005578 | Ga0068854_100017141 | Ga0068854_1000171412 | 183 |
| 135 | 3300005614 | Ga0068856_100007368 | Ga0068856_1000073683 | 183 |
| 136 | 3300005615 | Ga0070702_100000565 | Ga0070702_10000056513 | 183 |
| 137 | 3300005615 | Ga0070702_100431023 | Ga0070702_1004310232 | 183 |
| 138 | 3300005617 | Ga0068859_100008910 | Ga0068859_1000089109 | 183 |
| 139 | 3300005617 | Ga0068859_100054296 | Ga0068859_1000542963 | 183 |
| 140 | 3300005617 | Ga0068859_100102868 | Ga0068859_1001028682 | 183 |
| 141 | 3300005618 | Ga0068864_100164190 | Ga0068864_1001641902 | 183 |
| 142 | 3300005718 | Ga0068866_10000746 | Ga0068866_1000074617 | 183 |
| 143 | 3300005719 | Ga0068861_100001913 | Ga0068861_1000019132 | 183 |
| 144 | 3300005719 | Ga0068861_101278643 | Ga0068861_1012786431 | 183 |
| 145 | 3300005840 | Ga0068870_10039986 | Ga0068870_100399862 | 183 |
| 146 | 3300005840 | Ga0068870_10324015 | Ga0068870_103240151 | 183 |
| 147 | 3300005841 | Ga0068863_100362787 | Ga0068863_1003627872 | 183 |
| 148 | 3300005843 | Ga0068860_100008118 | Ga0068860_1000081188 | 183 |
| 149 | 3300005844 | Ga0068862_100038786 | Ga0068862_1000387862 | 183 |
| 150 | 3300005844 | Ga0068862_100622332 | Ga0068862_1006223322 | 183 |
| 151 | 3300005981 | Ga0081538_10035515 | Ga0081538_100355152 | 183 |
| 152 | 3300005985 | Ga0081539_10000365 | Ga0081539_1000036572 | 183 |
| 153 | 3300006173 | Ga0070716_100095464 | Ga0070716_1000954642 | 183 |
| 154 | 3300006177 | Ga0075362_10198970 | Ga0075362_101989701 | 183 |
| 155 | 3300006237 | Ga0097621_100001187 | Ga0097621_1000011872 | 183 |
| 156 | 3300006237 | Ga0097621_100004204 | Ga0097621_10000420411 | 183 |
| 157 | 3300006358 | Ga0068871_100024686 | Ga0068871_1000246863 | 183 |
| 158 | 3300006358 | Ga0068871_100025566 | Ga0068871_1000255665 | 183 |
| 159 | 3300006844 | Ga0075428_100000502 | Ga0075428_1000005024 | 183 |
| 160 | 3300006844 | Ga0075428_100341990 | Ga0075428_1003419902 | 183 |
| 161 | 3300006844 | Ga0075428_100524127 | Ga0075428_1005241272 | 183 |
| 162 | 3300006844 | Ga0075428_100593693 | Ga0075428_1005936932 | 183 |
| 163 | 3300006844 | Ga0075428_101171261 | Ga0075428_1011712612 | 183 |
| 164 | 3300006846 | Ga0075430_100000620 | Ga0075430_10000062022 | 183 |
| 165 | 3300006846 | Ga0075430_100007238 | Ga0075430_1000072386 | 183 |
| 166 | 3300006846 | Ga0075430_100014819 | Ga0075430_1000148199 | 183 |
| 167 | 3300006846 | Ga0075430_100248243 | Ga0075430_1002482432 | 183 |
| 168 | 3300006846 | Ga0075430_100641390 | Ga0075430_1006413901 | 183 |
| 169 | 3300006847 | Ga0075431_100066156 | Ga0075431_1000661561 | 183 |
| 170 | 3300006847 | Ga0075431_100074130 | Ga0075431_1000741304 | 183 |
| 171 | 3300006847 | Ga0075431_100128621 | Ga0075431_1001286212 | 183 |
| 172 | 3300006847 | Ga0075431_100145990 | Ga0075431_1001459903 | 183 |
| 173 | 3300006847 | Ga0075431_100603829 | Ga0075431_1006038292 | 183 |
| 174 | 3300006847 | Ga0075431_100707544 | Ga0075431_1007075442 | 183 |
| 175 | 3300006852 | Ga0075433_10000611 | Ga0075433_1000061122 | 183 |
| 176 | 3300006852 | Ga0075433_10233296 | Ga0075433_102332962 | 183 |
| 177 | 3300006852 | Ga0075433_10322407 | Ga0075433_103224072 | 183 |
| 178 | 3300006852 | Ga0075433_10441807 | Ga0075433_104418072 | 183 |
| 179 | 3300006871 | Ga0075434_100000406 | Ga0075434_10000040616 | 183 |
| 180 | 3300006871 | Ga0075434_100007989 | Ga0075434_1000079892 | 183 |
| 181 | 3300006871 | Ga0075434_100064318 | Ga0075434_1000643182 | 183 |
| 182 | 3300006880 | Ga0075429_100000081 | Ga0075429_10000008132 | 183 |
| 183 | 3300006880 | Ga0075429_100000145 | Ga0075429_1000001452 | 183 |
| 184 | 3300006880 | Ga0075429_100078877 | Ga0075429_1000788772 | 183 |
| 185 | 3300006880 | Ga0075429_100123110 | Ga0075429_1001231102 | 183 |
| 186 | 3300006880 | Ga0075429_100128615 | Ga0075429_1001286152 | 183 |
| 187 | 3300006881 | Ga0068865_100001100 | Ga0068865_1000011002 | 183 |
| 188 | 3300006914 | Ga0075436_100000375 | Ga0075436_10000037522 | 183 |
| 189 | 3300006914 | Ga0075436_100000513 | Ga0075436_1000005136 | 183 |
| 190 | 3300006914 | Ga0075436_100275724 | Ga0075436_1002757242 | 183 |
| 191 | 3300006931 | Ga0097620_100008910 | Ga0097620_1000089103 | 183 |
| 192 | 3300006931 | Ga0097620_100054294 | Ga0097620_1000542943 | 183 |
| 193 | 3300006931 | Ga0097620_100102861 | Ga0097620_1001028612 | 183 |
| 194 | 3300007076 | Ga0075435_100000668 | Ga0075435_10000066811 | 183 |
