F466055

General Info

Members Datasets Scaffolds Average Seq Length
581 224 1162 187

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100061220|Ga0068859_1000612206
Length 217
Sequence LYCVLCQRRPSTKNKVQKTKIMNTYAKADTLMGAALAPLDSTRSAGLVIVFSLFIAASAQFAIQIGPVPITGQSFAVLLTGALLGSRLGAAAVIAYLIEGAVGLPFFANGGAGSVRFFGPTGGYLVAFPAAAYVTGAFAEHGWDKKYLTAYAAMAIGSAVIFLGGWAWFAVLTNTPPIAAFKIAVLPFLPGDAIKIALAAAVLPTGWALLKRKASGK

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
176 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
190 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
191 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
192 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
193 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
196 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
197 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
198 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
199 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
200 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
201 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
202 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
203 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
204 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
205 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
206 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
207 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
208 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
209 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
210 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
211 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
212 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
213 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
214 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
215 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
216 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 1.2
Rhizosphere 98.28
Stem 0
Stem Tuber 0
Unclassified 19.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100061220 3300005617 Bacteria 3793
2 CNAas_1004799 3300000532 Viruses 869
3 JGI24751J29686_10000009 3300002459 Bacteria 125815
4 JGI25406J46586_10037526 3300003203 Bacteria 1745
5 JGI25406J46586_10082447 3300003203 Bacteria 984
6 Ga0065704_10002024 3300005289 Bacteria 6589
7 Ga0065704_10020024 3300005289 Bacteria 2110
8 Ga0065712_10144027 3300005290 Bacteria 1424
9 Ga0065715_10093695 3300005293 Bacteria 4596
10 Ga0065715_10096584 3300005293 Bacteria 3855
11 Ga0065707_10004910 3300005295 Bacteria 5576
12 Ga0065707_10170678 3300005295 Bacteria 1485
13 Ga0070690_100015964 3300005330 Bacteria 4488
14 Ga0070690_100018781 3300005330 Bacteria 4183
15 Ga0070690_100162563 3300005330 Unclassified 1531
16 Ga0070670_100000088 3300005331 Bacteria 87898
17 Ga0070670_100002133 3300005331 Bacteria 16242
18 Ga0070670_100101088 3300005331 Bacteria 2482
19 Ga0070670_100251495 3300005331 Bacteria 1540
20 Ga0070670_100390168 3300005331 Bacteria 1228
21 Ga0070670_100432939 3300005331 Unclassified 1164
22 Ga0070670_100586188 3300005331 Unclassified 997
23 Ga0070670_101025853 3300005331 Bacteria 751
24 Ga0068869_100011215 3300005334 Bacteria 5871
25 Ga0068869_100672276 3300005334 Bacteria 881
26 Ga0070666_10083818 3300005335 Bacteria 2181
27 Ga0070680_100174956 3300005336 Bacteria 1807
28 Ga0070680_100197540 3300005336 Bacteria 1696
29 Ga0070680_100309891 3300005336 Bacteria 1339
30 Ga0070680_100830649 3300005336 Bacteria 796
31 Ga0070682_100000076 3300005337 Bacteria 90097
32 Ga0070682_100024522 3300005337 Bacteria 3591
33 Ga0070682_100129380 3300005337 Bacteria 1707
34 Ga0068868_100190534 3300005338 Bacteria 1705
35 Ga0068868_100769018 3300005338 Bacteria 867
36 Ga0070660_100194905 3300005339 Bacteria 1642
37 Ga0070689_100011044 3300005340 Bacteria 6456
38 Ga0070689_100036058 3300005340 Bacteria 3782
39 Ga0070689_100172990 3300005340 Bacteria 1750
40 Ga0070689_100784895 3300005340 Unclassified 837
41 Ga0070687_100016822 3300005343 Bacteria 3347
42 Ga0070687_100251808 3300005343 Unclassified 1098
43 Ga0070661_100120778 3300005344 Bacteria 1963
44 Ga0070661_100399070 3300005344 Unclassified 1087
45 Ga0070692_10015443 3300005345 Bacteria 3612
46 Ga0070692_10062640 3300005345 Unclassified 1963
47 Ga0070692_10129488 3300005345 Bacteria 1417
48 Ga0070669_100000653 3300005353 Bacteria 25664
49 Ga0070669_100694048 3300005353 Unclassified 859
50 Ga0070669_100727478 3300005353 Unclassified 839
51 Ga0070669_100840719 3300005353 Bacteria 782
52 Ga0070675_100182319 3300005354 Bacteria 1816
53 Ga0070675_100313032 3300005354 Bacteria 1386
54 Ga0070675_100507706 3300005354 Bacteria 1087
55 Ga0070671_100375470 3300005355 Bacteria 1215
56 Ga0070674_100605952 3300005356 Unclassified 926
57 Ga0070673_100560376 3300005364 Bacteria 1039
58 Ga0070688_100715146 3300005365 Unclassified 777
59 Ga0070659_100021240 3300005366 Bacteria 4939
60 Ga0070667_101328399 3300005367 Unclassified 674
61 Ga0070703_10004011 3300005406 Bacteria 4162
62 Ga0070703_10082335 3300005406 Unclassified 1099
63 Ga0070701_10066186 3300005438 Bacteria 1919
64 Ga0070705_100031453 3300005440 Bacteria 2939
65 Ga0070705_100486706 3300005440 Unclassified 933
66 Ga0070705_100727880 3300005440 Unclassified 782
67 Ga0070700_100000120 3300005441 Bacteria 48358
68 Ga0070700_100012086 3300005441 Bacteria 4801
69 Ga0070700_100058231 3300005441 Bacteria 2426
70 Ga0070694_100010143 3300005444 Bacteria 5798
71 Ga0070694_100014091 3300005444 Bacteria 5003
72 Ga0070694_100018959 3300005444 Bacteria 4371
73 Ga0070694_100129546 3300005444 Bacteria 1821
74 Ga0070694_100153467 3300005444 Bacteria 1684
75 Ga0070694_100309864 3300005444 Bacteria 1212
