F466048

General Info

Members Datasets Scaffolds Average Seq Length
581 328 1162 137

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100052950|Ga0070713_1000529502
Length 164
Sequence MQRIAQAPRCIGGTSRRCVFNNITKEQAMKVNPYLMYDGNCEAAFKFYEKALGGKIEMMLTHEGAPESMPTPPEWKKKIMHARMSIDGEVIMASDAPPGHFHKPQGFSVSLQVQDPAEAERKFKALSEGGNVNMAFAKTFFSRGFGMCVDQFGIPWMVNSPLEG

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
80 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
151 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
175 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
178 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
183 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
198 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
203 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
204 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
205 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
206 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
207 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
208 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
235 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
250 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
253 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
254 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
255 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
261 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
262 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
265 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
289 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
290 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
291 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
292 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
296 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
299 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
300 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
303 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
304 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
305 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
306 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
307 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
308 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
309 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
310 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
311 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
312 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
313 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
314 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
315 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
316 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
317 2906610324
318 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
319 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
320 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
321 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
322 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
323 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
324 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
325 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
326 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
327 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
328 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.52
Metatranscriptomes 0.86
Isolates 3.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 3.1
Rhizoplane 7.92
Rhizosphere 82.62
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100052950 3300005436 Bacteria 3362
2 JGI24744J21845_10007506 3300002077 Bacteria 2253
3 JGI24742J22300_10017682 3300002244 Bacteria 1206
4 JGI25406J46586_10002622 3300003203 Bacteria 8481
5 JGI25404J52841_10006982 3300003659 Bacteria 2375
6 JGI25404J52841_10029384 3300003659 Bacteria 1179
7 JGI25404J52841_10051441 3300003659 Bacteria 866
8 JGI25405J52794_10077457 3300003911 Bacteria 730
9 Ga0058861_11722199 3300004800 Bacteria 637
10 Ga0058862_12517227 3300004803 Bacteria 639
11 Ga0070683_100103534 3300005329 Bacteria 2682
12 Ga0070680_100019162 3300005336 Bacteria 5420
13 Ga0070660_100019869 3300005339 Bacteria 4928
14 Ga0070660_100120229 3300005339 Bacteria 2096
15 Ga0070691_10569069 3300005341 Bacteria 665
16 Ga0070661_100178162 3300005344 Bacteria 1616
17 Ga0070669_100628721 3300005353 Bacteria 901
18 Ga0070671_100623479 3300005355 Bacteria 933
19 Ga0070674_100278454 3300005356 Bacteria 1325
20 Ga0070674_100765626 3300005356 Bacteria 831
21 Ga0070688_101109468 3300005365 Bacteria 633
22 Ga0070659_100109151 3300005366 Bacteria 2233
23 Ga0070709_10015776 3300005434 Bacteria 4302
24 Ga0070709_10222364 3300005434 Bacteria 1347
25 Ga0070714_100058797 3300005435 Bacteria 3295
26 Ga0070714_100092067 3300005435 Bacteria 2657
27 Ga0070713_100046315 3300005436 Bacteria 3568
28 Ga0070713_100265487 3300005436 Bacteria 1570
29 Ga0070713_101909062 3300005436 Unclassified 576
30 Ga0070711_100011149 3300005439 Bacteria 5575
31 Ga0070711_100902813 3300005439 Bacteria 754
32 Ga0070711_101732562 3300005439 Bacteria 548
33 Ga0070663_100306150 3300005455 Bacteria 1273
34 Ga0070678_100014685 3300005456 Bacteria 4951
35 Ga0070678_100102369 3300005456 Bacteria 2222
36 Ga0070678_100422338 3300005456 Bacteria 1162
37 Ga0070678_100626748 3300005456 Bacteria 962
38 Ga0070662_100474775 3300005457 Bacteria 1040
39 Ga0068867_101856726 3300005459 Bacteria 567
40 Ga0070706_101397555 3300005467 Bacteria 641
41 Ga0070698_100023974 3300005471 Bacteria 6371
42 Ga0070698_100670923 3300005471 Bacteria 978
43 Ga0070699_101134544 3300005518 Unclassified 717
44 Ga0070684_100504488 3300005535 Bacteria 1121