| 195 | 3300007076 | Ga0075435_100000820 | Ga0075435_1000008204 | 183 |
| 196 | 3300007076 | Ga0075435_100038536 | Ga0075435_1000385363 | 183 |
| 197 | 3300007076 | Ga0075435_100094652 | Ga0075435_1000946522 | 183 |
| 198 | 3300007076 | Ga0075435_100122190 | Ga0075435_1001221902 | 183 |
| 199 | 3300007076 | Ga0075435_100194868 | Ga0075435_1001948682 | 183 |
| 200 | 3300007265 | Ga0099794_10018041 | Ga0099794_100180412 | 183 |
| 201 | 3300007265 | Ga0099794_10027883 | Ga0099794_100278832 | 183 |
| 202 | 3300007265 | Ga0099794_10240426 | Ga0099794_102404261 | 183 |
| 203 | 3300009093 | Ga0105240_10374347 | Ga0105240_103743472 | 183 |
| 204 | 3300009094 | Ga0111539_10368556 | Ga0111539_103685562 | 183 |
| 205 | 3300009094 | Ga0111539_10869191 | Ga0111539_108691912 | 183 |
| 206 | 3300009094 | Ga0111539_11318386 | Ga0111539_113183862 | 183 |
| 207 | 3300009098 | Ga0105245_10004790 | Ga0105245_100047909 | 183 |
| 208 | 3300009098 | Ga0105245_10125608 | Ga0105245_101256082 | 183 |
| 209 | 3300009147 | Ga0114129_10000393 | Ga0114129_1000039341 | 183 |
| 210 | 3300009147 | Ga0114129_10002113 | Ga0114129_1000211324 | 183 |
| 211 | 3300009147 | Ga0114129_10076304 | Ga0114129_100763043 | 183 |
| 212 | 3300009147 | Ga0114129_10196261 | Ga0114129_101962612 | 183 |
| 213 | 3300009148 | Ga0105243_10016884 | Ga0105243_100168842 | 183 |
| 214 | 3300009148 | Ga0105243_10231139 | Ga0105243_102311392 | 183 |
| 215 | 3300009148 | Ga0105243_11198363 | Ga0105243_111983631 | 183 |
| 216 | 3300009174 | Ga0105241_10077029 | Ga0105241_100770291 | 183 |
| 217 | 3300009176 | Ga0105242_10000296 | Ga0105242_1000029631 | 183 |
| 218 | 3300009176 | Ga0105242_10008018 | Ga0105242_100080184 | 183 |
| 219 | 3300009176 | Ga0105242_11420768 | Ga0105242_114207681 | 183 |
| 220 | 3300009177 | Ga0105248_10824065 | Ga0105248_108240652 | 183 |
| 221 | 3300010375 | Ga0105239_10495774 | Ga0105239_104957742 | 183 |
| 222 | 3300011119 | Ga0105246_10048210 | Ga0105246_100482102 | 183 |
| 223 | 3300013297 | Ga0157378_10003195 | Ga0157378_100031952 | 183 |
| 224 | 3300013307 | Ga0157372_10613611 | Ga0157372_106136112 | 183 |
| 225 | 3300013308 | Ga0157375_11010906 | Ga0157375_110109062 | 183 |
| 226 | 3300014326 | Ga0157380_10279714 | Ga0157380_102797142 | 183 |
| 227 | 3300014968 | Ga0157379_10053730 | Ga0157379_100537302 | 183 |
| 228 | 3300014969 | Ga0157376_10011070 | Ga0157376_100110706 | 183 |
| 229 | 3300025885 | Ga0207653_10019105 | Ga0207653_100191052 | 183 |
| 230 | 3300025899 | Ga0207642_10014619 | Ga0207642_100146192 | 183 |
| 231 | 3300025901 | Ga0207688_10069086 | Ga0207688_100690862 | 183 |
| 232 | 3300025903 | Ga0207680_10187394 | Ga0207680_101873942 | 183 |
| 233 | 3300025905 | Ga0207685_10152804 | Ga0207685_101528042 | 183 |
| 234 | 3300025908 | Ga0207643_10039448 | Ga0207643_100394482 | 183 |
| 235 | 3300025910 | Ga0207684_10239857 | Ga0207684_102398572 | 183 |
| 236 | 3300025912 | Ga0207707_10008207 | Ga0207707_100082073 | 183 |
| 237 | 3300025912 | Ga0207707_10156666 | Ga0207707_101566662 | 183 |
| 238 | 3300025912 | Ga0207707_11284380 | Ga0207707_112843801 | 183 |
| 239 | 3300025917 | Ga0207660_10074307 | Ga0207660_100743072 | 183 |
| 240 | 3300025918 | Ga0207662_10000024 | Ga0207662_1000002472 | 183 |
| 241 | 3300025918 | Ga0207662_10246786 | Ga0207662_102467862 | 183 |
| 242 | 3300025918 | Ga0207662_10287659 | Ga0207662_102876592 | 183 |
| 243 | 3300025921 | Ga0207652_10581920 | Ga0207652_105819202 | 183 |
| 244 | 3300025922 | Ga0207646_10549906 | Ga0207646_105499062 | 183 |
| 245 | 3300025927 | Ga0207687_10030729 | Ga0207687_100307293 | 183 |
| 246 | 3300025927 | Ga0207687_10582823 | Ga0207687_105828232 | 183 |
| 247 | 3300025928 | Ga0207700_10343191 | Ga0207700_103431912 | 183 |
| 248 | 3300025934 | Ga0207686_10001177 | Ga0207686_1000117713 | 183 |
| 249 | 3300025934 | Ga0207686_10010567 | Ga0207686_100105674 | 183 |
| 250 | 3300025935 | Ga0207709_10010644 | Ga0207709_100106442 | 183 |
| 251 | 3300025935 | Ga0207709_10460929 | Ga0207709_104609292 | 183 |
| 252 | 3300025936 | Ga0207670_10002055 | Ga0207670_100020556 | 183 |
| 253 | 3300025936 | Ga0207670_10164267 | Ga0207670_101642672 | 183 |
| 254 | 3300025938 | Ga0207704_10000918 | Ga0207704_1000091813 | 183 |
| 255 | 3300025939 | Ga0207665_10046937 | Ga0207665_100469372 | 183 |
| 256 | 3300025942 | Ga0207689_10068059 | Ga0207689_100680592 | 183 |