76 Ga0070694_100412065 3300005444 Bacteria 1060
77 Ga0070694_101008669 3300005444 Unclassified 691
78 Ga0070708_100000269 3300005445 Bacteria 38570
79 Ga0070708_100163539 3300005445 Bacteria 2075
80 Ga0070708_100561435 3300005445 Bacteria 1076
81 Ga0070708_100953841 3300005445 Unclassified 805
82 Ga0070662_100062884 3300005457 Bacteria 2713
83 Ga0070662_100281390 3300005457 Bacteria 1346
84 Ga0070681_10001081 3300005458 Bacteria 23250
85 Ga0070681_10023141 3300005458 Bacteria 6249
86 Ga0068867_100015751 3300005459 Bacteria 5366
87 Ga0068867_100753949 3300005459 Unclassified 864
88 Ga0070706_100009844 3300005467 Bacteria 8882
89 Ga0070706_100092242 3300005467 Bacteria 2810
90 Ga0070706_100337135 3300005467 Bacteria 1406
91 Ga0070707_100029143 3300005468 Bacteria 5255
92 Ga0070707_100200920 3300005468 Bacteria 1943
93 Ga0070707_100240208 3300005468 Bacteria 1763
94 Ga0070707_100576107 3300005468 Unclassified 1088
95 Ga0070707_100622607 3300005468 Unclassified 1042
96 Ga0070698_100002172 3300005471 Bacteria 21757
97 Ga0070698_100003919 3300005471 Bacteria 16358
98 Ga0070698_100025413 3300005471 Bacteria 6173
99 Ga0070699_100007321 3300005518 Bacteria 9605
100 Ga0070699_100020745 3300005518 Bacteria 5667
101 Ga0070699_100029062 3300005518 Bacteria 4766
102 Ga0070699_100050484 3300005518 Bacteria 3601
103 Ga0070699_100397507 3300005518 Bacteria 1246
104 Ga0070699_100409167 3300005518 Bacteria 1227
105 Ga0070679_100026832 3300005530 Bacteria 5664
106 Ga0070697_100000477 3300005536 Bacteria 30446
107 Ga0070697_100000865 3300005536 Bacteria 22780
108 Ga0070697_100003047 3300005536 Bacteria 12857
109 Ga0070697_100063349 3300005536 Bacteria 3019
110 Ga0070697_100096320 3300005536 Bacteria 2455
111 Ga0068853_100026724 3300005539 Bacteria 4848
112 Ga0068853_100104609 3300005539 Bacteria 2506
113 Ga0070672_100332774 3300005543 Unclassified 1292
114 Ga0070686_100002652 3300005544 Bacteria 9859
115 Ga0070686_100006232 3300005544 Bacteria 6624
116 Ga0070686_100730356 3300005544 Unclassified 792
117 Ga0070695_100092125 3300005545 Bacteria 2025
118 Ga0070695_100197870 3300005545 Bacteria 1434
119 Ga0070695_100463511 3300005545 Bacteria 973
120 Ga0070696_100000807 3300005546 Bacteria 20137
121 Ga0070696_100055801 3300005546 Bacteria 2755
122 Ga0070696_100162571 3300005546 Bacteria 1646
123 Ga0070696_100434533 3300005546 Bacteria 1033
124 Ga0070696_100663728 3300005546 Unclassified 846
125 Ga0070696_100705212 3300005546 Unclassified 823
126 Ga0070693_100142673 3300005547 Bacteria 1509
127 Ga0070693_100198032 3300005547 Bacteria 1303
128 Ga0070693_100199923 3300005547 Bacteria 1297
129 Ga0070665_100460583 3300005548 Unclassified 1282
130 Ga0070665_100674091 3300005548 Bacteria 1047
131 Ga0070704_100077059 3300005549 Bacteria 2441
132 Ga0070704_100088732 3300005549 Bacteria 2298
133 Ga0070704_100134867 3300005549 Bacteria 1919
134 Ga0070704_100531181 3300005549 Bacteria 1025
135 Ga0070704_100558024 3300005549 Unclassified 1001
136 Ga0070704_100645018 3300005549 Unclassified 934
137 Ga0068855_100376985 3300005563 Bacteria 1558
138 Ga0070664_100013034 3300005564 Bacteria 6764
139 Ga0070664_100747372 3300005564 Unclassified 913
140 Ga0068857_100075447 3300005577 Bacteria 3006
141 Ga0068857_100287001 3300005577 Viruses 1515
142 Ga0068857_100690879 3300005577 Unclassified 969
143 Ga0068857_100850614 3300005577 Bacteria 873
144 Ga0070702_100037906 3300005615 Bacteria 2680
145 Ga0070702_100132448 3300005615 Bacteria 1576
146 Ga0070702_100194408 3300005615 Bacteria 1338
147 Ga0070702_100674728 3300005615 Bacteria 785
148 Ga0068852_100065249 3300005616 Bacteria 3176
149 Ga0068859_100009793 3300005617 Bacteria 9681
150 Ga0068859_100043654 3300005617 Bacteria 4506
151 Ga0068859_100135827 3300005617 Bacteria 2532
152 Ga0068859_100147609 3300005617 Bacteria 2427
153 Ga0068859_100170560 3300005617 Bacteria 2257
154 Ga0068859_100250767 3300005617 Bacteria 1861
155 Ga0068859_100448740 3300005617 Bacteria 1386
156 Ga0068859_100641952 3300005617 Bacteria 1154
157 Ga0068859_100828759 3300005617 Bacteria 1012
158 Ga0068859_100939065 3300005617 Bacteria 949
159 Ga0068859_101087372 3300005617 Bacteria 879
160 Ga0068859_101348005 3300005617 Unclassified 787
161 Ga0068859_101405011 3300005617 Bacteria 770
162 Ga0068859_101749092 3300005617 Unclassified 687
163 Ga0068864_100020978 3300005618 Bacteria 5471
164 Ga0068864_100073774 3300005618 Bacteria 2975
165 Ga0068864_100098515 3300005618 Bacteria 2589
166 Ga0068864_100395665 3300005618 Bacteria 1312
167 Ga0068864_100527152 3300005618 Bacteria 1139
168 Ga0068864_100564493 3300005618 Bacteria 1101
169 Ga0068864_100877680 3300005618 Bacteria 885
170 Ga0068861_100046275 3300005719 Bacteria 3279
171 Ga0068861_100065061 3300005719 Unclassified 2807
172 Ga0068851_10000582 3300005834 Bacteria 15892
173 Ga0068870_10074945 3300005840 Bacteria 1855
174 Ga0068870_10118522 3300005840 Unclassified 1521
175 Ga0068870_10164443 3300005840 Bacteria 1319
176 Ga0068870_10407825 3300005840 Bacteria 886
177 Ga0068863_100057112 3300005841 Bacteria 3694
178 Ga0068863_100147563 3300005841 Bacteria 2250
179 Ga0068863_100288825 3300005841 Unclassified 1590
180 Ga0068863_100670106 3300005841 Bacteria 1030
181 Ga0068858_100054083 3300005842 Bacteria 3712
182 Ga0068858_100223501 3300005842 Bacteria 1784
183 Ga0068858_100224482 3300005842 Bacteria 1780
184 Ga0068858_100304258 3300005842 Unclassified 1521
185 Ga0068858_100485653 3300005842 Bacteria 1192
186 Ga0068860_100014175 3300005843 Bacteria 7817
187 Ga0068860_100107392 3300005843 Bacteria 2667
188 Ga0068860_100147630 3300005843 Bacteria 2263
189 Ga0068860_100223893 3300005843 Bacteria 1827
190 Ga0068860_100385188 3300005843 Bacteria 1385
191 Ga0068860_100906359 3300005843 Unclassified 898