45 Ga0068853_100366829 3300005539 Bacteria 1343
46 Ga0068853_100520087 3300005539 Bacteria 1125
47 Ga0068853_100541604 3300005539 Bacteria 1102
48 Ga0068853_100751257 3300005539 Bacteria 932
49 Ga0070693_100080019 3300005547 Bacteria 1946
50 Ga0070693_100537246 3300005547 Bacteria 835
51 Ga0070693_100777681 3300005547 Bacteria 708
52 Ga0070665_100162979 3300005548 Bacteria 2232
53 Ga0070665_100445181 3300005548 Bacteria 1305
54 Ga0070665_100809933 3300005548 Bacteria 950
55 Ga0070665_101969033 3300005548 Bacteria 590
56 Ga0068855_100060900 3300005563 Bacteria 4411
57 Ga0068855_101091127 3300005563 Bacteria 835
58 Ga0070664_100062716 3300005564 Bacteria 3169
59 Ga0070664_100357866 3300005564 Bacteria 1329
60 Ga0068857_100625795 3300005577 Bacteria 1019
61 Ga0068854_100253759 3300005578 Bacteria 1406
62 Ga0068854_100267518 3300005578 Bacteria 1371
63 Ga0068854_100384354 3300005578 Bacteria 1157
64 Ga0068856_100120142 3300005614 Bacteria 2629
65 Ga0068856_100786952 3300005614 Bacteria 971
66 Ga0070702_100297636 3300005615 Bacteria 1115
67 Ga0070702_100645034 3300005615 Bacteria 800
68 Ga0068852_100067174 3300005616 Bacteria 3134
69 Ga0068852_100223430 3300005616 Bacteria 1792
70 Ga0068852_100442183 3300005616 Bacteria 1286
71 Ga0068859_100843125 3300005617 Bacteria 1003
72 Ga0068864_100250705 3300005618 Bacteria 1643
73 Ga0068866_10715262 3300005718 Bacteria 688
74 Ga0068861_102060925 3300005719 Bacteria 570
75 Ga0068851_10030046 3300005834 Bacteria 2693
76 Ga0068851_10238975 3300005834 Bacteria 1026
77 Ga0068863_101082328 3300005841 Bacteria 806
78 Ga0068858_101061564 3300005842 Bacteria 795
79 Ga0081455_10008831 3300005937 Bacteria 10428
80 Ga0081455_10047851 3300005937 Bacteria 3699
81 Ga0081455_10057252 3300005937 Bacteria 3304
82 Ga0081540_1010291 3300005983 Bacteria 6346
83 Ga0081540_1010662 3300005983 Bacteria 6200
84 Ga0081540_1036403 3300005983 Bacteria 2625
85 Ga0081540_1046569 3300005983 Bacteria 2188
86 Ga0081540_1048780 3300005983 Bacteria 2117
87 Ga0081540_1094229 3300005983 Bacteria 1309
88 Ga0081540_1289191 3300005983 Bacteria 564
89 Ga0081539_10000848 3300005985 Bacteria 58499
90 Ga0070717_10000460 3300006028 Bacteria 25862
91 Ga0075364_10210701 3300006051 Bacteria 1318
92 Ga0070715_10073801 3300006163 Bacteria 1531
93 Ga0070716_100095051 3300006173 Bacteria 1813
94 Ga0070716_101453399 3300006173 Bacteria 559
95 Ga0070712_100129756 3300006175 Bacteria 1909
96 Ga0070712_100173829 3300006175 Bacteria 1673
97 Ga0075369_10438305 3300006186 Bacteria 618
98 Ga0097621_100586194 3300006237 Bacteria 1018
99 Ga0097621_100625833 3300006237 Bacteria 986
100 Ga0097621_101612764 3300006237 Bacteria 617
101 Ga0068871_100060972 3300006358 Bacteria 3079
102 Ga0068871_100224504 3300006358 Bacteria 1629
103 Ga0075428_100432214 3300006844 Bacteria 1410
104 Ga0075428_102161487 3300006844 Bacteria 575
105 Ga0075434_100006248 3300006871 Bacteria 10910
106 Ga0068865_100042465 3300006881 Bacteria 3101
107 Ga0068865_100175842 3300006881 Bacteria 1645
108 Ga0075436_100971439 3300006914 Bacteria 637
109 Ga0075436_101467387 3300006914 Bacteria 518
110 Ga0097620_100842964 3300006931 Bacteria 1003
111 Ga0099794_10196547 3300007265 Bacteria 1032
112 Ga0099794_10201472 3300007265 Bacteria 1019
113 Ga0099795_10005225 3300007788 Bacteria 3432
114 Ga0099795_10023844 3300007788 Bacteria 2034
115 Ga0099795_10031743 3300007788 Bacteria 1821
116 Ga0099795_10038257 3300007788 Bacteria 1692
117 Ga0099795_10071522 3300007788 Bacteria 1310
118 Ga0099795_10107899 3300007788 Bacteria 1100
119 Ga0099795_10134707 3300007788 Bacteria 1000
120 Ga0105240_10143116 3300009093 Bacteria 2857
121 Ga0111539_10291752 3300009094 Bacteria 1898
122 Ga0105245_10010180 3300009098 Bacteria 8188
123 Ga0105245_10204644 3300009098 Bacteria 1897
124 Ga0105245_11329514 3300009098 Bacteria 768
125 Ga0105245_11810638 3300009098 Bacteria 663
126 Ga0105245_12376238 3300009098 Bacteria 584
127 Ga0105247_10290063 3300009101 Bacteria 1131
128 Ga0114129_11619885 3300009147 Bacteria 792
129 Ga0105243_10672831 3300009148 Bacteria 1006
130 Ga0105243_10800129 3300009148 Bacteria 929
131 Ga0105243_11076973 3300009148 Unclassified 811
132 Ga0105243_11181168 3300009148 Bacteria 777
133 Ga0105241_10134091 3300009174 Bacteria 2008
134 Ga0105242_10309316 3300009176 Bacteria 1445
135 Ga0105242_10615222 3300009176 Bacteria 1051
136 Ga0105242_12541687 3300009176 Bacteria 561
137 Ga0105248_10997784 3300009177 Bacteria 946
138 Ga0105237_10201450 3300009545 Bacteria 1991
139 Ga0105238_10481607 3300009551 Bacteria 1240
140 Ga0099796_10032553 3300010159 Bacteria 1709
141 Ga0099796_10054300 3300010159 Bacteria 1400
142 Ga0099796_10096381 3300010159 Bacteria 1107
143 Ga0099796_10226713 3300010159 Bacteria 768
144 Ga0099796_10278753 3300010159 Bacteria 702
145 Ga0105239_10049562 3300010375 Bacteria 4605
146 Ga0105239_10176034 3300010375 Bacteria 2393
147 Ga0105239_10203875 3300010375 Bacteria 2216
148 Ga0105239_10212845 3300010375 Bacteria 2167
149 Ga0105246_10039944 3300011119 Bacteria 3164
150 Ga0105246_10177357 3300011119 Bacteria 1637
151 Ga0105246_10588418 3300011119 Bacteria 960
152 Ga0105246_10793710 3300011119 Bacteria 839
153 Ga0105246_11718312 3300011119 Bacteria 597
154 Ga0105246_12085933 3300011119 Bacteria 549
155 Ga0157321_1008488 3300012487 Bacteria 746
156 Ga0157338_1055579 3300012515 Bacteria 580
157 Ga0157370_10872613 3300013104 Bacteria 817
158 Ga0157369_10016812 3300013105 Bacteria 8222
159 Ga0157374_10028177 3300013296 Bacteria 5072
160 Ga0157374_10411172 3300013296 Bacteria 1351
161 Ga0157374_11283128 3300013296 Bacteria 754
162 Ga0157378_10667062 3300013297 Bacteria 1057
163 Ga0157378_10946725 3300013297 Bacteria 894