| 257 | 3300025949 | Ga0207667_10005789 | Ga0207667_100057899 | 183 |
| 258 | 3300025960 | Ga0207651_10609819 | Ga0207651_106098192 | 183 |
| 259 | 3300025961 | Ga0207712_10022123 | Ga0207712_100221232 | 183 |
| 260 | 3300025981 | Ga0207640_10007225 | Ga0207640_100072256 | 183 |
| 261 | 3300026023 | Ga0207677_10000875 | Ga0207677_1000087517 | 183 |
| 262 | 3300026035 | Ga0207703_10199071 | Ga0207703_101990712 | 183 |
| 263 | 3300026041 | Ga0207639_10642603 | Ga0207639_106426031 | 183 |
| 264 | 3300026075 | Ga0207708_10002074 | Ga0207708_100020742 | 183 |
| 265 | 3300026075 | Ga0207708_10547219 | Ga0207708_105472192 | 183 |
| 266 | 3300026075 | Ga0207708_10694568 | Ga0207708_106945681 | 183 |
| 267 | 3300026078 | Ga0207702_10209225 | Ga0207702_102092252 | 183 |
| 268 | 3300026088 | Ga0207641_10133363 | Ga0207641_101333632 | 183 |
| 269 | 3300026089 | Ga0207648_10005161 | Ga0207648_1000516114 | 183 |
| 270 | 3300026089 | Ga0207648_10049940 | Ga0207648_100499404 | 183 |
| 271 | 3300026089 | Ga0207648_11112681 | Ga0207648_111126811 | 183 |
| 272 | 3300026095 | Ga0207676_10272943 | Ga0207676_102729432 | 183 |
| 273 | 3300026095 | Ga0207676_10702801 | Ga0207676_107028012 | 183 |
| 274 | 3300026116 | Ga0207674_10142260 | Ga0207674_101422602 | 183 |
| 275 | 3300026118 | Ga0207675_100002609 | Ga0207675_10000260920 | 183 |
| 276 | 3300027360 | Ga0209969_1004100 | Ga0209969_10041002 | 183 |
| 277 | 3300027360 | Ga0209969_1016375 | Ga0209969_10163752 | 183 |
| 278 | 3300027364 | Ga0209967_1003038 | Ga0209967_10030382 | 183 |
| 279 | 3300027378 | Ga0209981_1030401 | Ga0209981_10304011 | 183 |
| 280 | 3300027395 | Ga0209996_1010823 | Ga0209996_10108232 | 183 |
| 281 | 3300027395 | Ga0209996_1022382 | Ga0209996_10223822 | 183 |
| 282 | 3300027462 | Ga0210000_1004382 | Ga0210000_10043822 | 183 |
| 283 | 3300027462 | Ga0210000_1016163 | Ga0210000_10161632 | 183 |
| 284 | 3300027471 | Ga0209995_1001101 | Ga0209995_10011013 | 183 |
| 285 | 3300027471 | Ga0209995_1016483 | Ga0209995_10164832 | 183 |
| 286 | 3300027471 | Ga0209995_1037772 | Ga0209995_10377722 | 183 |
| 287 | 3300027526 | Ga0209968_1022480 | Ga0209968_10224802 | 183 |
| 288 | 3300027543 | Ga0209999_1007147 | Ga0209999_10071472 | 183 |
| 289 | 3300027543 | Ga0209999_1010557 | Ga0209999_10105572 | 183 |
| 290 | 3300027695 | Ga0209966_1001585 | Ga0209966_10015852 | 183 |
| 291 | 3300027695 | Ga0209966_1019647 | Ga0209966_10196472 | 183 |
| 292 | 3300027907 | Ga0207428_10009302 | Ga0207428_1000930210 | 183 |
| 293 | 3300028380 | Ga0268265_10004469 | Ga0268265_100044692 | 183 |
| 294 | 3300028380 | Ga0268265_10335398 | Ga0268265_103353982 | 183 |
| 295 | 3300028380 | Ga0268265_10360989 | Ga0268265_103609892 | 183 |
| 296 | 3300028381 | Ga0268264_10000841 | Ga0268264_100008411 | 183 |
| 297 | 3300028381 | Ga0268264_10741826 | Ga0268264_107418261 | 183 |
| 298 | 3300031548 | Ga0307408_100078396 | Ga0307408_1000783962 | 183 |
| 299 | 3300031548 | Ga0307408_100539331 | Ga0307408_1005393312 | 183 |
| 300 | 3300031824 | Ga0307413_10475038 | Ga0307413_104750382 | 183 |
| 301 | 3300031852 | Ga0307410_10820010 | Ga0307410_108200101 | 183 |
| 302 | 3300031903 | Ga0307407_10584124 | Ga0307407_105841241 | 183 |
| 303 | 3300031995 | Ga0307409_100208017 | Ga0307409_1002080172 | 183 |
| 304 | 3300032002 | Ga0307416_100409488 | Ga0307416_1004094882 | 183 |
| 305 | 3300032002 | Ga0307416_100428887 | Ga0307416_1004288872 | 183 |
| 306 | 3300032002 | Ga0307416_100568855 | Ga0307416_1005688552 | 183 |
| 307 | 3300032005 | Ga0307411_10152968 | Ga0307411_101529682 | 183 |
| 308 | 3300032005 | Ga0307411_10206451 | Ga0307411_102064511 | 183 |
| 309 | 3300034816 | Ga0373930_0046016 | Ga0373930_0046016_339_890 | 183 |
| 310 | 3300034817 | Ga0373948_0002713 | Ga0373948_0002713_179_730 | 183 |
| 311 | 3300034818 | Ga0373950_0007812 | Ga0373950_0007812_339_890 | 183 |
| 312 | 3300034957 | Ga0373938_0025120 | Ga0373938_0025120_557_1108 | 183 |
| 313 | 3300035084 | Ga0373928_0018806 | Ga0373928_0018806_79_630 | 183 |
| 314 | 3300035088 | Ga0373940_0024050 | Ga0373940_0024050_339_890 | 183 |
| 315 | 3300035112 | Ga0373932_0001177 | Ga0373932_0001177_5157_5708 | 183 |
| 316 | 3300035113 | Ga0373936_0202024 | Ga0373936_0202024_127_678 | 183 |
| 317 | 3300035114 | Ga0373939_0049430 | Ga0373939_0049430_65_616 | 183 |
| 318 | 3300035115 | Ga0373941_0014998 | Ga0373941_0014998_215_766 | 183 |