192 Ga0068860_100923893 3300005843 Unclassified 889
193 Ga0068862_100196142 3300005844 Bacteria 1819
194 Ga0081539_10000408 3300005985 Bacteria 91634
195 Ga0081539_10000725 3300005985 Bacteria 66076
196 Ga0081539_10002782 3300005985 Bacteria 23520
197 Ga0081539_10004753 3300005985 Bacteria 14668
198 Ga0097621_100005680 3300006237 Bacteria 8808
199 Ga0097621_100175519 3300006237 Bacteria 1849
200 Ga0097621_100636333 3300006237 Bacteria 978
201 Ga0068871_100005259 3300006358 Bacteria 9060
202 Ga0068871_100102557 3300006358 Bacteria 2398
203 Ga0068871_100378694 3300006358 Bacteria 1257
204 Ga0075428_100390387 3300006844 Bacteria 1492
205 Ga0075430_100028960 3300006846 Bacteria 4701
206 Ga0075430_100056687 3300006846 Bacteria 3295
207 Ga0075431_100250826 3300006847 Bacteria 1798
208 Ga0075431_100372229 3300006847 Viruses 1433
209 Ga0075431_100601681 3300006847 Bacteria 1083
210 Ga0075433_10056161 3300006852 Bacteria 3438
211 Ga0075433_10056982 3300006852 Bacteria 3415
212 Ga0075433_10086456 3300006852 Bacteria 2768
213 Ga0075433_10099491 3300006852 Bacteria 2574
214 Ga0075433_10461765 3300006852 Bacteria 1119
215 Ga0075434_100041540 3300006871 Bacteria 4556
216 Ga0075434_100055282 3300006871 Bacteria 3944
217 Ga0075434_100361024 3300006871 Bacteria 1473
218 Ga0075434_100616397 3300006871 Bacteria 1104
219 Ga0075434_101024719 3300006871 Unclassified 839
220 Ga0075429_100216637 3300006880 Bacteria 1677
221 Ga0068865_100117045 3300006881 Bacteria 1975
222 Ga0068865_100535394 3300006881 Unclassified 982
223 Ga0097620_100009793 3300006931 Bacteria 9681
224 Ga0097620_100043656 3300006931 Bacteria 4506
225 Ga0097620_100061224 3300006931 Bacteria 3793
226 Ga0097620_100135833 3300006931 Bacteria 2532
227 Ga0097620_100147600 3300006931 Bacteria 2427
228 Ga0097620_100170561 3300006931 Bacteria 2257
229 Ga0097620_100250757 3300006931 Bacteria 1861
230 Ga0097620_100448720 3300006931 Bacteria 1386
231 Ga0097620_100641914 3300006931 Bacteria 1154
232 Ga0097620_100828700 3300006931 Bacteria 1012
233 Ga0097620_100939033 3300006931 Bacteria 949
234 Ga0097620_101087520 3300006931 Bacteria 879
235 Ga0097620_101347916 3300006931 Unclassified 787
236 Ga0097620_101404975 3300006931 Bacteria 770
237 Ga0097620_101749098 3300006931 Unclassified 687
238 Ga0105251_10083054 3300009011 Bacteria 1479
239 Ga0105250_10249588 3300009092 Unclassified 758
240 Ga0105240_10405927 3300009093 Bacteria 1534
241 Ga0105240_10758489 3300009093 Bacteria 1054
242 Ga0105240_10999270 3300009093 Unclassified 895
243 Ga0111539_10005075 3300009094 Bacteria 17101
244 Ga0111539_10673222 3300009094 Bacteria 1205
245 Ga0105247_10007521 3300009101 Bacteria 6677
246 Ga0105247_10138127 3300009101 Bacteria 1594
247 Ga0105247_10532029 3300009101 Unclassified 861
248 Ga0105247_10760244 3300009101 Bacteria 735
249 Ga0114129_10126690 3300009147 Bacteria 3510
250 Ga0114129_10319070 3300009147 Bacteria 2066
251 Ga0114129_10443078 3300009147 Bacteria 1705
252 Ga0114129_10801444 3300009147 Bacteria 1201
253 Ga0114129_11050969 3300009147 Bacteria 1022
254 Ga0105243_10022028 3300009148 Bacteria 4840
255 Ga0105243_10081907 3300009148 Bacteria 2636
256 Ga0105243_10428102 3300009148 Bacteria 1236
257 Ga0105241_10111097 3300009174 Bacteria 2194
258 Ga0105241_10403335 3300009174 Bacteria 1200
259 Ga0105241_10444178 3300009174 Bacteria 1146
260 Ga0105241_10756268 3300009174 Unclassified 892
261 Ga0105241_10784515 3300009174 Unclassified 876
262 Ga0105242_10045054 3300009176 Bacteria 3574
263 Ga0105242_10137857 3300009176 Bacteria 2114
264 Ga0105242_10165267 3300009176 Bacteria 1941
265 Ga0105242_10809312 3300009176 Unclassified 928
266 Ga0105248_10001941 3300009177 Bacteria 22973
267 Ga0105248_10023136 3300009177 Bacteria 6901
268 Ga0105248_10095139 3300009177 Bacteria 3354
269 Ga0105248_10115307 3300009177 Bacteria 3030
270 Ga0105248_10137662 3300009177 Bacteria 2754
271 Ga0105248_10234934 3300009177 Bacteria 2064
272 Ga0105248_10625515 3300009177 Bacteria 1215
273 Ga0105237_10002609 3300009545 Bacteria 22195
274 Ga0105237_10046618 3300009545 Bacteria 4359
275 Ga0105237_10918953 3300009545 Unclassified 882
276 Ga0105238_10008842 3300009551 Bacteria 10074
277 Ga0105249_10004897 3300009553 Bacteria 11556
278 Ga0105249_10011545 3300009553 Bacteria 7761
279 Ga0105249_10038427 3300009553 Bacteria 4343
280 Ga0105249_10704586 3300009553 Bacteria 1070
281 Ga0105249_11736892 3300009553 Unclassified 696
282 Ga0105239_10156373 3300010375 Bacteria 2546
283 Ga0105239_10363164 3300010375 Bacteria 1635
284 Ga0105239_10627564 3300010375 Bacteria 1227
285 Ga0105239_10909137 3300010375 Unclassified 1010
286 Ga0105239_11557051 3300010375 Unclassified 764
287 Ga0105246_10163523 3300011119 Bacteria 1698
288 Ga0105246_10261113 3300011119 Unclassified 1380
289 Ga0105246_10280755 3300011119 Unclassified 1336
290 Ga0105246_10445813 3300011119 Bacteria 1086
291 Ga0105246_10921853 3300011119 Unclassified 785
292 Ga0157373_10067675 3300013100 Bacteria 2525
293 Ga0157373_10097233 3300013100 Bacteria 2073
294 Ga0157373_10107791 3300013100 Bacteria 1959
295 Ga0157373_10310646 3300013100 Bacteria 1120
296 Ga0157374_10390716 3300013296 Unclassified 1387
297 Ga0157378_10001282 3300013297 Bacteria 22599
298 Ga0157378_10047838 3300013297 Bacteria 3803
299 Ga0157378_10113458 3300013297 Bacteria 2488
300 Ga0157378_10151655 3300013297 Bacteria 2160
301 Ga0157378_11004316 3300013297 Bacteria 869
302 Ga0163162_10010804 3300013306 Bacteria 8881
303 Ga0163162_10011606 3300013306 Bacteria 8591
304 Ga0163162_10155323 3300013306 Bacteria 2408
305 Ga0163162_10338734 3300013306 Bacteria 1636
306 Ga0163162_10604757 3300013306 Bacteria 1222
307 Ga0163162_11943537 3300013306 Bacteria 674
308 Ga0157372_10010912 3300013307 Bacteria 9669