164 Ga0157378_11211182 3300013297 Bacteria 795
165 Ga0163162_10111100 3300013306 Bacteria 2838
166 Ga0163162_10383983 3300013306 Bacteria 1538
167 Ga0163162_10611103 3300013306 Bacteria 1216
168 Ga0163162_11035467 3300013306 Bacteria 929
169 Ga0163162_11505088 3300013306 Bacteria 767
170 Ga0163162_12533770 3300013306 Bacteria 590
171 Ga0157372_10686695 3300013307 Bacteria 1192
172 Ga0157375_10037030 3300013308 Bacteria 4671
173 Ga0157375_10115292 3300013308 Bacteria 2790
174 Ga0163163_10253936 3300014325 Bacteria 1809
175 Ga0163163_10393405 3300014325 Bacteria 1444
176 Ga0163163_11395357 3300014325 Bacteria 762
177 Ga0157380_10040768 3300014326 Bacteria 3619
178 Ga0157380_10093880 3300014326 Bacteria 2482
179 Ga0182008_10478988 3300014497 Bacteria 681
180 Ga0157377_10413033 3300014745 Bacteria 922
181 Ga0157379_10226320 3300014968 Bacteria 1695
182 Ga0157379_10329562 3300014968 Bacteria 1395
183 Ga0157379_11089230 3300014968 Bacteria 765
184 Ga0157376_10023264 3300014969 Bacteria 4847
185 Ga0157376_10483307 3300014969 Bacteria 1214
186 Ga0163161_10118281 3300017792 Bacteria 1989
187 Ga0163161_10370125 3300017792 Bacteria 1143
188 Ga0206356_11766417 3300020070 Bacteria 996
189 Ga0207697_10047709 3300025315 Bacteria 1766
190 Ga0207656_10143118 3300025321 Bacteria 1128
191 Ga0207642_10020270 3300025899 Bacteria 2592
192 Ga0207710_10255860 3300025900 Bacteria 876
193 Ga0207688_10253279 3300025901 Bacteria 1067
194 Ga0207688_10885201 3300025901 Bacteria 565
195 Ga0207688_10983633 3300025901 Bacteria 533
196 Ga0207647_10241492 3300025904 Bacteria 1037
197 Ga0207647_10785556 3300025904 Bacteria 513
198 Ga0207685_10015214 3300025905 Bacteria 2432
199 Ga0207699_10019382 3300025906 Bacteria 3626
200 Ga0207699_10259776 3300025906 Bacteria 1200
201 Ga0207699_10666028 3300025906 Bacteria 761
202 Ga0207643_10531458 3300025908 Bacteria 754
203 Ga0207684_10205200 3300025910 Bacteria 1700
204 Ga0207684_11627019 3300025910 Bacteria 522
205 Ga0207707_10001016 3300025912 Bacteria 26912
206 Ga0207671_11162602 3300025914 Bacteria 605
207 Ga0207693_10009325 3300025915 Bacteria 8001
208 Ga0207693_10086472 3300025915 Bacteria 2456
209 Ga0207693_10898415 3300025915 Bacteria 680
210 Ga0207663_10082572 3300025916 Bacteria 2108
211 Ga0207663_10122838 3300025916 Bacteria 1781
212 Ga0207663_10187725 3300025916 Bacteria 1482
213 Ga0207660_10000924 3300025917 Bacteria 19378
214 Ga0207657_10001391 3300025919 Bacteria 25799
215 Ga0207657_10347365 3300025919 Bacteria 1170
216 Ga0207657_10383961 3300025919 Bacteria 1106
217 Ga0207649_10050880 3300025920 Bacteria 2564
218 Ga0207649_10073277 3300025920 Bacteria 2193
219 Ga0207652_10012249 3300025921 Bacteria 6928
220 Ga0207646_10714605 3300025922 Bacteria 895
221 Ga0207681_10191713 3300025923 Bacteria 1564
222 Ga0207694_11382098 3300025924 Bacteria 595
223 Ga0207659_10878735 3300025926 Bacteria 771
224 Ga0207687_10008945 3300025927 Bacteria 6546
225 Ga0207687_10301834 3300025927 Bacteria 1290
226 Ga0207687_10597043 3300025927 Bacteria 930
227 Ga0207687_11239288 3300025927 Bacteria 641
228 Ga0207700_10008658 3300025928 Bacteria 6318
229 Ga0207700_10103231 3300025928 Bacteria 2279
230 Ga0207664_10154737 3300025929 Bacteria 1951
231 Ga0207664_10855942 3300025929 Bacteria 817
232 Ga0207644_10913321 3300025931 Bacteria 736
233 Ga0207644_10928937 3300025931 Bacteria 729
234 Ga0207690_10273241 3300025932 Bacteria 1314
235 Ga0207690_10730507 3300025932 Bacteria 815
236 Ga0207690_11168167 3300025932 Bacteria 642
237 Ga0207706_10063996 3300025933 Bacteria 3238
238 Ga0207686_10566937 3300025934 Bacteria 890
239 Ga0207686_10889155 3300025934 Bacteria 718
240 Ga0207709_11206943 3300025935 Bacteria 623
241 Ga0207669_10137542 3300025937 Bacteria 1690
242 Ga0207669_10437821 3300025937 Bacteria 1033
243 Ga0207669_10907981 3300025937 Bacteria 736
244 Ga0207704_10165387 3300025938 Bacteria 1579
245 Ga0207704_11943320 3300025938 Bacteria 506
246 Ga0207665_10278431 3300025939 Bacteria 1244
247 Ga0207711_10422518 3300025941 Bacteria 1240
248 Ga0207661_10334631 3300025944 Bacteria 1363
249 Ga0207661_10877068 3300025944 Bacteria 826
250 Ga0207679_10093822 3300025945 Bacteria 2329
251 Ga0207679_10605630 3300025945 Bacteria 988
252 Ga0207667_10015694 3300025949 Bacteria 8591
253 Ga0207712_12039065 3300025961 Bacteria 513
254 Ga0207668_11611603 3300025972 Bacteria 586
255 Ga0207640_10232000 3300025981 Bacteria 1420
256 Ga0207640_10259883 3300025981 Bacteria 1352
257 Ga0207640_10273152 3300025981 Bacteria 1323
258 Ga0207677_11514083 3300026023 Bacteria 620
259 Ga0207639_10005788 3300026041 Bacteria 8369
260 Ga0207639_10557080 3300026041 Bacteria 1053
261 Ga0207639_10583797 3300026041 Bacteria 1029
262 Ga0207639_11588361 3300026041 Bacteria 614
263 Ga0207678_10004216 3300026067 Bacteria 12904
264 Ga0207678_10043984 3300026067 Bacteria 3865
265 Ga0207678_10361103 3300026067 Bacteria 1253
266 Ga0207702_10356717 3300026078 Bacteria 1400
267 Ga0207702_10430122 3300026078 Bacteria 1278
268 Ga0207648_10177498 3300026089 Bacteria 1884
269 Ga0207648_12003085 3300026089 Bacteria 540
270 Ga0207676_10063927 3300026095 Bacteria 2924
271 Ga0207674_10051452 3300026116 Bacteria 4203
272 Ga0207675_100016441 3300026118 Bacteria 6910
273 Ga0207675_102256917 3300026118 Bacteria 559
274 Ga0207683_10094349 3300026121 Bacteria 2667
275 Ga0207683_10147863 3300026121 Bacteria 2120
276 Ga0207683_10188223 3300026121 Bacteria 1873
277 Ga0207683_11534665 3300026121 Bacteria 615
278 Ga0207698_10084396 3300026142 Bacteria 2575
279 Ga0207698_10240475 3300026142 Bacteria 1650
280 Ga0207698_10556561 3300026142 Bacteria 1125
281 Ga0207698_10618801 3300026142 Bacteria 1069
282 Ga0207698_10772220 3300026142 Bacteria 961
283 Ga0209179_1015735 3300027512 Bacteria 1409