| 319 | 3300035115 | Ga0373941_0055604 | Ga0373941_0055604_12_566 | 183 |
| 320 | 3300035115 | Ga0373941_0171538 | Ga0373941_0171538_198_749 | 183 |
| 321 | 3300035241 | Ga0373961_0002326 | Ga0373961_0002326_4245_4796 | 183 |
| 322 | 3300035241 | Ga0373961_0152895 | Ga0373961_0152895_204_755 | 183 |
| 323 | 3300035242 | Ga0373962_0077378 | Ga0373962_0077378_37_588 | 183 |
| 324 | 3300035691 | Ga0373931_0000177 | Ga0373931_0000177_16401_16952 | 183 |
| 325 | 3300035691 | Ga0373931_0012034 | Ga0373931_0012034_3223_3774 | 183 |
| 326 | 3300035691 | Ga0373931_0026008 | Ga0373931_0026008_954_1508 | 183 |
| 327 | 3300035691 | Ga0373931_0187183 | Ga0373931_0187183_128_679 | 183 |
| 328 | 3300036401 | Ga0373937_0127278 | Ga0373937_0127278_79_630 | 183 |
| 329 | 3300041406 | Ga0439439_0031632 | Ga0439439_0031632_23_574 | 183 |
| 330 | 3300041408 | Ga0439453_0027668 | Ga0439453_0027668_138_689 | 183 |
| 331 | 3300041410 | Ga0439461_0049558 | Ga0439461_0049558_211_762 | 183 |
| 332 | 3300041512 | Ga0451853_1506806 | Ga0451853_1506806_586_1137 | 183 |
| 333 | 3300042001 | Ga0439441_013204 | Ga0439441_013204_281_832 | 183 |
| 334 | 3300042003 | Ga0439443_001907 | Ga0439443_001907_849_1400 | 183 |
| 335 | 3300042008 | Ga0439450_070826 | Ga0439450_070826_18_569 | 183 |
| 336 | 3300042009 | Ga0439451_005225 | Ga0439451_005225_371_922 | 183 |
| 337 | 3300042015 | Ga0439462_0097402 | Ga0439462_0097402_59_610 | 183 |
| 338 | 3300042156 | Ga0439446_0003451 | Ga0439446_0003451_308_859 | 183 |
| 339 | 3300042435 | Ga0439434_0003761 | Ga0439434_0003761_1472_2023 | 183 |
| 340 | 3300042435 | Ga0439434_0170684 | Ga0439434_0170684_155_706 | 183 |
| 341 | 3300042436 | Ga0439435_0000966 | Ga0439435_0000966_977_1528 | 183 |
| 342 | 3300042436 | Ga0439435_0018938 | Ga0439435_0018938_106_657 | 183 |
| 343 | 3300042437 | Ga0439444_0000672 | Ga0439444_0000672_1152_1703 | 183 |
| 344 | 3300042437 | Ga0439444_0009256 | Ga0439444_0009256_286_837 | 183 |
| 345 | 3300042438 | Ga0439459_0016797 | Ga0439459_0016797_248_799 | 183 |
| 346 | 3300042461 | Ga0439460_0001831 | Ga0439460_0001831_2074_2625 | 183 |
| 347 | 3300045051 | Ga0451576_0009298 | Ga0451576_0009298_1059_1610 | 183 |
| 348 | 3300045051 | Ga0451576_0020989 | Ga0451576_0020989_5303_5854 | 183 |
| 349 | 3300046476 | Ga0495662_0043151 | Ga0495662_0043151_366_917 | 183 |
| 350 | 3300046511 | Ga0495608_0037973 | Ga0495608_0037973_2014_2565 | 183 |
| 351 | 3300046516 | Ga0495628_0009779 | Ga0495628_0009779_7559_8110 | 183 |
| 352 | 3300046517 | Ga0495630_0019320 | Ga0495630_0019320_1803_2354 | 183 |
| 353 | 3300046517 | Ga0495630_0827260 | Ga0495630_0827260_44_595 | 183 |
| 354 | 3300046525 | Ga0495663_0136464 | Ga0495663_0136464_49_645 | 183 |
| 355 | 3300046526 | Ga0495666_0031461 | Ga0495666_0031461_1999_2550 | 183 |
| 356 | 3300046529 | Ga0495652_0031366 | Ga0495652_0031366_4085_4636 | 183 |
| 357 | 3300046533 | Ga0495640_0032561 | Ga0495640_0032561_2021_2572 | 183 |
| 358 | 3300046533 | Ga0495640_0088600 | Ga0495640_0088600_655_1206 | 183 |
| 359 | 3300046535 | Ga0495586_0011534 | Ga0495586_0011534_510_1061 | 183 |
| 360 | 3300046535 | Ga0495586_0027203 | Ga0495586_0027203_49_600 | 183 |
| 361 | 3300046539 | Ga0495621_0008822 | Ga0495621_0008822_1473_2024 | 183 |
| 362 | 3300046539 | Ga0495621_0078555 | Ga0495621_0078555_312_908 | 183 |
| 363 | 3300046539 | Ga0495621_0099042 | Ga0495621_0099042_10_564 | 183 |
| 364 | 3300046559 | Ga0495667_0014782 | Ga0495667_0014782_1917_2468 | 183 |
| 365 | 3300046663 | Ga0495635_0073380 | Ga0495635_0073380_185_736 | 183 |
| 366 | 3300046680 | Ga0495646_0141136 | Ga0495646_0141136_159_710 | 183 |
| 367 | 3300046683 | Ga0495658_0021201 | Ga0495658_0021201_405_956 | 183 |
| 368 | 3300046683 | Ga0495658_0034706 | Ga0495658_0034706_179_730 | 183 |
| 369 | 3300046689 | Ga0495613_0008807 | Ga0495613_0008807_2167_2718 | 183 |
| 370 | 3300046690 | Ga0495624_0056350 | Ga0495624_0056350_827_1378 | 183 |
| 371 | 3300046809 | Ga0495600_0012118 | Ga0495600_0012118_3064_3615 | 183 |
| 372 | 3300047315 | Ga0495581_0205766 | Ga0495581_0205766_169_720 | 183 |
| 373 | 3300047317 | Ga0495604_0017573 | Ga0495604_0017573_4023_4574 | 183 |
| 374 | 3300047318 | Ga0495636_0001613 | Ga0495636_0001613_3258_3809 | 183 |
| 375 | 3300047322 | Ga0495680_0004125 | Ga0495680_0004125_11567_12118 | 183 |
| 376 | 3300049514 | Ga0501291_019296 | Ga0501291_019296_54_605 | 183 |