309 Ga0157372_10861705 3300013307 Unclassified 1051
310 Ga0157372_10910458 3300013307 Unclassified 1020
311 Ga0157372_11431326 3300013307 Bacteria 797
312 Ga0157375_10023552 3300013308 Bacteria 5683
313 Ga0157375_10212501 3300013308 Bacteria 2092
314 Ga0157375_10547155 3300013308 Bacteria 1319
315 Ga0157375_10910123 3300013308 Unclassified 1023
316 Ga0157375_11553500 3300013308 Unclassified 782
317 Ga0157375_12028158 3300013308 Unclassified 684
318 Ga0163163_10000590 3300014325 Bacteria 31968
319 Ga0163163_10001831 3300014325 Bacteria 17942
320 Ga0163163_10011046 3300014325 Bacteria 8167
321 Ga0163163_10052048 3300014325 Bacteria 4038
322 Ga0163163_10181738 3300014325 Bacteria 2150
323 Ga0163163_10192357 3300014325 Bacteria 2088
324 Ga0163163_10479281 3300014325 Unclassified 1305
325 Ga0163163_10618026 3300014325 Unclassified 1147
326 Ga0163163_10809672 3300014325 Bacteria 1000
327 Ga0163163_11586057 3300014325 Unclassified 716
328 Ga0157380_10002027 3300014326 Bacteria 13525
329 Ga0157380_10100431 3300014326 Bacteria 2409
330 Ga0157377_10391349 3300014745 Unclassified 944
331 Ga0157379_10343357 3300014968 Bacteria 1366
332 Ga0157376_10348510 3300014969 Bacteria 1416
333 Ga0157376_11024594 3300014969 Unclassified 849
334 Ga0157376_11146291 3300014969 Unclassified 804
335 Ga0182007_10024432 3300015262 Bacteria 2114
336 Ga0163161_10019128 3300017792 Bacteria 4802
337 Ga0163161_10401037 3300017792 Bacteria 1100
338 Ga0213876_10070164 3300021384 Bacteria 1851
339 Ga0207653_10001174 3300025885 Bacteria 8552
340 Ga0207653_10053686 3300025885 Bacteria 1346
341 Ga0207642_10187718 3300025899 Bacteria 1132
342 Ga0207710_10280319 3300025900 Unclassified 839
343 Ga0207680_10493654 3300025903 Unclassified 871
344 Ga0207647_10097582 3300025904 Bacteria 1747
345 Ga0207643_10027474 3300025908 Bacteria 3155
346 Ga0207643_10031093 3300025908 Bacteria 2975
347 Ga0207643_10107525 3300025908 Bacteria 1640
348 Ga0207643_10432640 3300025908 Unclassified 835
349 Ga0207643_10452757 3300025908 Unclassified 817
350 Ga0207684_10004928 3300025910 Bacteria 12454
351 Ga0207684_10068907 3300025910 Bacteria 3007
352 Ga0207654_10448093 3300025911 Unclassified 905
353 Ga0207707_10045674 3300025912 Bacteria 3816
354 Ga0207707_10215548 3300025912 Bacteria 1671
355 Ga0207707_10266692 3300025912 Bacteria 1485
356 Ga0207695_10251651 3300025913 Bacteria 1666
357 Ga0207671_10001556 3300025914 Bacteria 26259
358 Ga0207671_10617654 3300025914 Unclassified 864
359 Ga0207660_10148022 3300025917 Bacteria 1802
360 Ga0207660_10217446 3300025917 Bacteria 1498
361 Ga0207660_10738938 3300025917 Bacteria 803
362 Ga0207662_10020084 3300025918 Bacteria 3810
363 Ga0207662_10424708 3300025918 Unclassified 905
364 Ga0207657_10218200 3300025919 Bacteria 1529
365 Ga0207649_10119298 3300025920 Bacteria 1776
366 Ga0207646_10017182 3300025922 Bacteria 6775
367 Ga0207646_10439423 3300025922 Bacteria 1177
368 Ga0207681_10000828 3300025923 Bacteria 20413
369 Ga0207681_10565609 3300025923 Unclassified 937
370 Ga0207681_10743794 3300025923 Unclassified 817
371 Ga0207681_10899144 3300025923 Unclassified 741
372 Ga0207694_10193800 3300025924 Bacteria 1652
373 Ga0207694_10213720 3300025924 Bacteria 1571
374 Ga0207650_10000001 3300025925 Bacteria 1545726
375 Ga0207650_10002163 3300025925 Bacteria 13736
376 Ga0207650_10075088 3300025925 Bacteria 2550
377 Ga0207650_10173876 3300025925 Unclassified 1713
378 Ga0207650_10655784 3300025925 Bacteria 885
379 Ga0207659_10336957 3300025926 Bacteria 1248
380 Ga0207687_10441516 3300025927 Bacteria 1078
381 Ga0207644_10053683 3300025931 Bacteria 2901
382 Ga0207644_10297319 3300025931 Unclassified 1300
383 Ga0207690_10038588 3300025932 Bacteria 3109
384 Ga0207690_10365895 3300025932 Unclassified 1143
385 Ga0207686_10091693 3300025934 Bacteria 2007
386 Ga0207709_10000921 3300025935 Bacteria 22171
387 Ga0207709_10089870 3300025935 Bacteria 2004
388 Ga0207709_10191414 3300025935 Bacteria 1453
389 Ga0207670_10000250 3300025936 Bacteria 33568
390 Ga0207670_10008901 3300025936 Bacteria 5691
391 Ga0207670_10695466 3300025936 Unclassified 841
392 Ga0207669_10568413 3300025937 Unclassified 917
393 Ga0207704_10664653 3300025938 Unclassified 859
394 Ga0207691_10242854 3300025940 Bacteria 1557
395 Ga0207711_10006665 3300025941 Bacteria 9721
396 Ga0207711_10025712 3300025941 Bacteria 4937
397 Ga0207711_10074154 3300025941 Bacteria 2959
398 Ga0207711_10171018 3300025941 Bacteria 1971
399 Ga0207689_10033473 3300025942 Bacteria 4270
400 Ga0207689_10037070 3300025942 Bacteria 4046
401 Ga0207689_10038011 3300025942 Bacteria 3988
402 Ga0207689_10174434 3300025942 Bacteria 1773
403 Ga0207689_10273566 3300025942 Bacteria 1398
404 Ga0207679_10003584 3300025945 Bacteria 9625
405 Ga0207679_10067039 3300025945 Bacteria 2692
406 Ga0207667_10192799 3300025949 Bacteria 2091
407 Ga0207667_10524671 3300025949 Unclassified 1200
408 Ga0207651_10122773 3300025960 Bacteria 1973
409 Ga0207651_11073143 3300025960 Unclassified 721
410 Ga0207712_10130801 3300025961 Bacteria 1912
411 Ga0207712_10173148 3300025961 Bacteria 1689
412 Ga0207677_10036141 3300026023 Bacteria 3216
413 Ga0207677_10213707 3300026023 Bacteria 1542
414 Ga0207703_10044491 3300026035 Bacteria 3568
415 Ga0207703_10048865 3300026035 Bacteria 3417
416 Ga0207703_10118684 3300026035 Bacteria 2268
417 Ga0207703_10206830 3300026035 Bacteria 1747
418 Ga0207703_10340943 3300026035 Bacteria 1377
419 Ga0207703_10387251 3300026035 Bacteria 1294
420 Ga0207703_10467672 3300026035 Bacteria 1180
421 Ga0207639_10031372 3300026041 Bacteria 3905
422 Ga0207708_10000196 3300026075 Bacteria 47880
423 Ga0207708_10017117 3300026075 Bacteria 5456
424 Ga0207708_10026675 3300026075 Bacteria 4374
425 Ga0207708_10496879 3300026075 Unclassified 1022