284 Ga0209179_1029728 3300027512 Bacteria 1114
285 Ga0209179_1031412 3300027512 Bacteria 1090
286 Ga0209179_1075543 3300027512 Bacteria 740
287 Ga0209588_1093934 3300027671 Bacteria 966
288 Ga0209588_1135750 3300027671 Bacteria 784
289 Ga0207428_10069869 3300027907 Bacteria 2761
290 Ga0268266_10306408 3300028379 Bacteria 1483
291 Ga0268266_10350006 3300028379 Bacteria 1388
292 Ga0268266_10609155 3300028379 Bacteria 1049
293 Ga0268266_10830493 3300028379 Bacteria 893
294 Ga0265319_1000770 3300028563 Bacteria 20820
295 Ga0265318_10000563 3300028577 Bacteria 26166
296 Ga0307517_10000098 3300028786 Bacteria 126044
297 Ga0307515_10227314 3300028794 Bacteria 1668
298 Ga0265338_10217687 3300028800 Unclassified 1429
299 Ga0265330_10013905 3300031235 Bacteria 3742
300 Ga0265330_10034391 3300031235 Bacteria 2264
301 Ga0265330_10058121 3300031235 Bacteria 1686
302 Ga0265330_10058315 3300031235 Bacteria 1683
303 Ga0265332_10029923 3300031238 Bacteria 2379
304 Ga0265332_10031826 3300031238 Bacteria 2300
305 Ga0265328_10081076 3300031239 Bacteria 1196
306 Ga0265320_10000328 3300031240 Bacteria 38910
307 Ga0265325_10010704 3300031241 Bacteria 5297
308 Ga0265325_10040048 3300031241 Bacteria 2463
309 Ga0265325_10163190 3300031241 Bacteria 1047
310 Ga0265329_10000518 3300031242 Bacteria 19897
311 Ga0265340_10011233 3300031247 Bacteria 4768
312 Ga0265340_10016525 3300031247 Bacteria 3820
313 Ga0265331_10000021 3300031250 Bacteria 242632
314 Ga0265316_10003604 3300031344 Bacteria 15612
315 Ga0265316_10008572 3300031344 Bacteria 9476
316 Ga0265316_10067409 3300031344 Bacteria 2768
317 Ga0265316_10214610 3300031344 Bacteria 1422
318 Ga0307513_10146024 3300031456 Bacteria 2283
319 Ga0307509_10601446 3300031507 Bacteria 772
320 Ga0265313_10000730 3300031595 Bacteria 33796
321 Ga0265313_10036233 3300031595 Bacteria 2478
322 Ga0307508_10014893 3300031616 Bacteria 7094
323 Ga0307508_10055386 3300031616 Bacteria 3513
324 Ga0307508_10347765 3300031616 Bacteria 1074
325 Ga0265314_10012056 3300031711 Bacteria 7086
326 Ga0265342_10000032 3300031712 Bacteria 150633
327 Ga0265342_10146208 3300031712 Bacteria 1316
328 Ga0265342_10275863 3300031712 Bacteria 891
329 Ga0265342_10478993 3300031712 Bacteria 636
330 Ga0307516_10222352 3300031730 Bacteria 1596
331 Ga0307405_10917333 3300031731 Bacteria 742
332 Ga0307412_10874101 3300031911 Bacteria 786
333 Ga0307510_10039876 3300033180 Bacteria 5165
334 Ga0315911_1000005 3300033442 Bacteria 426255
335 Ga0316215_1003072 3300033544 Bacteria 1584
336 Ga0373934_0320693 3300035086 Bacteria 643
337 Ga0373944_0065430 3300035089 Bacteria 1174
338 Ga0373944_0103644 3300035089 Bacteria 964
339 Ga0373944_0258764 3300035089 Bacteria 644
340 Ga0373951_0011361 3300035091 Bacteria 1999
341 Ga0373923_0023723 3300035111 Bacteria 2416
342 Ga0373923_0034589 3300035111 Bacteria 2052
343 Ga0373936_0076431 3300035113 Bacteria 1388
344 Ga0373941_0048436 3300035115 Bacteria 1342
345 Ga0373945_0053508 3300035116 Bacteria 1490
346 Ga0373945_0286433 3300035116 Bacteria 703
347 Ga0373953_0019537 3300035117 Bacteria 2522
348 Ga0373954_0001160 3300035118 Bacteria 10599
349 Ga0373956_0136461 3300035119 Bacteria 1150
350 Ga0373957_0001004 3300035120 Bacteria 7420
351 Ga0373943_0007942 3300035170 Bacteria 4763
352 Ga0373943_0029588 3300035170 Bacteria 2588
353 Ga0373946_0067032 3300035171 Bacteria 1540
354 Ga0373955_0056494 3300035172 Bacteria 2153
355 Ga0373955_0165436 3300035172 Bacteria 1307
356 Ga0373924_0044043 3300035410 Bacteria 1833
357 Ga0373924_0206306 3300035410 Bacteria 867
358 Ga0373931_0003428 3300035691 Bacteria 7118
359 Ga0373935_0000520 3300035692 Bacteria 20054
360 Ga0373935_0083123 3300035692 Bacteria 2084
361 Ga0373935_0276216 3300035692 Bacteria 1182
362 Ga0373927_0000046 3300035695 Bacteria 88401
363 Ga0373927_0019031 3300035695 Bacteria 4504
364 Ga0373927_0110676 3300035695 Bacteria 1789
365 Ga0373927_0140706 3300035695 Bacteria 1578
366 Ga0373933_0131768 3300035724 Bacteria 1572
367 Ga0373947_0001392 3300035725 Bacteria 14902
368 Ga0373947_0016227 3300035725 Bacteria 4280
369 Ga0373947_0160194 3300035725 Bacteria 1455
370 Ga0373947_0313970 3300035725 Bacteria 1047
371 Ga0373937_0015298 3300036401 Bacteria 6784
372 Ga0372808_014906 3300036459 Bacteria 1111
373 Ga0310109_032434 3300036534 Bacteria 690
374 Ga0373925_0003408 3300037068 Bacteria 12318
375 Ga0373925_0023664 3300037068 Bacteria 4482
376 Ga0373925_0517310 3300037068 Bacteria 980
377 Ga0395898_0133228 3300037466 Bacteria 2380
378 Ga0436361_0031455 3300039447 Bacteria 805
379 Ga0439465_0203907 3300041413 Bacteria 721
380 Ga0451789_0880387 3300041443 Bacteria 652
381 Ga0451793_0607721 3300041452 Bacteria 664
382 Ga0451837_1234563 3300041494 Bacteria 584
383 Ga0451839_0084335 3300041496 Bacteria 503
384 Ga0451847_0530427 3300041503 Bacteria 852
385 Ga0451855_1911224 3300041511 Bacteria 581
386 Ga0451853_0221928 3300041512 Bacteria 1652
387 Ga0466959_0011365 3300045049 Bacteria 6396
388 Ga0495592_0073270 3300046454 Bacteria 2490
389 Ga0495592_0159719 3300046454 Bacteria 1552
390 Ga0495603_0000051 3300046455 Bacteria 50402
391 Ga0495603_0307282 3300046455 Bacteria 911
392 Ga0495629_0000182 3300046459 Bacteria 56655
393 Ga0495629_0000750 3300046459 Bacteria 26239
394 Ga0495638_0203037 3300046460 Bacteria 1118
395 Ga0495641_0006785 3300046461 Bacteria 7338
396 Ga0495641_0116307 3300046461 Bacteria 1193
397 Ga0495651_0026747 3300046462 Bacteria 4492
398 Ga0495653_0064475 3300046463 Bacteria 2760
399 Ga0495653_0905940 3300046463 Bacteria 525
400 Ga0495580_0004021 3300046472 Bacteria 12411
401 Ga0495580_0560037 3300046472 Bacteria 758
402 Ga0495582_0000137 3300046473 Bacteria 39425
403 Ga0495639_0000047 3300046475 Bacteria 53940
404 Ga0495662_0001496 3300046476 Bacteria 11578