| 377 | 3300049521 | Ga0501298_009420 | Ga0501298_009420_325_882 | 183 |
| 378 | 3300049522 | Ga0501299_029320 | Ga0501299_029320_241_792 | 183 |
| 379 | 3300049568 | Ga0501031_0026854 | Ga0501031_0026854_2087_2638 | 183 |
| 380 | 3300049568 | Ga0501031_0285658 | Ga0501031_0285658_449_1000 | 183 |
| 381 | 3300049570 | Ga0501033_0016766 | Ga0501033_0016766_2645_3196 | 183 |
| 382 | 3300049571 | Ga0501034_1345022 | Ga0501034_1345022_13_564 | 183 |
| 383 | 3300049572 | Ga0501036_0008179 | Ga0501036_0008179_3234_3785 | 183 |
| 384 | 3300049572 | Ga0501036_0400854 | Ga0501036_0400854_459_1010 | 183 |
| 385 | 3300049572 | Ga0501036_0734589 | Ga0501036_0734589_228_779 | 183 |
| 386 | 3300049573 | Ga0501037_0042031 | Ga0501037_0042031_1105_1656 | 183 |
| 387 | 3300049573 | Ga0501037_0202080 | Ga0501037_0202080_144_695 | 183 |
| 388 | 3300049574 | Ga0501038_0011271 | Ga0501038_0011271_5153_5704 | 183 |
| 389 | 3300049575 | Ga0501039_0007682 | Ga0501039_0007682_2883_3434 | 183 |
| 390 | 3300049575 | Ga0501039_0020405 | Ga0501039_0020405_1426_1977 | 183 |
| 391 | 3300049575 | Ga0501039_0163118 | Ga0501039_0163118_559_1110 | 183 |
| 392 | 3300049575 | Ga0501039_0237314 | Ga0501039_0237314_149_706 | 183 |
| 393 | 3300049575 | Ga0501039_0251229 | Ga0501039_0251229_376_927 | 183 |
| 394 | 3300049575 | Ga0501039_0268630 | Ga0501039_0268630_759_1310 | 183 |
| 395 | 3300049576 | Ga0501040_0006268 | Ga0501040_0006268_2574_3125 | 183 |
| 396 | 3300049576 | Ga0501040_0028332 | Ga0501040_0028332_1210_1761 | 183 |
| 397 | 3300049576 | Ga0501040_0030687 | Ga0501040_0030687_1385_1936 | 183 |
| 398 | 3300049576 | Ga0501040_0105899 | Ga0501040_0105899_504_1055 | 183 |
| 399 | 3300049577 | Ga0501041_0000358 | Ga0501041_0000358_4791_5342 | 183 |
| 400 | 3300049578 | Ga0501042_0000291 | Ga0501042_0000291_21748_22299 | 183 |
| 401 | 3300049578 | Ga0501042_0096681 | Ga0501042_0096681_1297_1848 | 183 |
| 402 | 3300049578 | Ga0501042_0180846 | Ga0501042_0180846_642_1193 | 183 |
| 403 | 3300049578 | Ga0501042_0309311 | Ga0501042_0309311_377_928 | 183 |
| 404 | 3300049579 | Ga0501043_0048212 | Ga0501043_0048212_637_1188 | 183 |
| 405 | 3300049579 | Ga0501043_0417302 | Ga0501043_0417302_67_618 | 183 |
| 406 | 3300049580 | Ga0501046_0010378 | Ga0501046_0010378_4879_5430 | 183 |
| 407 | 3300049580 | Ga0501046_0073060 | Ga0501046_0073060_181_732 | 183 |
| 408 | 3300049582 | Ga0501048_0016337 | Ga0501048_0016337_3071_3622 | 183 |
| 409 | 3300049582 | Ga0501048_0520648 | Ga0501048_0520648_104_661 | 183 |
| 410 | 3300049585 | Ga0501069_0209621 | Ga0501069_0209621_398_952 | 183 |
| 411 | 3300049587 | Ga0501071_0004120 | Ga0501071_0004120_4815_5366 | 183 |
| 412 | 3300049587 | Ga0501071_0050912 | Ga0501071_0050912_918_1469 | 183 |
| 413 | 3300049587 | Ga0501071_0053220 | Ga0501071_0053220_753_1304 | 183 |
| 414 | 3300049587 | Ga0501071_0399535 | Ga0501071_0399535_235_786 | 183 |
| 415 | 3300049588 | Ga0501072_0000720 | Ga0501072_0000720_22566_23117 | 183 |
| 416 | 3300049588 | Ga0501072_0001286 | Ga0501072_0001286_11637_12188 | 183 |
| 417 | 3300049588 | Ga0501072_0016019 | Ga0501072_0016019_556_1107 | 183 |
| 418 | 3300049588 | Ga0501072_0140334 | Ga0501072_0140334_205_756 | 183 |
| 419 | 3300049588 | Ga0501072_0148958 | Ga0501072_0148958_462_1013 | 183 |
| 420 | 3300049588 | Ga0501072_0311253 | Ga0501072_0311253_174_725 | 183 |
| 421 | 3300049588 | Ga0501072_0366753 | Ga0501072_0366753_370_921 | 183 |
| 422 | 3300049590 | Ga0501074_0056482 | Ga0501074_0056482_1839_2390 | 183 |
| 423 | 3300049590 | Ga0501074_0408588 | Ga0501074_0408588_176_727 | 183 |
| 424 | 3300049590 | Ga0501074_0723867 | Ga0501074_0723867_75_626 | 183 |
| 425 | 3300049591 | Ga0501075_0005455 | Ga0501075_0005455_3234_3785 | 183 |
| 426 | 3300049591 | Ga0501075_0052774 | Ga0501075_0052774_444_995 | 183 |
| 427 | 3300049591 | Ga0501075_0060896 | Ga0501075_0060896_908_1459 | 183 |
| 428 | 3300049592 | Ga0501076_0002120 | Ga0501076_0002120_8396_8947 | 183 |
| 429 | 3300049592 | Ga0501076_0003881 | Ga0501076_0003881_4172_4723 | 183 |
| 430 | 3300049592 | Ga0501076_0590243 | Ga0501076_0590243_226_777 | 183 |
| 431 | 3300049593 | Ga0501077_0004484 | Ga0501077_0004484_5510_6061 | 183 |
| 432 | 3300049593 | Ga0501077_0020675 | Ga0501077_0020675_2469_3020 | 183 |
| 433 | 3300049656 | Ga0501209_049413 | Ga0501209_049413_265_816 | 183 |
| 434 | 3300049660 | Ga0501216_047758 | Ga0501216_047758_155_706 | 183 |