426 Ga0207641_10161721 3300026088 Bacteria 2036
427 Ga0207641_10212255 3300026088 Bacteria 1791
428 Ga0207641_10285906 3300026088 Bacteria 1553
429 Ga0207641_10393753 3300026088 Bacteria 1329
430 Ga0207641_10448441 3300026088 Bacteria 1246
431 Ga0207641_10655653 3300026088 Bacteria 1031
432 Ga0207676_10003808 3300026095 Bacteria 10661
433 Ga0207676_10023095 3300026095 Bacteria 4582
434 Ga0207676_10082090 3300026095 Bacteria 2620
435 Ga0207676_10326944 3300026095 Bacteria 1410
436 Ga0207676_10593347 3300026095 Viruses 1063
437 Ga0207676_10918658 3300026095 Unclassified 859
438 Ga0207674_10023367 3300026116 Bacteria 6624
439 Ga0207674_10044107 3300026116 Bacteria 4595
440 Ga0207674_10397766 3300026116 Bacteria 1332
441 Ga0207674_10912626 3300026116 Unclassified 847
442 Ga0207674_11494029 3300026116 Unclassified 645
443 Ga0207675_100026320 3300026118 Bacteria 5415
444 Ga0207675_100427092 3300026118 Bacteria 1310
445 Ga0207675_100443904 3300026118 Bacteria 1285
446 Ga0207675_100890839 3300026118 Bacteria 906
447 Ga0207675_101062867 3300026118 Unclassified 829
448 Ga0207698_10115082 3300026142 Bacteria 2264
449 Ga0207428_10003589 3300027907 Bacteria 14977
450 Ga0268265_10174436 3300028380 Bacteria 1841
451 Ga0268265_10401499 3300028380 Bacteria 1267
452 Ga0268264_10034831 3300028381 Bacteria 4144
453 Ga0268264_10165345 3300028381 Bacteria 1997
454 Ga0268264_10211529 3300028381 Bacteria 1780
455 Ga0268264_10653212 3300028381 Unclassified 1041
456 Ga0307408_100166790 3300031548 Bacteria 1755
457 Ga0307408_100279011 3300031548 Bacteria 1391
458 Ga0307408_100569282 3300031548 Unclassified 1002
459 Ga0307405_10016765 3300031731 Bacteria 4002
460 Ga0307405_10466233 3300031731 Unclassified 1005
461 Ga0307405_10920295 3300031731 Unclassified 741
462 Ga0307413_10235322 3300031824 Bacteria 1348
463 Ga0307410_10002023 3300031852 Bacteria 9564
464 Ga0307410_10532488 3300031852 Bacteria 971
465 Ga0307410_10843411 3300031852 Unclassified 782
466 Ga0307406_10009008 3300031901 Bacteria 5580
467 Ga0307406_10096046 3300031901 Bacteria 2007
468 Ga0307407_10038002 3300031903 Bacteria 2664
469 Ga0307407_10278998 3300031903 Bacteria 1157
470 Ga0307412_10006046 3300031911 Bacteria 6814
471 Ga0307412_10302740 3300031911 Bacteria 1264
472 Ga0307412_11036143 3300031911 Unclassified 727
473 Ga0307409_100802542 3300031995 Bacteria 949
474 Ga0307409_100813035 3300031995 Unclassified 943
475 Ga0307409_100851786 3300031995 Unclassified 922
476 Ga0307416_100008158 3300032002 Bacteria 6730
477 Ga0307416_100091493 3300032002 Bacteria 2613
478 Ga0307414_10004981 3300032004 Bacteria 7263
479 Ga0307414_10111575 3300032004 Bacteria 2083
480 Ga0307414_10137285 3300032004 Bacteria 1909
481 Ga0307414_10384623 3300032004 Bacteria 1214
482 Ga0307411_10025260 3300032005 Bacteria 3557
483 Ga0307411_10034092 3300032005 Bacteria 3164
484 Ga0307411_10189267 3300032005 Bacteria 1570
485 Ga0307411_10531268 3300032005 Unclassified 1000
486 Ga0307415_100005908 3300032126 Bacteria 6550
487 Ga0307415_100056649 3300032126 Bacteria 2689
488 Ga0373940_0028690 3300035088 Bacteria 1470
489 Ga0373951_0001417 3300035091 Bacteria 6298
490 Ga0373952_0046334 3300035092 Bacteria 1022
491 Ga0373941_0004953 3300035115 Bacteria 3103
492 Ga0373961_0071659 3300035241 Bacteria 1073
493 Ga0373937_0111494 3300036401 Bacteria 2545
494 Ga0395899_0701440 3300037312 Unclassified 635
495 Ga0395900_0110160 3300037418 Bacteria 2829
496 Ga0395900_0417052 3300037418 Bacteria 1304
497 Ga0395905_0699103 3300037471 Unclassified 916
498 Ga0242420_003259 3300038996 Bacteria 2391
499 Ga0436365_1168610 3300039437 Bacteria 2151
500 Ga0439455_0102744 3300042012 Bacteria 791
501 Ga0439458_0056688 3300042157 Bacteria 973
502 Ga0453683_0022475 3300044673 Bacteria 4024
503 Ga0451576_0225117 3300045051 Bacteria 1958
504 Ga0451576_0734647 3300045051 Bacteria 1037
505 Ga0451576_1196201 3300045051 Bacteria 794
506 Ga0495663_0000393 3300046525 Bacteria 16144
507 Ga0495598_0000084 3300046537 Bacteria 15504
508 Ga0495621_0000175 3300046539 Bacteria 14565
509 Ga0495672_0015382 3300047320 Bacteria 5197
510 Ga0496100_0240743 3300048903 Bacteria 1335
511 Ga0496106_0309594 3300048909 Bacteria 1267
512 Ga0496107_0092934 3300048910 Bacteria 2206
513 Ga0496108_0057670 3300048911 Bacteria 3263
514 Ga0496112_0221663 3300048915 Bacteria 1847
515 Ga0496113_0487710 3300048916 Bacteria 990
516 Ga0496113_0612397 3300048916 Bacteria 872
517 Ga0501291_015080 3300049514 Bacteria 1164
518 Ga0501292_104409 3300049515 Unclassified 564
519 Ga0501295_019714 3300049518 Bacteria 1214
520 Ga0501298_000146 3300049521 Bacteria 8619
521 Ga0501298_004317 3300049521 Bacteria 2233
522 Ga0501303_004134 3300049526 Bacteria 1190
523 Ga0501077_0193558 3300049593 Bacteria 1292
524 Ga0501077_0509223 3300049593 Bacteria 772
525 Ga0501201_030284 3300049651 Unclassified 614
526 Ga0501206_024255 3300049653 Bacteria 877
527 Ga0501207_008265 3300049654 Bacteria 1501
528 Ga0501208_048647 3300049655 Bacteria 803
529 Ga0501216_014110 3300049660 Bacteria 1332
530 Ga0501216_111791 3300049660 Unclassified 614
531 Ga0501217_000882 3300049661 Bacteria 5335
532 Ga0501217_065604 3300049661 Bacteria 978
533 Ga0501223_002684 3300049663 Bacteria 3915
534 Ga0501224_000129 3300049664 Bacteria 8262
535 Ga0501224_002783 3300049664 Bacteria 2410
536 Ga0501227_001010 3300049665 Bacteria 6235
537 Ga0501233_007331 3300049668 Bacteria 2096
538 Ga0501233_015734 3300049668 Bacteria 1562
539 Ga0501233_049880 3300049668 Unclassified 1011
540 Ga0501235_001520 3300049669 Bacteria 4965
541 Ga0501235_005769 3300049669 Bacteria 2692
542 Ga0501235_020306 3300049669 Bacteria 1475
543 Ga0501255_002581 3300049684 Bacteria 1603
544 Ga0501256_007175 3300049685 Bacteria 1019
545 Ga0501257_042787 3300049686 Bacteria 1115
546 Ga0501257_128546 3300049686 Unclassified 684
547 Ga0501261_020309 3300049690 Bacteria 949
548 Ga0501225_0000145 3300049705 Bacteria 21644
549 Ga0501225_0030880 3300049705 Unclassified 1474
550 Ga0501225_0042544 3300049705 Bacteria 1255
551 Ga0501225_0228636 3300049705 Unclassified 602
552 Ga0501234_000075 3300049707 Bacteria 12283
553 Ga0501234_002094 3300049707 Bacteria 3154
554 Ga0501245_007859 3300049708 Bacteria 1513
555 Ga0501263_015678 3300049760 Unclassified 981
556 Ga0501283_003237 3300049779 Bacteria 2145
557 Ga0501283_018382 3300049779 Bacteria 1100
558 Ga0501283_020651 3300049779 Bacteria 1051
559 Ga0501204_042774 3300049850 Unclassified 670
560 Ga0501212_000437 3300049851 Bacteria 4013
561 nmdc:mga05p37_425135_c1 3300050507 Bacteria 1545
562 nmdc:mga05p37_546945_c1 3300050507 Bacteria 1319
563 nmdc:mga05p37_926222_c1 3300050507 Unclassified 936
564 nmdc:mga05p37_961742_c1 3300050507 Bacteria 912
565 nmdc:mga0qj67_174856_c1 3300050509 Bacteria 1744
566 nmdc:mga06r32_269818_c1 3300050510 Bacteria 1689
567 nmdc:mga06r32_683695_c1 3300050510 Viruses 993
568 nmdc:mga08y16_3905_c1 3300050511 Bacteria 15524
569 nmdc:mga08y16_70409_c1 3300050511 Bacteria 3646
570 nmdc:mga0n895_129567_c1 3300050512 Bacteria 2547
571 nmdc:mga0n895_520163_c1 3300050512 Bacteria 1197
572 nmdc:mga0n895_559007_c1 3300050512 Bacteria 1149
573 nmdc:mga0a205_175660_c1 3300050515 Bacteria 2037
574 nmdc:mga0a205_360527_c1 3300050515 Bacteria 1320
575 nmdc:mga0a205_363498_c1 3300050515 Bacteria 1313
576 nmdc:mga0a205_43896_c1 3300050515 Bacteria 4309
577 nmdc:mga0a205_56269_c1 3300050515 Bacteria 3797
578 nmdc:mga0a205_67765_c1 3300050515 Unclassified 3448
579 nmdc:mga0a205_69328_c1 3300050515 Bacteria 3405
580 Ga0500568_0110198 3300053139 Bacteria 1029
581 Ga0530510_0081276 3300061734 Bacteria 2359
582 Ga0068859_100061220
583 CNAas_1004799
584 JGI24751J29686_10000009
585 JGI25406J46586_10037526
586 JGI25406J46586_10082447
587 Ga0065704_10002024
588 Ga0065704_10020024
589 Ga0065712_10144027
590 Ga0065715_10093695
591 Ga0065715_10096584
592 Ga0065707_10004910
593 Ga0065707_10170678
594 Ga0070690_100015964
595 Ga0070690_100018781
596 Ga0070690_100162563
597 Ga0070670_100000088
598 Ga0070670_100002133
599 Ga0070670_100101088
600 Ga0070670_100251495
601 Ga0070670_100390168
602 Ga0070670_100432939
603 Ga0070670_100586188
604 Ga0070670_101025853
605 Ga0068869_100011215
606 Ga0068869_100672276
607 Ga0070666_10083818
608 Ga0070680_100174956
609 Ga0070680_100197540
610 Ga0070680_100309891
611 Ga0070680_100830649
612 Ga0070682_100000076
613 Ga0070682_100024522
614 Ga0070682_100129380
615 Ga0068868_100190534
616 Ga0068868_100769018
617 Ga0070660_100194905
618 Ga0070689_100011044
619 Ga0070689_100036058
620 Ga0070689_100172990
621 Ga0070689_100784895
622 Ga0070687_100016822
623 Ga0070687_100251808
624 Ga0070661_100120778
625 Ga0070661_100399070
626 Ga0070692_10015443
627 Ga0070692_10062640
628 Ga0070692_10129488
629 Ga0070669_100000653
630 Ga0070669_100694048
631 Ga0070669_100727478
632 Ga0070669_100840719
633 Ga0070675_100182319
634 Ga0070675_100313032
635 Ga0070675_100507706
636 Ga0070671_100375470
637 Ga0070674_100605952
638 Ga0070673_100560376
639 Ga0070688_100715146
640 Ga0070659_100021240
641 Ga0070667_101328399
642 Ga0070703_10004011
643 Ga0070703_10082335
644 Ga0070701_10066186
645 Ga0070705_100031453
646 Ga0070705_100486706
647 Ga0070705_100727880
648 Ga0070700_100000120
649 Ga0070700_100012086
650 Ga0070700_100058231
651 Ga0070694_100010143
652 Ga0070694_100014091
653 Ga0070694_100018959
654 Ga0070694_100129546
655 Ga0070694_100153467
656 Ga0070694_100309864
657 Ga0070694_100412065
658 Ga0070694_101008669
659 Ga0070708_100000269
660 Ga0070708_100163539
661 Ga0070708_100561435
662 Ga0070708_100953841
663 Ga0070662_100062884
664 Ga0070662_100281390
665 Ga0070681_10001081
666 Ga0070681_10023141
667 Ga0068867_100015751
668 Ga0068867_100753949
669 Ga0070706_100009844
670 Ga0070706_100092242
671 Ga0070706_100337135
672 Ga0070707_100029143
673 Ga0070707_100200920
674 Ga0070707_100240208
675 Ga0070707_100576107
676 Ga0070707_100622607
677 Ga0070698_100002172
678 Ga0070698_100003919
679 Ga0070698_100025413
680 Ga0070699_100007321
681 Ga0070699_100020745
682 Ga0070699_100029062
683 Ga0070699_100050484
684 Ga0070699_100397507
685 Ga0070699_100409167
686 Ga0070679_100026832
687 Ga0070697_100000477
688 Ga0070697_100000865
689 Ga0070697_100003047
690 Ga0070697_100063349
691 Ga0070697_100096320
692 Ga0068853_100026724
693 Ga0068853_100104609
694 Ga0070672_100332774
695 Ga0070686_100002652
696 Ga0070686_100006232
697 Ga0070686_100730356
698 Ga0070695_100092125
699 Ga0070695_100197870
700 Ga0070695_100463511
701 Ga0070696_100000807
702 Ga0070696_100055801
703 Ga0070696_100162571
704 Ga0070696_100434533
705 Ga0070696_100663728
706 Ga0070696_100705212
707 Ga0070693_100142673
708 Ga0070693_100198032
709 Ga0070693_100199923
710 Ga0070665_100460583
711 Ga0070665_100674091
712 Ga0070704_100077059
713 Ga0070704_100088732
714 Ga0070704_100134867
715 Ga0070704_100531181
716 Ga0070704_100558024
717 Ga0070704_100645018
718 Ga0068855_100376985
719 Ga0070664_100013034
720 Ga0070664_100747372
721 Ga0068857_100075447
722 Ga0068857_100287001
723 Ga0068857_100690879
724 Ga0068857_100850614
725 Ga0070702_100037906
726 Ga0070702_100132448
727 Ga0070702_100194408
728 Ga0070702_100674728
729 Ga0068852_100065249
730 Ga0068859_100009793
731 Ga0068859_100043654
732 Ga0068859_100135827
733 Ga0068859_100147609
734 Ga0068859_100170560
735 Ga0068859_100250767
736 Ga0068859_100448740
737 Ga0068859_100641952
738 Ga0068859_100828759
739 Ga0068859_100939065
740 Ga0068859_101087372
741 Ga0068859_101348005
742 Ga0068859_101405011
743 Ga0068859_101749092
744 Ga0068864_100020978
745 Ga0068864_100073774
746 Ga0068864_100098515
747 Ga0068864_100395665
748 Ga0068864_100527152
749 Ga0068864_100564493
750 Ga0068864_100877680
751 Ga0068861_100046275
752 Ga0068861_100065061
753 Ga0068851_10000582
754 Ga0068870_10074945
755 Ga0068870_10118522
756 Ga0068870_10164443
757 Ga0068870_10407825
758 Ga0068863_100057112
759 Ga0068863_100147563
760 Ga0068863_100288825
761 Ga0068863_100670106
762 Ga0068858_100054083
763 Ga0068858_100223501
764 Ga0068858_100224482
765 Ga0068858_100304258
766 Ga0068858_100485653
767 Ga0068860_100014175
768 Ga0068860_100107392
769 Ga0068860_100147630
770 Ga0068860_100223893
771 Ga0068860_100385188
772 Ga0068860_100906359
773 Ga0068860_100923893
774 Ga0068862_100196142
775 Ga0081539_10000408
776 Ga0081539_10000725
777 Ga0081539_10002782
778 Ga0081539_10004753
779 Ga0097621_100005680
780 Ga0097621_100175519
781 Ga0097621_100636333
782 Ga0068871_100005259
783 Ga0068871_100102557
784 Ga0068871_100378694
785 Ga0075428_100390387
786 Ga0075430_100028960
787 Ga0075430_100056687
788 Ga0075431_100250826
789 Ga0075431_100372229
790 Ga0075431_100601681
791 Ga0075433_10056161
792 Ga0075433_10056982
793 Ga0075433_10086456
794 Ga0075433_10099491
795 Ga0075433_10461765
796 Ga0075434_100041540
797 Ga0075434_100055282
798 Ga0075434_100361024
799 Ga0075434_100616397
800 Ga0075434_101024719
801 Ga0075429_100216637
802 Ga0068865_100117045
803 Ga0068865_100535394
804 Ga0097620_100009793
805 Ga0097620_100043656
806 Ga0097620_100061224
807 Ga0097620_100135833
808 Ga0097620_100147600
809 Ga0097620_100170561
810 Ga0097620_100250757
811 Ga0097620_100448720
812 Ga0097620_100641914
813 Ga0097620_100828700
814 Ga0097620_100939033
815 Ga0097620_101087520
816 Ga0097620_101347916
817 Ga0097620_101404975
818 Ga0097620_101749098
819 Ga0105251_10083054
820 Ga0105250_10249588
821 Ga0105240_10405927
822 Ga0105240_10758489
823 Ga0105240_10999270
824 Ga0111539_10005075
825 Ga0111539_10673222
826 Ga0105247_10007521
827 Ga0105247_10138127
828 Ga0105247_10532029
829 Ga0105247_10760244
830 Ga0114129_10126690
831 Ga0114129_10319070
832 Ga0114129_10443078
833 Ga0114129_10801444
834 Ga0114129_11050969
835 Ga0105243_10022028
836 Ga0105243_10081907
837 Ga0105243_10428102
838 Ga0105241_10111097
839 Ga0105241_10403335
840 Ga0105241_10444178
841 Ga0105241_10756268
842 Ga0105241_10784515
843 Ga0105242_10045054
844 Ga0105242_10137857
845 Ga0105242_10165267
846 Ga0105242_10809312
847 Ga0105248_10001941
848 Ga0105248_10023136
849 Ga0105248_10095139
850 Ga0105248_10115307
851 Ga0105248_10137662
852 Ga0105248_10234934
853 Ga0105248_10625515
854 Ga0105237_10002609
855 Ga0105237_10046618
856 Ga0105237_10918953
857 Ga0105238_10008842
858 Ga0105249_10004897
859 Ga0105249_10011545
860 Ga0105249_10038427
861 Ga0105249_10704586
862 Ga0105249_11736892
863 Ga0105239_10156373
864 Ga0105239_10363164
865 Ga0105239_10627564
866 Ga0105239_10909137
867 Ga0105239_11557051
868 Ga0105246_10163523
869 Ga0105246_10261113
870 Ga0105246_10280755
871 Ga0105246_10445813
872 Ga0105246_10921853
873 Ga0157373_10067675
874 Ga0157373_10097233
875 Ga0157373_10107791
876 Ga0157373_10310646
877 Ga0157374_10390716
878 Ga0157378_10001282
879 Ga0157378_10047838
880 Ga0157378_10113458
881 Ga0157378_10151655
882 Ga0157378_11004316
883 Ga0163162_10010804
884 Ga0163162_10011606
885 Ga0163162_10155323
886 Ga0163162_10338734
887 Ga0163162_10604757
888 Ga0163162_11943537
889 Ga0157372_10010912
890 Ga0157372_10861705
891 Ga0157372_10910458
892 Ga0157372_11431326
893 Ga0157375_10023552
894 Ga0157375_10212501
895 Ga0157375_10547155
896 Ga0157375_10910123
897 Ga0157375_11553500
898 Ga0157375_12028158
899 Ga0163163_10000590
900 Ga0163163_10001831
901 Ga0163163_10011046
902 Ga0163163_10052048
903 Ga0163163_10181738
904 Ga0163163_10192357
905 Ga0163163_10479281
906 Ga0163163_10618026
907 Ga0163163_10809672
908 Ga0163163_11586057
909 Ga0157380_10002027
910 Ga0157380_10100431
911 Ga0157377_10391349
912 Ga0157379_10343357
913 Ga0157376_10348510
914 Ga0157376_11024594
915 Ga0157376_11146291
916 Ga0182007_10024432
917 Ga0163161_10019128
918 Ga0163161_10401037
919 Ga0213876_10070164
920 Ga0207653_10001174
921 Ga0207653_10053686
922 Ga0207642_10187718
923 Ga0207710_10280319
924 Ga0207680_10493654
925 Ga0207647_10097582
926 Ga0207643_10027474
927 Ga0207643_10031093
928 Ga0207643_10107525
929 Ga0207643_10432640
930 Ga0207643_10452757
931 Ga0207684_10004928
932 Ga0207684_10068907
933 Ga0207654_10448093
934 Ga0207707_10045674
935 Ga0207707_10215548
936 Ga0207707_10266692
937 Ga0207695_10251651
938 Ga0207671_10001556
939 Ga0207671_10617654
940 Ga0207660_10148022
941 Ga0207660_10217446
942 Ga0207660_10738938
943 Ga0207662_10020084
944 Ga0207662_10424708
945 Ga0207657_10218200
946 Ga0207649_10119298
947 Ga0207646_10017182
948 Ga0207646_10439423
949 Ga0207681_10000828
950 Ga0207681_10565609
951 Ga0207681_10743794
952 Ga0207681_10899144
953 Ga0207694_10193800
954 Ga0207694_10213720
955 Ga0207650_10000001
956 Ga0207650_10002163
957 Ga0207650_10075088
958 Ga0207650_10173876
959 Ga0207650_10655784
960 Ga0207659_10336957
961 Ga0207687_10441516
962 Ga0207644_10053683
963 Ga0207644_10297319
964 Ga0207690_10038588
965 Ga0207690_10365895
966 Ga0207686_10091693
967 Ga0207709_10000921
968 Ga0207709_10089870
969 Ga0207709_10191414
970 Ga0207670_10000250
971 Ga0207670_10008901
972 Ga0207670_10695466
973 Ga0207669_10568413
974 Ga0207704_10664653
975 Ga0207691_10242854
976 Ga0207711_10006665
977 Ga0207711_10025712
978 Ga0207711_10074154
979 Ga0207711_10171018
980 Ga0207689_10033473
981 Ga0207689_10037070
982 Ga0207689_10038011
983 Ga0207689_10174434
984 Ga0207689_10273566
985 Ga0207679_10003584
986 Ga0207679_10067039
987 Ga0207667_10192799
988 Ga0207667_10524671
989 Ga0207651_10122773
990 Ga0207651_11073143
991 Ga0207712_10130801
992 Ga0207712_10173148
993 Ga0207677_10036141
994 Ga0207677_10213707
995 Ga0207703_10044491
996 Ga0207703_10048865
997 Ga0207703_10118684
998 Ga0207703_10206830
999 Ga0207703_10340943
1000 Ga0207703_10387251
1001 Ga0207703_10467672
1002 Ga0207639_10031372
1003 Ga0207708_10000196
1004 Ga0207708_10017117
1005 Ga0207708_10026675
1006 Ga0207708_10496879
1007 Ga0207641_10161721
1008 Ga0207641_10212255
1009 Ga0207641_10285906
1010 Ga0207641_10393753
1011 Ga0207641_10448441
1012 Ga0207641_10655653
1013 Ga0207676_10003808
1014 Ga0207676_10023095
1015 Ga0207676_10082090
1016 Ga0207676_10326944
1017 Ga0207676_10593347
1018 Ga0207676_10918658
1019 Ga0207674_10023367
1020 Ga0207674_10044107
1021 Ga0207674_10397766
1022 Ga0207674_10912626
1023 Ga0207674_11494029
1024 Ga0207675_100026320
1025 Ga0207675_100427092
1026 Ga0207675_100443904
1027 Ga0207675_100890839
1028 Ga0207675_101062867
1029 Ga0207698_10115082
1030 Ga0207428_10003589
1031 Ga0268265_10174436
1032 Ga0268265_10401499
1033 Ga0268264_10034831
1034 Ga0268264_10165345
1035 Ga0268264_10211529
1036 Ga0268264_10653212
1037 Ga0307408_100166790
1038 Ga0307408_100279011
1039 Ga0307408_100569282
1040 Ga0307405_10016765
1041 Ga0307405_10466233
1042 Ga0307405_10920295
1043 Ga0307413_10235322
1044 Ga0307410_10002023
1045 Ga0307410_10532488
1046 Ga0307410_10843411
1047 Ga0307406_10009008
1048 Ga0307406_10096046
1049 Ga0307407_10038002
1050 Ga0307407_10278998
1051 Ga0307412_10006046
1052 Ga0307412_10302740
1053 Ga0307412_11036143
1054 Ga0307409_100802542
1055 Ga0307409_100813035
1056 Ga0307409_100851786
1057 Ga0307416_100008158
1058 Ga0307416_100091493
1059 Ga0307414_10004981
1060 Ga0307414_10111575
1061 Ga0307414_10137285
1062 Ga0307414_10384623
1063 Ga0307411_10025260
1064 Ga0307411_10034092
1065 Ga0307411_10189267
1066 Ga0307411_10531268
1067 Ga0307415_100005908
1068 Ga0307415_100056649
1069 Ga0373940_0028690
1070 Ga0373951_0001417
1071 Ga0373952_0046334
1072 Ga0373941_0004953
1073 Ga0373961_0071659
1074 Ga0373937_0111494
1075 Ga0395899_0701440
1076 Ga0395900_0110160
1077 Ga0395900_0417052
1078 Ga0395905_0699103
1079 Ga0242420_003259
1080 Ga0436365_1168610
1081 Ga0439455_0102744
1082 Ga0439458_0056688
1083 Ga0453683_0022475
1084 Ga0451576_0225117
1085 Ga0451576_0734647
1086 Ga0451576_1196201
1087 Ga0495663_0000393
1088 Ga0495598_0000084
1089 Ga0495621_0000175
1090 Ga0495672_0015382
1091 Ga0496100_0240743
1092 Ga0496106_0309594
1093 Ga0496107_0092934
1094 Ga0496108_0057670
1095 Ga0496112_0221663
1096 Ga0496113_0487710
1097 Ga0496113_0612397
1098 Ga0501291_015080
1099 Ga0501292_104409
1100 Ga0501295_019714
1101 Ga0501298_000146
1102 Ga0501298_004317
1103 Ga0501303_004134
1104 Ga0501077_0193558
1105 Ga0501077_0509223
1106 Ga0501201_030284
1107 Ga0501206_024255
1108 Ga0501207_008265
1109 Ga0501208_048647
1110 Ga0501216_014110
1111 Ga0501216_111791
1112 Ga0501217_000882
1113 Ga0501217_065604
1114 Ga0501223_002684
1115 Ga0501224_000129
1116 Ga0501224_002783
1117 Ga0501227_001010
1118 Ga0501233_007331
1119 Ga0501233_015734
1120 Ga0501233_049880
1121 Ga0501235_001520
1122 Ga0501235_005769
1123 Ga0501235_020306
1124 Ga0501255_002581
1125 Ga0501256_007175
1126 Ga0501257_042787
1127 Ga0501257_128546
1128 Ga0501261_020309
1129 Ga0501225_0000145
1130 Ga0501225_0030880
1131 Ga0501225_0042544
1132 Ga0501225_0228636
1133 Ga0501234_000075
1134 Ga0501234_002094
1135 Ga0501245_007859
1136 Ga0501263_015678
1137 Ga0501283_003237
1138 Ga0501283_018382
1139 Ga0501283_020651
1140 Ga0501204_042774
1141 Ga0501212_000437
1142 nmdc:mga05p37_425135_c1
1143 nmdc:mga05p37_546945_c1
1144 nmdc:mga05p37_926222_c1
1145 nmdc:mga05p37_961742_c1
1146 nmdc:mga0qj67_174856_c1
1147 nmdc:mga06r32_269818_c1
1148 nmdc:mga06r32_683695_c1
1149 nmdc:mga08y16_3905_c1
1150 nmdc:mga08y16_70409_c1
1151 nmdc:mga0n895_129567_c1
1152 nmdc:mga0n895_520163_c1
1153 nmdc:mga0n895_559007_c1
1154 nmdc:mga0a205_175660_c1
1155 nmdc:mga0a205_360527_c1
1156 nmdc:mga0a205_363498_c1
1157 nmdc:mga0a205_43896_c1
1158 nmdc:mga0a205_56269_c1
1159 nmdc:mga0a205_67765_c1
1160 nmdc:mga0a205_69328_c1
1161 Ga0500568_0110198
1162 Ga0530510_0081276

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02632

BioY

BioY family

65

208

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dve-assembly1.cif.gz_A crystal structure at 2.1 a of the s-component for biotin from an ecf-type abc transporter 0.8738 21 184
4dve-assembly1.cif.gz_A crystal structure at 2.1 a of the s-component for biotin from an ecf-type abc transporter 0.761 21 184
4z7f-assembly2.cif.gz_D crystal structure of folt bound with folic acid 0.7162 19 185
5d0y-assembly2.cif.gz_B substrate bound s-component of folate ecf transporter 0.707 22 191
5d0y-assembly2.cif.gz_B substrate bound s-component of folate ecf transporter 0.6956 22 191
ID Description Score Start End Superfamily
af_Q54D94_113_302_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.9404 20 190 1.10.1760.20
af_Q2FVX1_1_181_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.9041 18 184 1.10.1760.20
af_Q54D94_113_302_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8445 20 190 1.10.1760.20
4dveA00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8342 21 184 1.10.1760.20
af_Q2FVX1_1_181_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8333 18 184 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A838RYP5-F1-model_v4 Biotin transporter BioY 0.9815 64 196 GO:0005886
GO:0015225
AF-E8U3Y4-F1-model_v4 Biotin transporter 0.9786 8 190 GO:0005886
GO:0015225
AF-A0A4Q4CJE2-F1-model_v4 Biotin transporter BioY 0.9768 20 155 GO:0005886
GO:0015225
AF-A0A521LQ98-F1-model_v4 Biotin transporter BioY 0.9765 21 147 GO:0005886
GO:0015225
AF-A0A2N9XM46-F1-model_v4 Biotin transporter 0.9746 25 192 GO:0005886
GO:0015225

Map