405 Ga0495664_0111795 3300046477 Bacteria 1649
406 Ga0495664_0156474 3300046477 Bacteria 1383
407 Ga0495584_0087004 3300046491 Bacteria 1575
408 Ga0495585_0309524 3300046492 Bacteria 775
409 Ga0495594_0001833 3300046499 Bacteria 11057
410 Ga0495594_0331276 3300046499 Bacteria 867
411 Ga0495594_0664219 3300046499 Bacteria 590
412 Ga0495608_0008203 3300046511 Bacteria 7333
413 Ga0495618_0174335 3300046514 Bacteria 1368
414 Ga0495618_0233565 3300046514 Bacteria 1157
415 Ga0495628_0102698 3300046516 Bacteria 2205
416 Ga0495628_0232458 3300046516 Bacteria 1382
417 Ga0495628_0311824 3300046516 Bacteria 1163
418 Ga0495630_0002625 3300046517 Bacteria 12446
419 Ga0495630_0363081 3300046517 Bacteria 1109
420 Ga0495666_0175911 3300046526 Bacteria 989
421 Ga0495666_0188351 3300046526 Bacteria 951
422 Ga0495652_0024273 3300046529 Bacteria 5368
423 Ga0495652_0079475 3300046529 Bacteria 2711
424 Ga0495652_0324318 3300046529 Bacteria 1111
425 Ga0495665_0001239 3300046531 Bacteria 13612
426 Ga0495665_0403721 3300046531 Bacteria 693
427 Ga0495640_0004375 3300046533 Bacteria 11274
428 Ga0495640_0026585 3300046533 Bacteria 4179
429 Ga0495587_0087341 3300046536 Bacteria 1804
430 Ga0495587_0470992 3300046536 Bacteria 695
431 Ga0495587_0569606 3300046536 Bacteria 624
432 Ga0495621_0400845 3300046539 Bacteria 582
433 Ga0495621_0454386 3300046539 Bacteria 549
434 Ga0495645_0065456 3300046543 Bacteria 2629
435 Ga0495622_0006199 3300046557 Bacteria 5554
436 Ga0495667_0035317 3300046559 Bacteria 3341
437 Ga0495667_0147947 3300046559 Bacteria 1512
438 Ga0495656_0042566 3300046615 Bacteria 1902
439 Ga0495668_0792619 3300046616 Bacteria 525
440 Ga0495634_0002221 3300046642 Bacteria 16276
441 Ga0495634_0146964 3300046642 Bacteria 1493
442 Ga0495625_0809773 3300046660 Bacteria 544
443 Ga0495635_0001455 3300046663 Bacteria 15846
444 Ga0495635_0002383 3300046663 Bacteria 12797
445 Ga0495659_0074696 3300046664 Bacteria 1276
446 Ga0495588_0099853 3300046674 Bacteria 1525
447 Ga0495588_0271220 3300046674 Bacteria 894
448 Ga0495657_0004131 3300046675 Bacteria 11623
449 Ga0495657_0397280 3300046675 Bacteria 812
450 Ga0495599_0136330 3300046678 Bacteria 1523
451 Ga0495599_0137392 3300046678 Bacteria 1517
452 Ga0495623_0156338 3300046679 Bacteria 1343
453 Ga0495623_0191104 3300046679 Bacteria 1183
454 Ga0495646_0073462 3300046680 Bacteria 2009
455 Ga0495646_0078070 3300046680 Bacteria 1936
456 Ga0495646_0110526 3300046680 Bacteria 1565
457 Ga0495647_0000577 3300046681 Bacteria 10837
458 Ga0495647_0019054 3300046681 Bacteria 2451
459 Ga0495647_0300730 3300046681 Bacteria 723
460 Ga0495658_0001786 3300046683 Bacteria 11096
461 Ga0495658_0819527 3300046683 Bacteria 596
462 Ga0495613_0007297 3300046689 Bacteria 8233
463 Ga0495613_0123620 3300046689 Bacteria 1857
464 Ga0495624_0000898 3300046690 Bacteria 23624
465 Ga0495670_0249015 3300046691 Bacteria 947
466 Ga0495589_0350747 3300046794 Bacteria 680
467 Ga0495600_0069131 3300046809 Bacteria 2308
468 Ga0495600_0100686 3300046809 Bacteria 1883
469 Ga0495581_0001056 3300047315 Bacteria 14926
470 Ga0495581_0539427 3300047315 Bacteria 677
471 Ga0495604_0013331 3300047317 Bacteria 6545
472 Ga0495674_0014874 3300047319 Bacteria 7279
473 Ga0495674_0018308 3300047319 Bacteria 6522
474 Ga0495674_1136950 3300047319 Bacteria 593
475 Ga0495672_0020527 3300047320 Bacteria 4326
476 Ga0495672_0107741 3300047320 Bacteria 1500
477 Ga0495676_0024153 3300047321 Bacteria 5266
478 Ga0495680_0029259 3300047322 Bacteria 4511
479 Ga0495680_0222116 3300047322 Bacteria 1348
480 Ga0495675_0036374 3300047444 Bacteria 3140
481 Ga0495685_071543 3300047447 Bacteria 1161
482 Ga0495673_0022493 3300047469 Bacteria 3088
483 Ga0495684_0000643 3300047471 Bacteria 28074
484 Ga0495684_0031079 3300047471 Bacteria 4099
485 Ga0495686_0047245 3300047472 Bacteria 2719
486 Ga0495593_0006202 3300047673 Bacteria 7030
487 Ga0495593_0038227 3300047673 Bacteria 2592
488 Ga0495602_0125851 3300048088 Bacteria 2053
489 Ga0495614_0001926 3300048089 Bacteria 9106
490 Ga0496100_0124404 3300048903 Bacteria 1808
491 Ga0496100_1368696 3300048903 Bacteria 559
492 Ga0496100_1430705 3300048903 Bacteria 546
493 Ga0496101_0007768 3300048904 Bacteria 6971
494 Ga0496101_0051293 3300048904 Bacteria 2972
495 Ga0496101_0133783 3300048904 Bacteria 1885
496 Ga0496101_0367812 3300048904 Bacteria 1131
497 Ga0496101_1289915 3300048904 Bacteria 571
498 Ga0496102_0079685 3300048905 Bacteria 3016
499 Ga0496102_0453172 3300048905 Bacteria 1203
500 Ga0496102_1452064 3300048905 Bacteria 605
501 Ga0496103_0061585 3300048906 Bacteria 2334
502 Ga0496104_0043739 3300048907 Bacteria 4206
503 Ga0496104_0467626 3300048907 Bacteria 1172
504 Ga0496105_0093395 3300048908 Bacteria 2484
505 Ga0496105_0408029 3300048908 Bacteria 1077
506 Ga0496106_0045268 3300048909 Bacteria 3305
507 Ga0496106_0124473 3300048909 Bacteria 2018
508 Ga0496106_0198068 3300048909 Bacteria 1598
509 Ga0496106_0239930 3300048909 Bacteria 1448
510 Ga0496106_1299473 3300048909 Bacteria 565
511 Ga0496107_0006973 3300048910 Bacteria 7786
512 Ga0496107_0017889 3300048910 Bacteria 4989
513 Ga0496107_0225014 3300048910 Bacteria 1396
514 Ga0496107_0587394 3300048910 Bacteria 824
515 Ga0496108_0041142 3300048911 Bacteria 3856
516 Ga0496108_0263902 3300048911 Bacteria 1499
517 Ga0496109_0048409 3300048912 Bacteria 3868
518 Ga0496109_0077635 3300048912 Bacteria 3056
519 Ga0496110_0009862 3300048913 Bacteria 7741
520 Ga0496111_0026720 3300048914 Bacteria 4077
521 Ga0496112_0012229 3300048915 Bacteria 7879
522 Ga0496113_0073832 3300048916 Bacteria 2599
523 Ga0496113_0172826 3300048916 Bacteria 1711
524 Ga0496114_0050080 3300048917 Bacteria 3476
525 Ga0496114_0073639 3300048917 Bacteria 2875
526 Ga0496114_0090980 3300048917 Bacteria 2591
527 Ga0496114_0178022 3300048917 Bacteria 1856
528 Ga0496115_0025021 3300048918 Bacteria 4644
529 Ga0496115_0151883 3300048918 Bacteria 1913
530 Ga0496115_0179751 3300048918 Bacteria 1749
531 Ga0496115_0236750 3300048918 Bacteria 1505
532 Ga0496115_1043089 3300048918 Bacteria 623
533 Ga0496121_0000265 3300048924 Bacteria 109251
534 Ga0496121_0181752 3300048924 Bacteria 1517
535 Ga0496121_0504879 3300048924 Bacteria 767
536 Ga0496121_0575222 3300048924 Bacteria 700
537 Ga0496126_0222934 3300048929 Bacteria 1583
538 Ga0495682_0070331 3300049460 Bacteria 1260
539 nmdc:mga03683_209134_c1 3300050489 Bacteria 897
540 nmdc:mga00v17_79537_c1 3300050491 Bacteria 2044
541 nmdc:mga0yw44_568318_c1 3300050492 Bacteria 770
542 nmdc:mga0n895_19893_c1 3300050512 Bacteria 6250
543 nmdc:mga0rr50_975278_c1 3300050513 Bacteria 722
544 nmdc:mga0a205_561168_c1 3300050515 Bacteria 996
545 nmdc:mga0sz30_327466_c1 3300050516 Bacteria 684
546 Ga0495601_0216989 3300053077 Bacteria 1249
547 Ga0495601_0335990 3300053077 Bacteria 983
548 Ga0495612_0247597 3300053078 Bacteria 792
549 Ga0495612_0345265 3300053078 Bacteria 672
550 Ga0495655_0073168 3300053083 Bacteria 963
551 Ga0495655_0108585 3300053083 Bacteria 831
552 Ga0495595_0032987 3300053084 Bacteria 2334
553 Ga0495619_0000633 3300053085 Bacteria 23194
554 Ga0495619_0259532 3300053085 Bacteria 1204
555 Ga0500556_0076313 3300053104 Bacteria 1260
556 Ga0500595_029237 3300053119 Bacteria 1871
557 Ga0500568_0026049 3300053139 Bacteria 2458
558 Ga0500637_0423317 3300053178 Bacteria 684
559 Ga0500576_190310 3300053725 Bacteria 712
560 2513655361 2513237096 Bacteria 8722461
561 2513863607 2513237137 Bacteria 9558895
562 2513916561 2513237145 Bacteria 8979722
563 2517889850 2517572143 Bacteria 9484767
564 2671121129 2667528175 Bacteria 7532676
565 2793073425 2791355197 Bacteria 8420563
566 2874606021 2874604998 Bacteria 7834745
567 2885379004 2885374607 Bacteria 8927485
568 2903748987 2903748898 Bacteria 9972761
569 2904692711 2904690495 Bacteria 9412302
570 2906612416
571 2906636764 2906635258 Bacteria 8601019
572 2906663459 2906660503 Bacteria 8595048
573 2908745685 2908739725 Bacteria 8628932
574 2908757649 2908756301 Bacteria 8864324
575 2935633038 2935630451 Bacteria 8169952
576 2941509660 2941507105 Bacteria 8166816
577 2941517489 2941515067 Bacteria 8166720
578 2941526558 2941523033 Bacteria 8169134
579 3005476061 3005474847 Bacteria 9259049
580 8006971094 8006964411 Bacteria 8966052
581 8056675367 8056673599 Bacteria 7871253
582 Ga0070713_100052950
583 JGI24744J21845_10007506
584 JGI24742J22300_10017682
585 JGI25406J46586_10002622
586 JGI25404J52841_10006982
587 JGI25404J52841_10029384
588 JGI25404J52841_10051441
589 JGI25405J52794_10077457
590 Ga0058861_11722199
591 Ga0058862_12517227
592 Ga0070683_100103534
593 Ga0070680_100019162
594 Ga0070660_100019869
595 Ga0070660_100120229
596 Ga0070691_10569069
597 Ga0070661_100178162
598 Ga0070669_100628721
599 Ga0070671_100623479
600 Ga0070674_100278454
601 Ga0070674_100765626
602 Ga0070688_101109468
603 Ga0070659_100109151
604 Ga0070709_10015776
605 Ga0070709_10222364
606 Ga0070714_100058797
607 Ga0070714_100092067
608 Ga0070713_100046315
609 Ga0070713_100265487
610 Ga0070713_101909062
611 Ga0070711_100011149
612 Ga0070711_100902813
613 Ga0070711_101732562
614 Ga0070663_100306150
615 Ga0070678_100014685
616 Ga0070678_100102369
617 Ga0070678_100422338
618 Ga0070678_100626748
619 Ga0070662_100474775
620 Ga0068867_101856726
621 Ga0070706_101397555
622 Ga0070698_100023974
623 Ga0070698_100670923
624 Ga0070699_101134544
625 Ga0070684_100504488
626 Ga0068853_100366829
627 Ga0068853_100520087
628 Ga0068853_100541604
629 Ga0068853_100751257
630 Ga0070693_100080019
631 Ga0070693_100537246
632 Ga0070693_100777681
633 Ga0070665_100162979
634 Ga0070665_100445181
635 Ga0070665_100809933
636 Ga0070665_101969033
637 Ga0068855_100060900
638 Ga0068855_101091127
639 Ga0070664_100062716
640 Ga0070664_100357866
641 Ga0068857_100625795
642 Ga0068854_100253759
643 Ga0068854_100267518
644 Ga0068854_100384354
645 Ga0068856_100120142
646 Ga0068856_100786952
647 Ga0070702_100297636
648 Ga0070702_100645034
649 Ga0068852_100067174
650 Ga0068852_100223430
651 Ga0068852_100442183
652 Ga0068859_100843125
653 Ga0068864_100250705
654 Ga0068866_10715262
655 Ga0068861_102060925
656 Ga0068851_10030046
657 Ga0068851_10238975
658 Ga0068863_101082328
659 Ga0068858_101061564
660 Ga0081455_10008831
661 Ga0081455_10047851
662 Ga0081455_10057252
663 Ga0081540_1010291
664 Ga0081540_1010662
665 Ga0081540_1036403
666 Ga0081540_1046569
667 Ga0081540_1048780
668 Ga0081540_1094229
669 Ga0081540_1289191
670 Ga0081539_10000848
671 Ga0070717_10000460
672 Ga0075364_10210701
673 Ga0070715_10073801
674 Ga0070716_100095051
675 Ga0070716_101453399
676 Ga0070712_100129756
677 Ga0070712_100173829
678 Ga0075369_10438305
679 Ga0097621_100586194
680 Ga0097621_100625833
681 Ga0097621_101612764
682 Ga0068871_100060972
683 Ga0068871_100224504
684 Ga0075428_100432214
685 Ga0075428_102161487
686 Ga0075434_100006248
687 Ga0068865_100042465
688 Ga0068865_100175842
689 Ga0075436_100971439
690 Ga0075436_101467387
691 Ga0097620_100842964
692 Ga0099794_10196547
693 Ga0099794_10201472
694 Ga0099795_10005225
695 Ga0099795_10023844
696 Ga0099795_10031743
697 Ga0099795_10038257
698 Ga0099795_10071522
699 Ga0099795_10107899
700 Ga0099795_10134707
701 Ga0105240_10143116
702 Ga0111539_10291752
703 Ga0105245_10010180
704 Ga0105245_10204644
705 Ga0105245_11329514
706 Ga0105245_11810638
707 Ga0105245_12376238
708 Ga0105247_10290063
709 Ga0114129_11619885
710 Ga0105243_10672831
711 Ga0105243_10800129
712 Ga0105243_11076973
713 Ga0105243_11181168
714 Ga0105241_10134091
715 Ga0105242_10309316
716 Ga0105242_10615222
717 Ga0105242_12541687
718 Ga0105248_10997784
719 Ga0105237_10201450
720 Ga0105238_10481607
721 Ga0099796_10032553
722 Ga0099796_10054300
723 Ga0099796_10096381
724 Ga0099796_10226713
725 Ga0099796_10278753
726 Ga0105239_10049562
727 Ga0105239_10176034
728 Ga0105239_10203875
729 Ga0105239_10212845
730 Ga0105246_10039944
731 Ga0105246_10177357
732 Ga0105246_10588418
733 Ga0105246_10793710
734 Ga0105246_11718312
735 Ga0105246_12085933
736 Ga0157321_1008488
737 Ga0157338_1055579
738 Ga0157370_10872613
739 Ga0157369_10016812
740 Ga0157374_10028177
741 Ga0157374_10411172
742 Ga0157374_11283128
743 Ga0157378_10667062
744 Ga0157378_10946725
745 Ga0157378_11211182
746 Ga0163162_10111100
747 Ga0163162_10383983
748 Ga0163162_10611103
749 Ga0163162_11035467
750 Ga0163162_11505088
751 Ga0163162_12533770
752 Ga0157372_10686695
753 Ga0157375_10037030
754 Ga0157375_10115292
755 Ga0163163_10253936
756 Ga0163163_10393405
757 Ga0163163_11395357
758 Ga0157380_10040768
759 Ga0157380_10093880
760 Ga0182008_10478988
761 Ga0157377_10413033
762 Ga0157379_10226320
763 Ga0157379_10329562
764 Ga0157379_11089230
765 Ga0157376_10023264
766 Ga0157376_10483307
767 Ga0163161_10118281
768 Ga0163161_10370125
769 Ga0206356_11766417
770 Ga0207697_10047709
771 Ga0207656_10143118
772 Ga0207642_10020270
773 Ga0207710_10255860
774 Ga0207688_10253279
775 Ga0207688_10885201
776 Ga0207688_10983633
777 Ga0207647_10241492
778 Ga0207647_10785556
779 Ga0207685_10015214
780 Ga0207699_10019382
781 Ga0207699_10259776
782 Ga0207699_10666028
783 Ga0207643_10531458
784 Ga0207684_10205200
785 Ga0207684_11627019
786 Ga0207707_10001016
787 Ga0207671_11162602
788 Ga0207693_10009325
789 Ga0207693_10086472
790 Ga0207693_10898415
791 Ga0207663_10082572
792 Ga0207663_10122838
793 Ga0207663_10187725
794 Ga0207660_10000924
795 Ga0207657_10001391
796 Ga0207657_10347365
797 Ga0207657_10383961
798 Ga0207649_10050880
799 Ga0207649_10073277
800 Ga0207652_10012249
801 Ga0207646_10714605
802 Ga0207681_10191713
803 Ga0207694_11382098
804 Ga0207659_10878735
805 Ga0207687_10008945
806 Ga0207687_10301834
807 Ga0207687_10597043
808 Ga0207687_11239288
809 Ga0207700_10008658
810 Ga0207700_10103231
811 Ga0207664_10154737
812 Ga0207664_10855942
813 Ga0207644_10913321
814 Ga0207644_10928937
815 Ga0207690_10273241
816 Ga0207690_10730507
817 Ga0207690_11168167
818 Ga0207706_10063996
819 Ga0207686_10566937
820 Ga0207686_10889155
821 Ga0207709_11206943
822 Ga0207669_10137542
823 Ga0207669_10437821
824 Ga0207669_10907981
825 Ga0207704_10165387
826 Ga0207704_11943320
827 Ga0207665_10278431
828 Ga0207711_10422518
829 Ga0207661_10334631
830 Ga0207661_10877068
831 Ga0207679_10093822
832 Ga0207679_10605630
833 Ga0207667_10015694
834 Ga0207712_12039065
835 Ga0207668_11611603
836 Ga0207640_10232000
837 Ga0207640_10259883
838 Ga0207640_10273152
839 Ga0207677_11514083
840 Ga0207639_10005788
841 Ga0207639_10557080
842 Ga0207639_10583797
843 Ga0207639_11588361
844 Ga0207678_10004216
845 Ga0207678_10043984
846 Ga0207678_10361103
847 Ga0207702_10356717
848 Ga0207702_10430122
849 Ga0207648_10177498
850 Ga0207648_12003085
851 Ga0207676_10063927
852 Ga0207674_10051452
853 Ga0207675_100016441
854 Ga0207675_102256917
855 Ga0207683_10094349
856 Ga0207683_10147863
857 Ga0207683_10188223
858 Ga0207683_11534665
859 Ga0207698_10084396
860 Ga0207698_10240475
861 Ga0207698_10556561
862 Ga0207698_10618801
863 Ga0207698_10772220
864 Ga0209179_1015735
865 Ga0209179_1029728
866 Ga0209179_1031412
867 Ga0209179_1075543
868 Ga0209588_1093934
869 Ga0209588_1135750
870 Ga0207428_10069869
871 Ga0268266_10306408
872 Ga0268266_10350006
873 Ga0268266_10609155
874 Ga0268266_10830493
875 Ga0265319_1000770
876 Ga0265318_10000563
877 Ga0307517_10000098
878 Ga0307515_10227314
879 Ga0265338_10217687
880 Ga0265330_10013905
881 Ga0265330_10034391
882 Ga0265330_10058121
883 Ga0265330_10058315
884 Ga0265332_10029923
885 Ga0265332_10031826
886 Ga0265328_10081076
887 Ga0265320_10000328
888 Ga0265325_10010704
889 Ga0265325_10040048
890 Ga0265325_10163190
891 Ga0265329_10000518
892 Ga0265340_10011233
893 Ga0265340_10016525
894 Ga0265331_10000021
895 Ga0265316_10003604
896 Ga0265316_10008572
897 Ga0265316_10067409
898 Ga0265316_10214610
899 Ga0307513_10146024
900 Ga0307509_10601446
901 Ga0265313_10000730
902 Ga0265313_10036233
903 Ga0307508_10014893
904 Ga0307508_10055386
905 Ga0307508_10347765
906 Ga0265314_10012056
907 Ga0265342_10000032
908 Ga0265342_10146208
909 Ga0265342_10275863
910 Ga0265342_10478993
911 Ga0307516_10222352
912 Ga0307405_10917333
913 Ga0307412_10874101
914 Ga0307510_10039876
915 Ga0315911_1000005
916 Ga0316215_1003072
917 Ga0373934_0320693
918 Ga0373944_0065430
919 Ga0373944_0103644
920 Ga0373944_0258764
921 Ga0373951_0011361
922 Ga0373923_0023723
923 Ga0373923_0034589
924 Ga0373936_0076431
925 Ga0373941_0048436
926 Ga0373945_0053508
927 Ga0373945_0286433
928 Ga0373953_0019537
929 Ga0373954_0001160
930 Ga0373956_0136461
931 Ga0373957_0001004
932 Ga0373943_0007942
933 Ga0373943_0029588
934 Ga0373946_0067032
935 Ga0373955_0056494
936 Ga0373955_0165436
937 Ga0373924_0044043
938 Ga0373924_0206306
939 Ga0373931_0003428
940 Ga0373935_0000520
941 Ga0373935_0083123
942 Ga0373935_0276216
943 Ga0373927_0000046
944 Ga0373927_0019031
945 Ga0373927_0110676
946 Ga0373927_0140706
947 Ga0373933_0131768
948 Ga0373947_0001392
949 Ga0373947_0016227
950 Ga0373947_0160194
951 Ga0373947_0313970
952 Ga0373937_0015298
953 Ga0372808_014906
954 Ga0310109_032434
955 Ga0373925_0003408
956 Ga0373925_0023664
957 Ga0373925_0517310
958 Ga0395898_0133228
959 Ga0436361_0031455
960 Ga0439465_0203907
961 Ga0451789_0880387
962 Ga0451793_0607721
963 Ga0451837_1234563
964 Ga0451839_0084335
965 Ga0451847_0530427
966 Ga0451855_1911224
967 Ga0451853_0221928
968 Ga0466959_0011365
969 Ga0495592_0073270
970 Ga0495592_0159719
971 Ga0495603_0000051
972 Ga0495603_0307282
973 Ga0495629_0000182
974 Ga0495629_0000750
975 Ga0495638_0203037
976 Ga0495641_0006785
977 Ga0495641_0116307
978 Ga0495651_0026747
979 Ga0495653_0064475
980 Ga0495653_0905940
981 Ga0495580_0004021
982 Ga0495580_0560037
983 Ga0495582_0000137
984 Ga0495639_0000047
985 Ga0495662_0001496
986 Ga0495664_0111795
987 Ga0495664_0156474
988 Ga0495584_0087004
989 Ga0495585_0309524
990 Ga0495594_0001833
991 Ga0495594_0331276
992 Ga0495594_0664219
993 Ga0495608_0008203
994 Ga0495618_0174335
995 Ga0495618_0233565
996 Ga0495628_0102698
997 Ga0495628_0232458
998 Ga0495628_0311824
999 Ga0495630_0002625
1000 Ga0495630_0363081
1001 Ga0495666_0175911
1002 Ga0495666_0188351
1003 Ga0495652_0024273
1004 Ga0495652_0079475
1005 Ga0495652_0324318
1006 Ga0495665_0001239
1007 Ga0495665_0403721
1008 Ga0495640_0004375
1009 Ga0495640_0026585
1010 Ga0495587_0087341
1011 Ga0495587_0470992
1012 Ga0495587_0569606
1013 Ga0495621_0400845
1014 Ga0495621_0454386
1015 Ga0495645_0065456
1016 Ga0495622_0006199
1017 Ga0495667_0035317
1018 Ga0495667_0147947
1019 Ga0495656_0042566
1020 Ga0495668_0792619
1021 Ga0495634_0002221
1022 Ga0495634_0146964
1023 Ga0495625_0809773
1024 Ga0495635_0001455
1025 Ga0495635_0002383
1026 Ga0495659_0074696
1027 Ga0495588_0099853
1028 Ga0495588_0271220
1029 Ga0495657_0004131
1030 Ga0495657_0397280
1031 Ga0495599_0136330
1032 Ga0495599_0137392
1033 Ga0495623_0156338
1034 Ga0495623_0191104
1035 Ga0495646_0073462
1036 Ga0495646_0078070
1037 Ga0495646_0110526
1038 Ga0495647_0000577
1039 Ga0495647_0019054
1040 Ga0495647_0300730
1041 Ga0495658_0001786
1042 Ga0495658_0819527
1043 Ga0495613_0007297
1044 Ga0495613_0123620
1045 Ga0495624_0000898
1046 Ga0495670_0249015
1047 Ga0495589_0350747
1048 Ga0495600_0069131
1049 Ga0495600_0100686
1050 Ga0495581_0001056
1051 Ga0495581_0539427
1052 Ga0495604_0013331
1053 Ga0495674_0014874
1054 Ga0495674_0018308
1055 Ga0495674_1136950
1056 Ga0495672_0020527
1057 Ga0495672_0107741
1058 Ga0495676_0024153
1059 Ga0495680_0029259
1060 Ga0495680_0222116
1061 Ga0495675_0036374
1062 Ga0495685_071543
1063 Ga0495673_0022493
1064 Ga0495684_0000643
1065 Ga0495684_0031079
1066 Ga0495686_0047245
1067 Ga0495593_0006202
1068 Ga0495593_0038227
1069 Ga0495602_0125851
1070 Ga0495614_0001926
1071 Ga0496100_0124404
1072 Ga0496100_1368696
1073 Ga0496100_1430705
1074 Ga0496101_0007768
1075 Ga0496101_0051293
1076 Ga0496101_0133783
1077 Ga0496101_0367812
1078 Ga0496101_1289915
1079 Ga0496102_0079685
1080 Ga0496102_0453172
1081 Ga0496102_1452064
1082 Ga0496103_0061585
1083 Ga0496104_0043739
1084 Ga0496104_0467626
1085 Ga0496105_0093395
1086 Ga0496105_0408029
1087 Ga0496106_0045268
1088 Ga0496106_0124473
1089 Ga0496106_0198068
1090 Ga0496106_0239930
1091 Ga0496106_1299473
1092 Ga0496107_0006973
1093 Ga0496107_0017889
1094 Ga0496107_0225014
1095 Ga0496107_0587394
1096 Ga0496108_0041142
1097 Ga0496108_0263902
1098 Ga0496109_0048409
1099 Ga0496109_0077635
1100 Ga0496110_0009862
1101 Ga0496111_0026720
1102 Ga0496112_0012229
1103 Ga0496113_0073832
1104 Ga0496113_0172826
1105 Ga0496114_0050080
1106 Ga0496114_0073639
1107 Ga0496114_0090980
1108 Ga0496114_0178022
1109 Ga0496115_0025021
1110 Ga0496115_0151883
1111 Ga0496115_0179751
1112 Ga0496115_0236750
1113 Ga0496115_1043089
1114 Ga0496121_0000265
1115 Ga0496121_0181752
1116 Ga0496121_0504879
1117 Ga0496121_0575222
1118 Ga0496126_0222934
1119 Ga0495682_0070331
1120 nmdc:mga03683_209134_c1
1121 nmdc:mga00v17_79537_c1
1122 nmdc:mga0yw44_568318_c1
1123 nmdc:mga0n895_19893_c1
1124 nmdc:mga0rr50_975278_c1
1125 nmdc:mga0a205_561168_c1
1126 nmdc:mga0sz30_327466_c1
1127 Ga0495601_0216989
1128 Ga0495601_0335990
1129 Ga0495612_0247597
1130 Ga0495612_0345265
1131 Ga0495655_0073168
1132 Ga0495655_0108585
1133 Ga0495595_0032987
1134 Ga0495619_0000633
1135 Ga0495619_0259532
1136 Ga0500556_0076313
1137 Ga0500595_029237
1138 Ga0500568_0026049
1139 Ga0500637_0423317
1140 Ga0500576_190310
1141 2513655361
1142 2513863607
1143 2513916561
1144 2517889850
1145 2671121129
1146 2793073425
1147 2874606021
1148 2885379004
1149 2903748987
1150 2904692711
1151 2906612416
1152 2906636764
1153 2906663459
1154 2908745685
1155 2908757649
1156 2935633038
1157 2941509660
1158 2941517489
1159 2941526558
1160 3005476061
1161 8006971094
1162 8056675367

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

30

158

0.94

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

29

159

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8938 1 135
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8811 1 135
1u7i-assembly1.cif.gz_B crystal structure of protein of unknown function pa1358 from pseudomonas aeruginosa 0.8324 1 134
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8197 1 132
1u7i-assembly1.cif.gz_B crystal structure of protein of unknown function pa1358 from pseudomonas aeruginosa 0.8156 1 134
ID Description Score Start End Superfamily
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9046 81 133 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8808 8 135 3.10.180.10
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8794 9 137 3.10.180.10
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.867 8 135 3.10.180.10
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8383 73 132 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A5A7W8G8-F1-model_v4 VOC family protein 0.9521 1 135
AF-A0A7V8NR92-F1-model_v4 VOC family protein 0.952 1 134
AF-A0A849VMP3-F1-model_v4 VOC family protein 0.9519 1 134
AF-A0A846MWN9-F1-model_v4 PhnB protein 0.9516 1 135
AF-Q2SAS0-F1-model_v4 Uncharacterized protein conserved in bacteria 0.9515 1 135

Map