| 435 | 3300049661 | Ga0501217_024459 | Ga0501217_024459_607_1164 | 183 |
| 436 | 3300049661 | Ga0501217_215945 | Ga0501217_215945_24_575 | 183 |
| 437 | 3300049679 | Ga0501249_029062 | Ga0501249_029062_77_628 | 183 |
| 438 | 3300049703 | Ga0501219_011674 | Ga0501219_011674_30_581 | 183 |
| 439 | 3300049705 | Ga0501225_0039011 | Ga0501225_0039011_445_996 | 183 |
| 440 | 3300049707 | Ga0501234_038330 | Ga0501234_038330_162_713 | 183 |
| 441 | 3300049708 | Ga0501245_016687 | Ga0501245_016687_265_816 | 183 |
| 442 | 3300049741 | Ga0501079_0013275 | Ga0501079_0013275_421_972 | 183 |
| 443 | 3300049741 | Ga0501079_0015686 | Ga0501079_0015686_2192_2743 | 183 |
| 444 | 3300049741 | Ga0501079_0253768 | Ga0501079_0253768_367_918 | 183 |
| 445 | 3300049742 | Ga0501080_0138422 | Ga0501080_0138422_1026_1577 | 183 |
| 446 | 3300049742 | Ga0501080_0151342 | Ga0501080_0151342_1523_2074 | 183 |
| 447 | 3300049742 | Ga0501080_0290203 | Ga0501080_0290203_349_900 | 183 |
| 448 | 3300049743 | Ga0501081_0002739 | Ga0501081_0002739_5511_6062 | 183 |
| 449 | 3300049743 | Ga0501081_0010072 | Ga0501081_0010072_5596_6147 | 183 |
| 450 | 3300049743 | Ga0501081_0232757 | Ga0501081_0232757_563_1114 | 183 |
| 451 | 3300049744 | Ga0501083_0113734 | Ga0501083_0113734_1163_1714 | 183 |
| 452 | 3300049744 | Ga0501083_0327977 | Ga0501083_0327977_400_951 | 183 |
| 453 | 3300049779 | Ga0501283_056889 | Ga0501283_056889_14_565 | 183 |
| 454 | 3300049822 | Ga0501035_0104044 | Ga0501035_0104044_205_756 | 183 |
| 455 | 3300049823 | Ga0501044_0333287 | Ga0501044_0333287_153_704 | 183 |
| 456 | 3300049824 | Ga0501045_0005295 | Ga0501045_0005295_3386_3937 | 183 |
| 457 | 3300049824 | Ga0501045_0366137 | Ga0501045_0366137_65_616 | 183 |
| 458 | 3300049853 | Ga0501226_015909 | Ga0501226_015909_260_811 | 183 |
| 459 | 3300050507 | nmdc:mga05p37_2146_c1 | nmdc:mga05p37_2146_c1_10583_11134 | 183 |
| 460 | 3300050507 | nmdc:mga05p37_572138_c1 | nmdc:mga05p37_572138_c1_578_1129 | 183 |
| 461 | 3300050507 | nmdc:mga05p37_74562_c1 | nmdc:mga05p37_74562_c1_2622_3173 | 183 |
| 462 | 3300050507 | nmdc:mga05p37_775_c1 | nmdc:mga05p37_775_c1_8317_8868 | 183 |
| 463 | 3300050508 | nmdc:mga09592_109817_c1 | nmdc:mga09592_109817_c1_976_1527 | 183 |
| 464 | 3300050508 | nmdc:mga09592_126809_c1 | nmdc:mga09592_126809_c1_498_1049 | 183 |
| 465 | 3300050508 | nmdc:mga09592_1359803_c1 | nmdc:mga09592_1359803_c1_18_569 | 183 |
| 466 | 3300050508 | nmdc:mga09592_148_c1 | nmdc:mga09592_148_c1_35195_35746 | 183 |
| 467 | 3300050508 | nmdc:mga09592_26_c1 | nmdc:mga09592_26_c1_66875_67426 | 183 |
| 468 | 3300050508 | nmdc:mga09592_34000_c1 | nmdc:mga09592_34000_c1_1051_1602 | 183 |
| 469 | 3300050508 | nmdc:mga09592_422796_c1 | nmdc:mga09592_422796_c1_49_600 | 183 |
| 470 | 3300050509 | nmdc:mga0qj67_1004775_c1 | nmdc:mga0qj67_1004775_c1_78_629 | 183 |
| 471 | 3300050509 | nmdc:mga0qj67_12222_c1 | nmdc:mga0qj67_12222_c1_3990_4541 | 183 |
| 472 | 3300050509 | nmdc:mga0qj67_350279_c1 | nmdc:mga0qj67_350279_c1_572_1123 | 183 |
| 473 | 3300050509 | nmdc:mga0qj67_38899_c1 | nmdc:mga0qj67_38899_c1_71_622 | 183 |
| 474 | 3300050509 | nmdc:mga0qj67_58443_c1 | nmdc:mga0qj67_58443_c1_479_1030 | 183 |
| 475 | 3300050509 | nmdc:mga0qj67_740_c1 | nmdc:mga0qj67_740_c1_9514_10065 | 183 |
| 476 | 3300050509 | nmdc:mga0qj67_933637_c1 | nmdc:mga0qj67_933637_c1_60_611 | 183 |
| 477 | 3300050510 | nmdc:mga06r32_124849_c2 | nmdc:mga06r32_124849_c2_208_759 | 183 |
| 478 | 3300050510 | nmdc:mga06r32_21812_c1 | nmdc:mga06r32_21812_c1_2319_2870 | 183 |
| 479 | 3300050510 | nmdc:mga06r32_248162_c1 | nmdc:mga06r32_248162_c1_795_1346 | 183 |
| 480 | 3300050510 | nmdc:mga06r32_33186_c1 | nmdc:mga06r32_33186_c1_3972_4523 | 183 |
| 481 | 3300050510 | nmdc:mga06r32_354814_c1 | nmdc:mga06r32_354814_c1_244_795 | 183 |
| 482 | 3300050510 | nmdc:mga06r32_81914_c1 | nmdc:mga06r32_81914_c1_2325_2876 | 183 |
| 483 | 3300050510 | nmdc:mga06r32_89483_c1 | nmdc:mga06r32_89483_c1_2425_2976 | 183 |
| 484 | 3300050511 | nmdc:mga08y16_142861_c1 | nmdc:mga08y16_142861_c1_644_1195 | 183 |
| 485 | 3300050511 | nmdc:mga08y16_220096_c1 | nmdc:mga08y16_220096_c1_619_1170 | 183 |
| 486 | 3300050511 | nmdc:mga08y16_377830_c1 | nmdc:mga08y16_377830_c1_456_1007 | 183 |
| 487 | 3300050511 | nmdc:mga08y16_864518_c1 | nmdc:mga08y16_864518_c1_91_642 | 183 |
| 488 | 3300050511 | nmdc:mga08y16_873553_c1 | nmdc:mga08y16_873553_c1_301_855 | 183 |
| 489 | 3300050512 | nmdc:mga0n895_1820_c1 | nmdc:mga0n895_1820_c1_6709_7260 | 183 |
| 490 | 3300050512 | nmdc:mga0n895_83407_c1 | nmdc:mga0n895_83407_c1_1818_2369 | 183 |
| 491 | 3300050512 | nmdc:mga0n895_924_c1 | nmdc:mga0n895_924_c1_6143_6694 | 183 |
| 492 | 3300050513 | nmdc:mga0rr50_1686_c1 | nmdc:mga0rr50_1686_c1_10444_10995 | 183 |
| 493 | 3300050513 | nmdc:mga0rr50_2253_c1 | nmdc:mga0rr50_2253_c1_3707_4258 | 183 |
| 494 | 3300050513 | nmdc:mga0rr50_4538_c1 | nmdc:mga0rr50_4538_c1_4376_4927 | 183 |
| 495 | 3300050514 | nmdc:mga08x19_280598_c1 | nmdc:mga08x19_280598_c1_317_868 | 183 |
| 496 | 3300050514 | nmdc:mga08x19_418697_c1 | nmdc:mga08x19_418697_c1_61_612 | 183 |
| 497 | 3300050514 | nmdc:mga08x19_46296_c1 | nmdc:mga08x19_46296_c1_1573_2124 | 183 |
| 498 | 3300050514 | nmdc:mga08x19_820_c1 | nmdc:mga08x19_820_c1_16711_17262 | 183 |
| 499 | 3300050514 | nmdc:mga08x19_834_c1 | nmdc:mga08x19_834_c1_63_614 | 183 |
| 500 | 3300050514 | nmdc:mga08x19_8472_c1 | nmdc:mga08x19_8472_c1_5365_5916 | 183 |
| 501 | 3300050515 | nmdc:mga0a205_14210_c1 | nmdc:mga0a205_14210_c1_3712_4263 | 183 |
| 502 | 3300050515 | nmdc:mga0a205_642632_c1 | nmdc:mga0a205_642632_c1_89_640 | 183 |
| 503 | 3300050515 | nmdc:mga0a205_821_c1 | nmdc:mga0a205_821_c1_18019_18570 | 183 |
| 504 | 3300053078 | Ga0495612_0043897 | Ga0495612_0043897_648_1199 | 183 |
| 505 | 3300054114 | Ga0501084_0000832 | Ga0501084_0000832_14827_15378 | 183 |
| 506 | 3300054114 | Ga0501084_0036193 | Ga0501084_0036193_2073_2624 | 183 |
| 507 | 3300054114 | Ga0501084_0079464 | Ga0501084_0079464_2154_2705 | 183 |
| 508 | 3300054114 | Ga0501084_1106066 | Ga0501084_1106066_89_640 | 183 |
| 509 | 3300059426 | Ga0590077_012905 | Ga0590077_012905_499_1050 | 183 |
| 510 | 3300059426 | Ga0590077_025698 | Ga0590077_025698_155_706 | 183 |
| 511 | 3300060353 | Ga0501082_0013472 | Ga0501082_0013472_92_643 | 183 |
| 512 | 3300060353 | Ga0501082_0154999 | Ga0501082_0154999_541_1092 | 183 |
| 513 | 3300061734 | Ga0530510_0000042 | Ga0530510_0000042_20752_21303 | 183 |
| 514 | 3300061734 | Ga0530510_0002067 | Ga0530510_0002067_4731_5282 | 183 |
| 515 | 3300061734 | Ga0530510_0003012 | Ga0530510_0003012_2451_3002 | 183 |
| 516 | 3300002244 | JGI24742J22300_10039004 | JGI24742J22300_100390042 | 184 |
| 517 | 3300005295 | Ga0065707_10162417 | Ga0065707_101624172 | 184 |
| 518 | 3300005295 | Ga0065707_10173005 | Ga0065707_101730052 | 184 |
| 519 | 3300005330 | Ga0070690_100162476 | Ga0070690_1001624762 | 184 |
| 520 | 3300005334 | Ga0068869_100084760 | Ga0068869_1000847602 | 184 |
| 521 | 3300005336 | Ga0070680_100181943 | Ga0070680_1001819432 | 184 |
| 522 | 3300005340 | Ga0070689_100100240 | Ga0070689_1001002402 | 184 |
| 523 | 3300005345 | Ga0070692_10003772 | Ga0070692_100037722 | 184 |
| 524 | 3300005347 | Ga0070668_100010867 | Ga0070668_1000108674 | 184 |
| 525 | 3300005353 | Ga0070669_100005087 | Ga0070669_1000050875 | 184 |
| 526 | 3300005353 | Ga0070669_100489702 | Ga0070669_1004897021 | 184 |
| 527 | 3300005354 | Ga0070675_100013865 | Ga0070675_1000138656 | 184 |
| 528 | 3300005356 | Ga0070674_100137328 | Ga0070674_1001373282 | 184 |
| 529 | 3300005364 | Ga0070673_100445932 | Ga0070673_1004459322 | 184 |
| 530 | 3300005365 | Ga0070688_100100107 | Ga0070688_1001001072 | 184 |
| 531 | 3300005438 | Ga0070701_10284738 | Ga0070701_102847382 | 184 |
| 532 | 3300005441 | Ga0070700_100049744 | Ga0070700_1000497442 | 184 |
| 533 | 3300005441 | Ga0070700_100848559 | Ga0070700_1008485591 | 184 |
| 534 | 3300005444 | Ga0070694_100191082 | Ga0070694_1001910822 | 184 |
| 535 | 3300005444 | Ga0070694_101103594 | Ga0070694_1011035941 | 184 |
| 536 | 3300005459 | Ga0068867_100001149 | Ga0068867_1000011498 | 184 |
| 537 | 3300005543 | Ga0070672_100556129 | Ga0070672_1005561292 | 184 |
| 538 | 3300005546 | Ga0070696_100281171 | Ga0070696_1002811712 | 184 |
| 539 | 3300005615 | Ga0070702_100245594 | Ga0070702_1002455941 | 184 |
| 540 | 3300005617 | Ga0068859_100223324 | Ga0068859_1002233242 | 184 |
| 541 | 3300005718 | Ga0068866_10276385 | Ga0068866_102763852 | 184 |
| 542 | 3300005719 | Ga0068861_100001922 | Ga0068861_1000019223 | 184 |
| 543 | 3300005840 | Ga0068870_10147941 | Ga0068870_101479412 | 184 |
| 544 | 3300005844 | Ga0068862_100017829 | Ga0068862_1000178293 | 184 |
| 545 | 3300006844 | Ga0075428_100455879 | Ga0075428_1004558792 | 184 |
| 546 | 3300006881 | Ga0068865_100000922 | Ga0068865_1000009222 | 184 |
| 547 | 3300006931 | Ga0097620_100223334 | Ga0097620_1002233342 | 184 |
| 548 | 3300009094 | Ga0111539_10220095 | Ga0111539_102200952 | 184 |
| 549 | 3300013297 | Ga0157378_10260458 | Ga0157378_102604582 | 184 |
| 550 | 3300014745 | Ga0157377_10034443 | Ga0157377_100344433 | 184 |
| 551 | 3300025885 | Ga0207653_10007973 | Ga0207653_100079733 | 184 |
| 552 | 3300025899 | Ga0207642_10265018 | Ga0207642_102650181 | 184 |
| 553 | 3300025901 | Ga0207688_10135061 | Ga0207688_101350612 | 184 |
| 554 | 3300025908 | Ga0207643_10048143 | Ga0207643_100481432 | 184 |
| 555 | 3300025917 | Ga0207660_10033615 | Ga0207660_100336152 | 184 |
| 556 | 3300025917 | Ga0207660_10216392 | Ga0207660_102163922 | 184 |
| 557 | 3300025918 | Ga0207662_10356794 | Ga0207662_103567941 | 184 |
| 558 | 3300025923 | Ga0207681_10001419 | Ga0207681_1000141913 | 184 |
| 559 | 3300025926 | Ga0207659_10055430 | Ga0207659_100554302 | 184 |
| 560 | 3300025933 | Ga0207706_10102730 | Ga0207706_101027303 | 184 |
| 561 | 3300025935 | Ga0207709_10009182 | Ga0207709_100091825 | 184 |
| 562 | 3300025936 | Ga0207670_10203145 | Ga0207670_102031452 | 184 |
| 563 | 3300025937 | Ga0207669_10062535 | Ga0207669_100625352 | 184 |
| 564 | 3300025938 | Ga0207704_10003103 | Ga0207704_100031035 | 184 |
| 565 | 3300025940 | Ga0207691_10214908 | Ga0207691_102149082 | 184 |
| 566 | 3300025940 | Ga0207691_10562949 | Ga0207691_105629492 | 184 |
| 567 | 3300025942 | Ga0207689_10063599 | Ga0207689_100635992 | 184 |
| 568 | 3300025960 | Ga0207651_10019775 | Ga0207651_100197752 | 184 |
| 569 | 3300025961 | Ga0207712_10013044 | Ga0207712_100130445 | 184 |
| 570 | 3300025972 | Ga0207668_10012611 | Ga0207668_100126115 | 184 |
| 571 | 3300026075 | Ga0207708_10374779 | Ga0207708_103747792 | 184 |
| 572 | 3300026075 | Ga0207708_10543052 | Ga0207708_105430522 | 184 |
| 573 | 3300026089 | Ga0207648_10014513 | Ga0207648_100145132 | 184 |
| 574 | 3300026118 | Ga0207675_100000954 | Ga0207675_10000095412 | 184 |
| 575 | 3300027907 | Ga0207428_10036346 | Ga0207428_100363463 | 184 |
| 576 | 3300028380 | Ga0268265_10009414 | Ga0268265_100094144 | 184 |
| 577 | 3300035085 | Ga0373929_0069443 | Ga0373929_0069443_20_574 | 184 |
| 578 | 3300046537 | Ga0495598_0245694 | Ga0495598_0245694_91_645 | 184 |
| 579 | 3300046684 | Ga0495669_0046200 | Ga0495669_0046200_300_854 | 184 |
| 580 | 3300050509 | nmdc:mga0qj67_873766_c1 | nmdc:mga0qj67_873766_c1_29_589 | 184 |
| 581 | 3300050511 | nmdc:mga08y16_916981_c1 | nmdc:mga08y16_916981_c1_147_701 | 184 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.8101 | 14 | 171 |
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.7919 | 14 | 171 |
| 6akg-assembly2.cif.gz_C | crystal structure of mouse claudin-3 p134g mutant in complex with c-terminal fragment of clostridium perfringens enterotoxin | 0.3967 | 59 | 163 |
| 6z0c-assembly1.cif.gz_A | structure of in silico modelled artificial maquette-3 protein | 0.3642 | 9 | 173 |
| 4ckg-assembly1.cif.gz_B | helical reconstruction of acap1(bar-ph domain) decorated membrane tubules by cryo-electron microscopy | 0.3588 | 9 | 172 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37674_16_146_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.6565 | 35 | 167 | 1.20.120.550 |
| af_P37674_16_146_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.6406 | 35 | 167 | 1.20.120.550 |
| af_P78369_1_191_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.5413 | 61 | 163 | 1.20.140.150 |
| af_A0A178VGS0_23_184_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.5171 | 27 | 173 | 1.20.140.150 |
| af_A0A2R8Q922_1_191_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.5066 | 48 | 163 | 1.20.140.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E6NY68-F1-model_v4 | TRAP transporter small permease protein | 0.9453 | 14 | 172 |
GO:0005886
GO:0022857 |
| AF-A0A0P7YB44-F1-model_v4 | TRAP transporter small permease protein | 0.9452 | 22 | 176 |
GO:0005886
GO:0022857 |
| AF-A0A6M1LQ77-F1-model_v4 | TRAP transporter small permease protein | 0.944 | 11 | 177 |
GO:0005886
GO:0022857 |
| AF-A0A7Y2CXB1-F1-model_v4 | TRAP transporter small permease protein | 0.9392 | 50 | 177 |
GO:0005886
GO:0022857 |
| AF-A0A839Z9N2-F1-model_v4 | TRAP transporter small permease protein | 0.9347 | 11 | 177 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar