F466047

General Info

Members Datasets Scaffolds Average Seq Length
581 189 1162 283

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100282498|Ga0070714_1002824981
Length 303
Sequence MASEPSTAGPPPTDSTSHGLRVVVAWLVVSAIATPLVAIYVGPLIPPGNASVEGQGQVFDNQVMTAFVTPILVLLAIFFAYGLIQFRARRNEAVLDGPPLRNDGRIQLLWIVITTTMVLFLAGFGTYELLKDGAGGGQGPNPIALPAHHQDAYQVQVIAQQWQFTYRYPSLGGVESNQLVLPADTDVELHVTSLDVVHGFWAVELGVKADANPGVDNVAYVETKSPTVFHVRCAELCGLWHGYMYNNGRVVDSTQFRSWAAQQEKLYAAIKPFMNKAPDQGGAPYAHSYLPAPGGGSPQVRAG

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
34 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
57 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
58 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
59 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
60 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
61 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
64 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
65 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
69 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
77 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
78 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
82 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
97 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
98 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
99 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 1.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.4
Rhizosphere 92.43
Stem 0
Stem Tuber 0
Unclassified 12.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100282498 3300005435 Bacteria 1542
2 Ga0070658_10012569 3300005327 Bacteria 6790
3 Ga0070683_100016847 3300005329 Bacteria 6447
4 Ga0070683_100017716 3300005329 Bacteria 6294
5 Ga0070683_100230299 3300005329 Unclassified 1762
6 Ga0070680_100043656 3300005336 Bacteria 3641
7 Ga0070680_100230576 3300005336 Bacteria 1564
8 Ga0070682_100089022 3300005337 Unclassified 2015
9 Ga0070660_100003251 3300005339 Bacteria 11151
10 Ga0070660_100090465 3300005339 Bacteria 2413
11 Ga0070691_10021406 3300005341 Bacteria 2992
12 Ga0070659_100060113 3300005366 Bacteria 3002
13 Ga0070709_10046911 3300005434 Bacteria 2689
14 Ga0070709_10067471 3300005434 Unclassified 2297
15 Ga0070709_10069522 3300005434 Bacteria 2268
16 Ga0070709_10093611 3300005434 Bacteria 1986
17 Ga0070709_10252568 3300005434 Bacteria 1271
18 Ga0070714_100010935 3300005435 Bacteria 7187
19 Ga0070714_100014158 3300005435 Bacteria 6405
20 Ga0070714_100021402 3300005435 Bacteria 5292
21 Ga0070714_100027718 3300005435 Bacteria 4693
22 Ga0070714_100050503 3300005435 Bacteria 3543
23 Ga0070714_100072759 3300005435 Bacteria 2976
24 Ga0070714_100188621 3300005435 Unclassified 1880
25 Ga0070714_100258762 3300005435 Bacteria 1611
26 Ga0070713_100004631 3300005436 Bacteria 9274
27 Ga0070713_100007202 3300005436 Bacteria 7785
28 Ga0070713_100094806 3300005436 Bacteria 2574
29 Ga0070713_100472911 3300005436 Unclassified 1180
30 Ga0070710_10007692 3300005437 Bacteria 5225
31 Ga0070710_10028333 3300005437 Bacteria 2995
32 Ga0070710_10313124 3300005437 Bacteria 1028
33 Ga0070711_100085427 3300005439 Bacteria 2260
34 Ga0070708_100239126 3300005445 Unclassified 1705
35 Ga0070681_10008810 3300005458 Bacteria 9905
36 Ga0070681_10167494 3300005458 Bacteria 2119
37 Ga0070707_100000445 3300005468 Bacteria 40989
38 Ga0070707_100108570 3300005468 Bacteria 2692
39 Ga0070707_100299111 3300005468 Unclassified 1564
40 Ga0070679_100027534 3300005530 Bacteria 5596
41 Ga0070679_100117228 3300005530 Bacteria 2648
42 Ga0070679_100118710 3300005530 Bacteria 2630
43 Ga0070684_100008226 3300005535 Bacteria 8151
44 Ga0068855_100015736 3300005563 Bacteria 9099
45 Ga0068856_100009230 3300005614 Bacteria 9593
46 Ga0070717_10001383 3300006028 Bacteria 16698
47 Ga0070717_10016886 3300006028 Bacteria 5667
48 Ga0070717_10027281 3300006028 Bacteria 4564
49 Ga0070717_10043441 3300006028 Bacteria 3668
50 Ga0070717_10114565 3300006028 Bacteria 2303
51 Ga0070715_10000206 3300006163 Bacteria 13864
52 Ga0070716_100001775 3300006173 Bacteria 9763
53 Ga0070716_100270063 3300006173 Bacteria 1168
54 Ga0070712_100008799 3300006175 Bacteria 6357
55 Ga0075436_100150345 3300006914 Bacteria 1638
56 Ga0105240_10280904 3300009093 Bacteria 1912
57 Ga0105240_10420847 3300009093 Bacteria 1501
58 Ga0105241_10455230 3300009174 Bacteria 1133
59 Ga0105241_10524945 3300009174 Bacteria 1059
60 Ga0105237_10006254 3300009545 Bacteria 13254
61 Ga0105237_10056066 3300009545 Bacteria 3945
62 Ga0105238_10018870 3300009551 Bacteria 7021
63 Ga0157370_10072644 3300013104 Bacteria 3245
64 Ga0157369_10003395 3300013105 Bacteria 18891
65 Ga0157369_10003872 3300013105 Bacteria 17775
66 Ga0157369_10016029 3300013105 Bacteria 8433
67 Ga0157369_10027514 3300013105 Bacteria 6302
68 Ga0157369_10036119 3300013105 Bacteria 5416
69 Ga0157374_10070638 3300013296 Bacteria 3291
70 Ga0157374_10499886 3300013296 Bacteria 1220
71 Ga0157372_10034070 3300013307 Bacteria 5596
72 Ga0182008_10068705 3300014497 Bacteria 1743
73 Ga0182008_10167561 3300014497 Bacteria 1108
74 Ga0197907_10665034 3300020069 Bacteria 2009
75 Ga0206356_11250198 3300020070 Bacteria 1853
76 Ga0206356_11468005 3300020070 Bacteria 1064
77 Ga0206355_1603386 3300020076 Unclassified 1485
78 Ga0206353_11140038 3300020082 Bacteria 5979
79 Ga0224712_10001598 3300022467 Bacteria 5308
80 Ga0224712_10023150 3300022467 Unclassified 2152
81 Ga0207699_10039611 3300025906 Bacteria 2709
82 Ga0207699_10044460 3300025906 Bacteria 2586
83 Ga0207699_10078389 3300025906 Unclassified 2040
84 Ga0207705_10028060 3300025909 Bacteria 4013
85 Ga0207707_10016175 3300025912 Bacteria 6509
86 Ga0207707_10387726 3300025912 Bacteria 1200
87 Ga0207695_10087217 3300025913 Bacteria 3144
88 Ga0207695_10173356 3300025913 Unclassified 2081
89 Ga0207695_10195276 3300025913 Bacteria 1940
90 Ga0207671_10109252 3300025914 Bacteria 2102
91 Ga0207693_10006828 3300025915 Bacteria 9428
92 Ga0207693_10014121 3300025915 Bacteria 6431
93 Ga0207663_10055545 3300025916 Bacteria 2485
94 Ga0207663_10092870 3300025916 Bacteria 2007
95 Ga0207660_10180742 3300025917 Bacteria 1638
96 Ga0207657_10019430 3300025919 Bacteria 6452
97 Ga0207657_10118159 3300025919 Bacteria 2183
98 Ga0207652_10086255 3300025921 Bacteria 2752
99 Ga0207652_10429111 3300025921 Unclassified 1192
100 Ga0207646_10001908 3300025922 Bacteria 25106
101 Ga0207646_10184016 3300025922 Bacteria 1887
102 Ga0207700_10039956 3300025928 Bacteria 3420
103 Ga0207700_10062066 3300025928 Bacteria 2837
104 Ga0207700_10178701 3300025928 Bacteria 1775
105 Ga0207664_10004541 3300025929 Bacteria 9408
106 Ga0207664_10025574 3300025929 Bacteria 4451
107 Ga0207664_10073204 3300025929 Bacteria 2764
108 Ga0207664_10119335 3300025929 Bacteria 2205
109 Ga0207664_10134009 3300025929 Bacteria 2088
110 Ga0207664_10145380 3300025929 Bacteria 2010
111 Ga0207664_10180819 3300025929 Bacteria 1810
112 Ga0207664_10309208 3300025929 Bacteria 1392
113 Ga0207665_10001018 3300025939 Bacteria 18916
114 Ga0207665_10186834 3300025939 Unclassified 1504
115 Ga0207661_10009909 3300025944 Bacteria 6843
116 Ga0207661_10021891 3300025944 Bacteria 4799
117 Ga0207667_10092945 3300025949 Bacteria 3115
118 Ga0207702_10028533 3300026078 Bacteria 4639
119 Ga0265337_1018407 3300028556 Unclassified 2220
120 Ga0265319_1005383 3300028563 Bacteria 6131
121 Ga0265319_1028836 3300028563 Bacteria 1953
122 Ga0265334_10000492 3300028573 Bacteria 20354
123 Ga0265334_10017657 3300028573 Bacteria 2943
124 Ga0265334_10022701 3300028573 Bacteria 2554
125 Ga0265334_10026718 3300028573 Bacteria 2329
126 Ga0265318_10000429 3300028577 Bacteria 31981
127 Ga0265318_10020519 3300028577 Bacteria 2665
128 Ga0265318_10087609 3300028577 Unclassified 1147
129 Ga0265322_10004312 3300028654 Bacteria 4247
130 Ga0265322_10004651 3300028654 Bacteria 4078
131 Ga0265322_10024794 3300028654 Unclassified 1716
132 Ga0265336_10004248 3300028666 Bacteria 5451
133 Ga0265336_10013473 3300028666 Bacteria 2726
134 Ga0265338_10002292 3300028800 Bacteria 29139
135 Ga0265338_10003836 3300028800 Bacteria 20883
136 Ga0265338_10006920 3300028800 Bacteria 14272
137 Ga0265338_10010581 3300028800 Bacteria 10789
138 Ga0265338_10010750 3300028800 Bacteria 10680
139 Ga0265338_10016896 3300028800 Bacteria 7898
140 Ga0265338_10040031 3300028800 Bacteria 4409
141 Ga0265338_10084685 3300028800 Bacteria 2645
142 Ga0265338_10113090 3300028800 Bacteria 2181
143 Ga0265338_10158033 3300028800 Bacteria 1754
144 Ga0265338_10165683 3300028800 Unclassified 1701
145 Ga0265338_10348960 3300028800 Bacteria 1064
146 Ga0265330_10000760 3300031235 Bacteria 20237
147 Ga0265330_10018953 3300031235 Bacteria 3158
148 Ga0265330_10131065 3300031235 Unclassified 1067
149 Ga0265332_10003620 3300031238 Bacteria 7404
150 Ga0265328_10000357 3300031239 Bacteria 21493
151 Ga0265320_10005108 3300031240 Bacteria 8478
152 Ga0265320_10028937 3300031240 Bacteria 2872
153 Ga0265320_10048354 3300031240 Bacteria 2076
154 Ga0265325_10027491 3300031241 Bacteria 3075
155 Ga0265325_10044198 3300031241 Bacteria 2321
156 Ga0265325_10097517 3300031241 Bacteria 1443
157 Ga0265329_10009037 3300031242 Bacteria 3741
158 Ga0265340_10068574 3300031247 Bacteria 1684
159 Ga0265340_10078370 3300031247 Unclassified 1558
160 Ga0265340_10082319 3300031247 Unclassified 1514
161 Ga0265339_10012774 3300031249 Bacteria 5106
162 Ga0265339_10026012 3300031249 Bacteria 3354
163 Ga0265339_10103420 3300031249 Bacteria 1479
164 Ga0265327_10003298 3300031251 Bacteria 15633
165 Ga0265327_10022747 3300031251 Bacteria 3735
166 Ga0265327_10066912 3300031251 Bacteria 1811
167 Ga0265316_10023216 3300031344 Bacteria 5215
168 Ga0265316_10026314 3300031344 Bacteria 4841
169 Ga0265316_10027658 3300031344 Bacteria 4690
170 Ga0265316_10102891 3300031344 Bacteria 2169
171 Ga0265313_10002251 3300031595 Bacteria 16966
172 Ga0265313_10008655 3300031595 Bacteria 6730
173 Ga0265313_10058430 3300031595 Unclassified 1818
174 Ga0265314_10011890 3300031711 Bacteria 7149
175 Ga0265314_10030184 3300031711 Bacteria 4016
176 Ga0265314_10047279 3300031711 Bacteria 3029
177 Ga0265342_10003288 3300031712 Bacteria 13375
178 Ga0265342_10011149 3300031712 Bacteria 6169
179 Ga0265342_10161824 3300031712 Bacteria 1237
180 Ga0373926_0009042 3300035083 Bacteria 3323
181 Ga0373944_0014503 3300035089 Bacteria 2200
182 Ga0373936_0024037 3300035113 Bacteria 2377
183 Ga0373936_0060699 3300035113 Viruses 1543
184 Ga0373945_0009976 3300035116 Bacteria 3121
185 Ga0373943_0000708 3300035170 Bacteria 14561
186 Ga0373943_0006539 3300035170 Bacteria 5233
187 Ga0373943_0008619 3300035170 Bacteria 4572
188 Ga0373943_0105921 3300035170 Bacteria 1477
189 Ga0373946_0001448 3300035171 Bacteria 8253
190 Ga0373955_0113619 3300035172 Bacteria 1568
191 Ga0373931_0127700 3300035691 Unclassified 1460
192 Ga0373935_0013507 3300035692 Bacteria 4927
193 Ga0373935_0016019 3300035692 Bacteria 4537
194 Ga0373935_0247836 3300035692 Bacteria 1246
195 Ga0373927_0035805 3300035695 Bacteria 3229
196 Ga0373927_0102081 3300035695 Bacteria 1866
197 Ga0373933_0041646 3300035724 Bacteria 2712
198 Ga0373933_0194391 3300035724 Bacteria 1297
199 Ga0373933_0325454 3300035724 Bacteria 997
200 Ga0373947_0002107 3300035725 Bacteria 12123
201 Ga0373947_0018607 3300035725 Bacteria 4000
202 Ga0373937_0000308 3300036401 Bacteria 46115
203 Ga0373937_0035960 3300036401 Bacteria 4511
204 Ga0373937_0097879 3300036401 Bacteria 2721
205 Ga0373937_0385477 3300036401 Bacteria 1329
206 Ga0373925_0001399 3300037068 Bacteria 20978
207 Ga0373925_0002351 3300037068 Bacteria 15189
208 Ga0373925_0201333 3300037068 Unclassified 1583
209 Ga0395899_0160788 3300037312 Bacteria 1587
210 Ga0395900_0009381 3300037418 Bacteria 10033
211 Ga0395900_0054890 3300037418 Bacteria 4102
212 Ga0395900_0060157 3300037418 Bacteria 3910
213 Ga0395900_0850738 3300037418 Bacteria 838
214 Ga0395898_0016031 3300037466 Bacteria 7675
215 Ga0395898_0136990 3300037466 Bacteria 2344
216 Ga0395898_0165685 3300037466 Unclassified 2114
217 Ga0395901_0022593 3300038443 Bacteria 6448
218 Ga0395901_0073857 3300038443 Bacteria 3557
219 Ga0395901_0074427 3300038443 Bacteria 3543
220 Ga0395901_0513298 3300038443 Bacteria 1219
221 Ga0436365_0589664 3300039437 Bacteria 5984
222 Ga0436362_0122452 3300039453 Bacteria 1699
223 Ga0451807_0390771 3300041486 Unclassified 929
224 Ga0466969_0002282 3300044656 Bacteria 10243
225 Ga0466969_0065240 3300044656 Unclassified 1761
226 Ga0466969_0157231 3300044656 Bacteria 1045
227 Ga0466972_0115956 3300044658 Unclassified 1264
228 Ga0466965_0017401 3300044683 Bacteria 3436
229 Ga0466965_0063526 3300044683 Bacteria 1848
230 Ga0466965_0096033 3300044683 Unclassified 1512
231 Ga0466966_0004423 3300044684 Bacteria 9266
232 Ga0466966_0018620 3300044684 Bacteria 4576
233 Ga0466966_0023443 3300044684 Bacteria 4041
234 Ga0466966_0060973 3300044684 Bacteria 2380
235 Ga0466966_0135895 3300044684 Bacteria 1503
236 Ga0466961_0006444 3300044693 Bacteria 7453
237 Ga0466961_0019637 3300044693 Bacteria 4348
238 Ga0466961_0032800 3300044693 Bacteria 3336
239 Ga0466961_0056963 3300044693 Bacteria 2489
240 Ga0466963_0000063 3300044694 Bacteria 36209
241 Ga0466963_0000532 3300044694 Bacteria 17888
242 Ga0466963_0001170 3300044694 Bacteria 13766
243 Ga0466963_0001668 3300044694 Bacteria 12099
244 Ga0466963_0003131 3300044694 Bacteria 9383
245 Ga0466963_0003410 3300044694 Bacteria 9092
246 Ga0466963_0004571 3300044694 Bacteria 8055
247 Ga0466963_0004743 3300044694 Bacteria 7935
248 Ga0466963_0007397 3300044694 Bacteria 6543
249 Ga0466963_0012078 3300044694 Bacteria 5277
250 Ga0466963_0024253 3300044694 Bacteria 3861
251 Ga0466963_0029928 3300044694 Bacteria 3508
252 Ga0466963_0063126 3300044694 Bacteria 2479
253 Ga0466963_0091513 3300044694 Unclassified 2072
254 Ga0466963_0186343 3300044694 Bacteria 1449
255 Ga0466963_0187080 3300044694 Bacteria 1446
256 Ga0466963_0187375 3300044694 Unclassified 1445
257 Ga0466964_0003765 3300044706 Bacteria 5559
258 Ga0466964_0010435 3300044706 Bacteria 3504
259 Ga0466964_0027015 3300044706 Unclassified 2250
260 Ga0466964_0028919 3300044706 Unclassified 2186
261 Ga0466964_0031370 3300044706 Bacteria 2107
262 Ga0466971_0000840 3300044719 Bacteria 12499
263 Ga0466971_0003605 3300044719 Bacteria 6616
264 Ga0466971_0009517 3300044719 Bacteria 4243
265 Ga0466971_0060122 3300044719 Bacteria 1717
266 Ga0466971_0075056 3300044719 Bacteria 1537
267 Ga0466968_0000944 3300044735 Bacteria 10230
268 Ga0466968_0009575 3300044735 Bacteria 3729
269 Ga0466968_0079911 3300044735 Unclassified 1435
270 Ga0466968_0101809 3300044735 Bacteria 1283
271 Ga0466970_0007339 3300044765 Bacteria 5522
272 Ga0466970_0131864 3300044765 Unclassified 1373
273 Ga0466957_0002652 3300044842 Bacteria 9652
274 Ga0466957_0004191 3300044842 Bacteria 7991
275 Ga0466957_0007463 3300044842 Bacteria 6175
276 Ga0466957_0013908 3300044842 Bacteria 4679
277 Ga0466957_0018542 3300044842 Bacteria 4087
278 Ga0466957_0018954 3300044842 Bacteria 4045
279 Ga0466957_0025484 3300044842 Bacteria 3506
280 Ga0466957_0034001 3300044842 Bacteria 3058
281 Ga0466960_0015030 3300044901 Bacteria 3330
282 Ga0466960_0061465 3300044901 Unclassified 1844
283 Ga0466959_0007814 3300045049 Bacteria 7526
284 Ga0466959_0010769 3300045049 Bacteria 6552
285 Ga0466959_0021405 3300045049 Bacteria 4768
286 Ga0466959_0053854 3300045049 Bacteria 2941
287 Ga0466959_0054051 3300045049 Bacteria 2935
288 Ga0466959_0097358 3300045049 Unclassified 2109
289 Ga0466959_0105001 3300045049 Unclassified 2020
290 Ga0466959_0199443 3300045049 Bacteria 1394
291 Ga0466959_0210209 3300045049 Unclassified 1352
292 Ga0466958_0001030 3300045836 Bacteria 12726
293 Ga0466958_0001870 3300045836 Bacteria 10285
294 Ga0466958_0008049 3300045836 Bacteria 5829
295 Ga0466958_0011598 3300045836 Bacteria 4967
296 Ga0466958_0015206 3300045836 Bacteria 4406
297 Ga0466958_0015349 3300045836 Bacteria 4388
298 Ga0466958_0017512 3300045836 Bacteria 4144
299 Ga0466958_0057330 3300045836 Bacteria 2367
300 Ga0466958_0085768 3300045836 Unclassified 1942
301 Ga0466958_0096346 3300045836 Unclassified 1835
302 Ga0466958_0103270 3300045836 Bacteria 1774
303 Ga0466958_0171408 3300045836 Unclassified 1374
304 Ga0466967_0000058 3300045976 Bacteria 40166
305 Ga0466967_0005619 3300045976 Bacteria 8722
306 Ga0466967_0005902 3300045976 Bacteria 8583
307 Ga0466967_0007306 3300045976 Bacteria 7955
308 Ga0466967_0010600 3300045976 Bacteria 6924
309 Ga0466967_0018957 3300045976 Bacteria 5519
310 Ga0466967_0033953 3300045976 Bacteria 4324
311 Ga0466967_0052036 3300045976 Bacteria 3592
312 Ga0466967_0075160 3300045976 Bacteria 3036
313 Ga0466967_0075935 3300045976 Bacteria 3021
314 Ga0466967_0100637 3300045976 Bacteria 2641
315 Ga0466967_0115665 3300045976 Bacteria 2470
316 Ga0466967_0133570 3300045976 Bacteria 2306
317 Ga0466967_0147083 3300045976 Bacteria 2198
318 Ga0466967_0149880 3300045976 Unclassified 2179
319 Ga0466967_0165237 3300045976 Bacteria 2079
320 Ga0466967_0176197 3300045976 Bacteria 2014
321 Ga0466967_0193063 3300045976 Unclassified 1925
322 Ga0466967_0257857 3300045976 Unclassified 1667
323 Ga0466967_0375600 3300045976 Bacteria 1379
324 Ga0466967_0618783 3300045976 Bacteria 1069
325 Ga0495592_0000410 3300046454 Bacteria 32753
326 Ga0495592_0004998 3300046454 Bacteria 9763
327 Ga0495592_0288306 3300046454 Unclassified 1071
328 Ga0495603_0011158 3300046455 Bacteria 5447
329 Ga0495603_0025944 3300046455 Bacteria 3543
330 Ga0495603_0197299 3300046455 Unclassified 1163
331 Ga0495603_0252781 3300046455 Bacteria 1015
332 Ga0495629_0000783 3300046459 Bacteria 25631
333 Ga0495629_0036254 3300046459 Bacteria 3483
334 Ga0495629_0041851 3300046459 Bacteria 3221
335 Ga0495629_0054285 3300046459 Bacteria 2802
336 Ga0495629_0215087 3300046459 Bacteria 1327
337 Ga0495641_0000421 3300046461 Bacteria 35438
338 Ga0495641_0007071 3300046461 Bacteria 7106
339 Ga0495641_0010830 3300046461 Bacteria 5244
340 Ga0495641_0013433 3300046461 Bacteria 4501
341 Ga0495651_0000034 3300046462 Bacteria 99213
342 Ga0495651_0001663 3300046462 Bacteria 17191
343 Ga0495651_0014439 3300046462 Bacteria 6105
344 Ga0495651_0061046 3300046462 Bacteria 2886
345 Ga0495651_0082424 3300046462 Unclassified 2427
346 Ga0495651_0206824 3300046462 Bacteria 1369
347 Ga0495653_0021748 3300046463 Bacteria 5193
348 Ga0495653_0034515 3300046463 Bacteria 4000
349 Ga0495653_0056787 3300046463 Bacteria 2982
350 Ga0495653_0125872 3300046463 Bacteria 1820
351 Ga0495653_0215329 3300046463 Unclassified 1295
352 Ga0495582_0000139 3300046473 Bacteria 39203
353 Ga0495582_0010406 3300046473 Bacteria 5116
354 Ga0495582_0023286 3300046473 Bacteria 3389
355 Ga0495582_0053760 3300046473 Bacteria 2221
356 Ga0495582_0167320 3300046473 Unclassified 1251
357 Ga0495639_0000166 3300046475 Bacteria 34551
358 Ga0495639_0004561 3300046475 Bacteria 5938
359 Ga0495662_0000341 3300046476 Bacteria 20401
360 Ga0495664_0023533 3300046477 Bacteria 3575
361 Ga0495664_0030358 3300046477 Bacteria 3166
362 Ga0495664_0055691 3300046477 Bacteria 2353
363 Ga0495608_0000638 3300046511 Bacteria 24128
364 Ga0495608_0009815 3300046511 Bacteria 6682
365 Ga0495608_0040572 3300046511 Bacteria 3118
366 Ga0495608_0074913 3300046511 Bacteria 2206
367 Ga0495618_0002873 3300046514 Bacteria 10921
368 Ga0495618_0005628 3300046514 Bacteria 7617
369 Ga0495618_0049437 3300046514 Bacteria 2655
370 Ga0495618_0171628 3300046514 Bacteria 1380
371 Ga0495628_0000184 3300046516 Bacteria 54832
372 Ga0495628_0005773 3300046516 Bacteria 10845
373 Ga0495628_0096398 3300046516 Bacteria 2285
374 Ga0495628_0112549 3300046516 Bacteria 2092
375 Ga0495628_0148407 3300046516 Unclassified 1787
376 Ga0495628_0277636 3300046516 Bacteria 1245
377 Ga0495628_0385659 3300046516 Unclassified 1025
378 Ga0495630_0002629 3300046517 Bacteria 12438
379 Ga0495630_0003040 3300046517 Bacteria 11642
380 Ga0495630_0007473 3300046517 Bacteria 7809
381 Ga0495630_0016688 3300046517 Bacteria 5369
382 Ga0495630_0060049 3300046517 Bacteria 2853
383 Ga0495630_0061020 3300046517 Bacteria 2831
384 Ga0495630_0067142 3300046517 Bacteria 2695
385 Ga0495666_0049517 3300046526 Viruses 2021
386 Ga0495652_0000319 3300046529 Bacteria 56845
387 Ga0495652_0018524 3300046529 Bacteria 6207
388 Ga0495652_0060510 3300046529 Bacteria 3200
389 Ga0495665_0000480 3300046531 Bacteria 20086
390 Ga0495665_0003054 3300046531 Bacteria 9046
391 Ga0495640_0007089 3300046533 Bacteria 8819
392 Ga0495586_0006570 3300046535 Bacteria 6213
393 Ga0495587_0000055 3300046536 Bacteria 97024
394 Ga0495587_0002592 3300046536 Bacteria 12074
395 Ga0495587_0032097 3300046536 Bacteria 3177
396 Ga0495587_0108855 3300046536 Unclassified 1593
397 Ga0495587_0109056 3300046536 Bacteria 1591
398 Ga0495645_0000170 3300046543 Bacteria 45455
399 Ga0495645_0013468 3300046543 Bacteria 5782
400 Ga0495645_0015728 3300046543 Bacteria 5386
401 Ga0495645_0035610 3300046543 Bacteria 3628
402 Ga0495645_0052364 3300046543 Bacteria 2970
403 Ga0495645_0185589 3300046543 Unclassified 1421
404 Ga0495645_0263809 3300046543 Bacteria 1139
405 Ga0495667_0040483 3300046559 Bacteria 3094
406 Ga0495667_0074754 3300046559 Bacteria 2206
407 Ga0495667_0095005 3300046559 Bacteria 1930
408 Ga0495667_0116701 3300046559 Bacteria 1724
409 Ga0495667_0138400 3300046559 Bacteria 1569
410 Ga0495634_0001802 3300046642 Bacteria 18504
411 Ga0495634_0002962 3300046642 Bacteria 13857
412 Ga0495634_0024046 3300046642 Bacteria 4278
413 Ga0495634_0024882 3300046642 Bacteria 4197
414 Ga0495634_0034030 3300046642 Bacteria 3497
415 Ga0495634_0034790 3300046642 Bacteria 3454
416 Ga0495634_0091635 3300046642 Bacteria 1973
417 Ga0495635_0005146 3300046663 Bacteria 9104
418 Ga0495635_0009812 3300046663 Bacteria 6695
419 Ga0495635_0039758 3300046663 Bacteria 3253
420 Ga0495635_0053555 3300046663 Bacteria 2780
421 Ga0495635_0054820 3300046663 Bacteria 2746
422 Ga0495635_0061115 3300046663 Bacteria 2588
423 Ga0495635_0094532 3300046663 Bacteria 2043
424 Ga0495588_0187710 3300046674 Bacteria 1092
425 Ga0495657_0008362 3300046675 Bacteria 7925
426 Ga0495657_0041983 3300046675 Bacteria 3126
427 Ga0495657_0045150 3300046675 Bacteria 2992
428 Ga0495657_0100708 3300046675 Bacteria 1841
429 Ga0495657_0105235 3300046675 Bacteria 1793
430 Ga0495657_0124920 3300046675 Bacteria 1617
431 Ga0495599_0001220 3300046678 Bacteria 14572
432 Ga0495599_0047059 3300046678 Bacteria 2704
433 Ga0495623_0000149 3300046679 Bacteria 42958
434 Ga0495623_0024677 3300046679 Bacteria 3871
435 Ga0495646_0008095 3300046680 Bacteria 6684
436 Ga0495646_0071362 3300046680 Bacteria 2043
437 Ga0495646_0187561 3300046680 Bacteria 1132
438 Ga0495647_0003022 3300046681 Bacteria 5355
439 Ga0495658_0000149 3300046683 Bacteria 39059
440 Ga0495658_0017571 3300046683 Bacteria 3698
441 Ga0495658_0044577 3300046683 Unclassified 2486
442 Ga0495658_0059638 3300046683 Unclassified 2186
443 Ga0495613_0002462 3300046689 Bacteria 13954
444 Ga0495613_0007620 3300046689 Bacteria 8050
445 Ga0495613_0019064 3300046689 Bacteria 5113
446 Ga0495624_0023223 3300046690 Bacteria 4091
447 Ga0495624_0026778 3300046690 Bacteria 3778
448 Ga0495624_0104593 3300046690 Bacteria 1742
449 Ga0495600_0055747 3300046809 Bacteria 2581
450 Ga0495600_0128675 3300046809 Unclassified 1646
451 Ga0495600_0231467 3300046809 Bacteria 1180
452 Ga0495600_0231649 3300046809 Bacteria 1179
453 Ga0495581_0000900 3300047315 Bacteria 15923
454 Ga0495581_0021505 3300047315 Bacteria 3738
455 Ga0495604_0000019 3300047317 Bacteria 175064
456 Ga0495604_0000194 3300047317 Bacteria 54877
457 Ga0495604_0105060 3300047317 Bacteria 2068
458 Ga0495604_0175438 3300047317 Bacteria 1503
459 Ga0495604_0276915 3300047317 Bacteria 1135
460 Ga0495674_0015705 3300047319 Bacteria 7068
461 Ga0495674_0019031 3300047319 Bacteria 6384
462 Ga0495674_0024937 3300047319 Bacteria 5488
463 Ga0495674_0066636 3300047319 Bacteria 3123
464 Ga0495674_0078544 3300047319 Bacteria 2835
465 Ga0495674_0338473 3300047319 Unclassified 1223
466 Ga0495676_0001858 3300047321 Bacteria 18533
467 Ga0495676_0113726 3300047321 Unclassified 1981
468 Ga0495676_0116853 3300047321 Bacteria 1947
469 Ga0495676_0133919 3300047321 Unclassified 1785
470 Ga0495680_0001661 3300047322 Bacteria 23654
471 Ga0495680_0002927 3300047322 Bacteria 17149
472 Ga0495680_0027260 3300047322 Bacteria 4696
473 Ga0495680_0053584 3300047322 Bacteria 3138
474 Ga0495680_0064483 3300047322 Bacteria 2809
475 Ga0495680_0075254 3300047322 Bacteria 2562
476 Ga0495680_0097218 3300047322 Bacteria 2198
477 Ga0495675_0000029 3300047444 Bacteria 105305
478 Ga0495684_0010365 3300047471 Bacteria 7210
479 Ga0495684_0044227 3300047471 Bacteria 3409
480 Ga0495684_0047784 3300047471 Bacteria 3272
481 Ga0495593_0000750 3300047673 Bacteria 18855
482 Ga0495593_0038252 3300047673 Bacteria 2591
483 Ga0495602_0000741 3300048088 Bacteria 30911
484 Ga0495602_0044523 3300048088 Bacteria 4025
485 Ga0495602_0086379 3300048088 Bacteria 2619
486 Ga0495602_0226180 3300048088 Unclassified 1409
487 Ga0495614_0001705 3300048089 Bacteria 9587
488 Ga0495614_0002889 3300048089 Bacteria 7649
489 Ga0495614_0025227 3300048089 Bacteria 2564
490 Ga0496100_0023490 3300048903 Bacteria 3746
491 Ga0496102_0174908 3300048905 Bacteria 2021
492 Ga0496103_0289586 3300048906 Unclassified 1053
493 Ga0496104_0025508 3300048907 Bacteria 5449
494 Ga0496104_0029797 3300048907 Bacteria 5065
495 Ga0496104_0149395 3300048907 Bacteria 2243
496 Ga0496104_0192358 3300048907 Unclassified 1952
497 Ga0496105_0002189 3300048908 Bacteria 14153
498 Ga0496105_0013935 3300048908 Bacteria 6390
499 Ga0496106_0005421 3300048909 Bacteria 9436
500 Ga0496106_0007960 3300048909 Bacteria 7831
501 Ga0496106_0064804 3300048909 Unclassified 2781
502 Ga0496108_0006809 3300048911 Bacteria 9249
503 Ga0496108_0038294 3300048911 Bacteria 3994
504 Ga0496109_0004307 3300048912 Bacteria 11885
505 Ga0496109_0020876 3300048912 Bacteria 5789
506 Ga0496109_0811175 3300048912 Unclassified 874
507 Ga0496110_0000970 3300048913 Bacteria 20097
508 Ga0496110_0012177 3300048913 Bacteria 7066
509 Ga0496110_0052905 3300048913 Bacteria 3568
510 Ga0496110_0121100 3300048913 Unclassified 2357
511 Ga0496110_0163604 3300048913 Bacteria 2017
512 Ga0496110_0167814 3300048913 Bacteria 1991
513 Ga0496111_0002051 3300048914 Bacteria 12004
514 Ga0496111_0065565 3300048914 Bacteria 2636
515 Ga0496111_0280125 3300048914 Bacteria 1236
516 Ga0496112_0006882 3300048915 Bacteria 10027
517 Ga0496112_0014169 3300048915 Bacteria 7388
518 Ga0496112_0067391 3300048915 Bacteria 3533
519 Ga0496112_0068703 3300048915 Bacteria 3499
520 Ga0496112_0071821 3300048915 Bacteria 3421
521 Ga0496112_0204075 3300048915 Bacteria 1935
522 Ga0496112_0211145 3300048915 Unclassified 1898
523 Ga0496113_0008476 3300048916 Bacteria 6700
524 Ga0496113_0060115 3300048916 Bacteria 2864
525 Ga0496113_0073471 3300048916 Bacteria 2605
526 Ga0496113_0159916 3300048916 Unclassified 1780
527 Ga0496114_0005225 3300048917 Bacteria 10144
528 Ga0496114_0076244 3300048917 Bacteria 2825
529 Ga0496115_0009386 3300048918 Bacteria 7270
530 Ga0496115_0025593 3300048918 Bacteria 4597
531 Ga0496115_0340776 3300048918 Unclassified 1223
532 Ga0501041_0074476 3300049577 Unclassified 2086
533 Ga0501043_0335532 3300049579 Bacteria 1151
534 Ga0501046_0023635 3300049580 Bacteria 5052
535 Ga0501047_0035997 3300049581 Bacteria 4783
536 Ga0501047_0097518 3300049581 Bacteria 2818
537 Ga0501067_0011371 3300049583 Bacteria 4929
538 Ga0501069_0007840 3300049585 Bacteria 5605
539 Ga0501069_0015309 3300049585 Bacteria 4110
540 Ga0501070_0002407 3300049586 Bacteria 16412
541 Ga0501070_0015806 3300049586 Bacteria 6346
542 Ga0501072_0003796 3300049588 Bacteria 11406
543 Ga0501073_0041383 3300049589 Bacteria 3256
544 Ga0501074_0003122 3300049590 Bacteria 11682
545 Ga0501074_0003478 3300049590 Bacteria 11175
546 Ga0501074_0046635 3300049590 Bacteria 3133
547 Ga0501074_0296729 3300049590 Unclassified 1148
548 Ga0501079_0051760 3300049741 Bacteria 3171
549 Ga0501080_0011497 3300049742 Bacteria 8104
550 Ga0501080_0019295 3300049742 Bacteria 6317
551 Ga0501080_0240149 3300049742 Unclassified 1654
552 Ga0501081_0397569 3300049743 Bacteria 1020
553 Ga0501083_0000442 3300049744 Bacteria 26662
554 nmdc:mga08x19_68103_c1 3300050514 Unclassified 2316
555 Ga0495601_0000082 3300053077 Bacteria 51242
556 Ga0495601_0001051 3300053077 Bacteria 15116
557 Ga0495601_0006082 3300053077 Bacteria 7041
558 Ga0495601_0007828 3300053077 Bacteria 6287
559 Ga0495601_0099983 3300053077 Bacteria 1873
560 Ga0495601_0162291 3300053077 Bacteria 1461
561 Ga0495612_0000412 3300053078 Bacteria 17061
562 Ga0495612_0026622 3300053078 Bacteria 2324
563 Ga0495612_0047789 3300053078 Bacteria 1754
564 Ga0495595_0006938 3300053084 Bacteria 4624
565 Ga0495595_0014501 3300053084 Bacteria 3346
566 Ga0495595_0125392 3300053084 Bacteria 1253
567 Ga0495595_0144205 3300053084 Bacteria 1169
568 Ga0495619_0000901 3300053085 Bacteria 19446
569 Ga0495619_0004401 3300053085 Bacteria 8985
570 Ga0495619_0011606 3300053085 Bacteria 5551
571 Ga0495619_0016589 3300053085 Bacteria 4662
572 Ga0495619_0018500 3300053085 Bacteria 4419
573 Ga0495619_0023764 3300053085 Bacteria 3929
574 Ga0495619_0036400 3300053085 Bacteria 3205
575 Ga0495619_0051144 3300053085 Bacteria 2730
576 Ga0466962_0000979 3300061719 Bacteria 12991
577 Ga0466962_0001028 3300061719 Bacteria 12768
578 Ga0466962_0002528 3300061719 Bacteria 8686
579 Ga0466962_0005923 3300061719 Bacteria 5875
580 Ga0466962_0017151 3300061719 Bacteria 3489
581 Ga0466962_0038683 3300061719 Unclassified 2284
582 Ga0070714_100282498
583 Ga0070658_10012569
584 Ga0070683_100016847
585 Ga0070683_100017716
586 Ga0070683_100230299
587 Ga0070680_100043656
588 Ga0070680_100230576
589 Ga0070682_100089022
590 Ga0070660_100003251
591 Ga0070660_100090465
592 Ga0070691_10021406
593 Ga0070659_100060113
594 Ga0070709_10046911
595 Ga0070709_10067471
596 Ga0070709_10069522
597 Ga0070709_10093611
598 Ga0070709_10252568
599 Ga0070714_100010935
600 Ga0070714_100014158
601 Ga0070714_100021402
602 Ga0070714_100027718
603 Ga0070714_100050503
604 Ga0070714_100072759
605 Ga0070714_100188621
606 Ga0070714_100258762
607 Ga0070713_100004631
608 Ga0070713_100007202
609 Ga0070713_100094806
610 Ga0070713_100472911
611 Ga0070710_10007692
612 Ga0070710_10028333
613 Ga0070710_10313124
614 Ga0070711_100085427
615 Ga0070708_100239126
616 Ga0070681_10008810
617 Ga0070681_10167494
618 Ga0070707_100000445
619 Ga0070707_100108570
620 Ga0070707_100299111
621 Ga0070679_100027534
622 Ga0070679_100117228
623 Ga0070679_100118710
624 Ga0070684_100008226
625 Ga0068855_100015736
626 Ga0068856_100009230
627 Ga0070717_10001383
628 Ga0070717_10016886
629 Ga0070717_10027281
630 Ga0070717_10043441
631 Ga0070717_10114565
632 Ga0070715_10000206
633 Ga0070716_100001775
634 Ga0070716_100270063
635 Ga0070712_100008799
636 Ga0075436_100150345
637 Ga0105240_10280904
638 Ga0105240_10420847
639 Ga0105241_10455230
640 Ga0105241_10524945
641 Ga0105237_10006254
642 Ga0105237_10056066
643 Ga0105238_10018870
644 Ga0157370_10072644
645 Ga0157369_10003395
646 Ga0157369_10003872
647 Ga0157369_10016029
648 Ga0157369_10027514
649 Ga0157369_10036119
650 Ga0157374_10070638
651 Ga0157374_10499886
652 Ga0157372_10034070
653 Ga0182008_10068705
654 Ga0182008_10167561
655 Ga0197907_10665034
656 Ga0206356_11250198
657 Ga0206356_11468005
658 Ga0206355_1603386
659 Ga0206353_11140038
660 Ga0224712_10001598
661 Ga0224712_10023150
662 Ga0207699_10039611
663 Ga0207699_10044460
664 Ga0207699_10078389
665 Ga0207705_10028060
666 Ga0207707_10016175
667 Ga0207707_10387726
668 Ga0207695_10087217
669 Ga0207695_10173356
670 Ga0207695_10195276
671 Ga0207671_10109252
672 Ga0207693_10006828
673 Ga0207693_10014121
674 Ga0207663_10055545
675 Ga0207663_10092870
676 Ga0207660_10180742
677 Ga0207657_10019430
678 Ga0207657_10118159
679 Ga0207652_10086255
680 Ga0207652_10429111
681 Ga0207646_10001908
682 Ga0207646_10184016
683 Ga0207700_10039956
684 Ga0207700_10062066
685 Ga0207700_10178701
686 Ga0207664_10004541
687 Ga0207664_10025574
688 Ga0207664_10073204
689 Ga0207664_10119335
690 Ga0207664_10134009
691 Ga0207664_10145380
692 Ga0207664_10180819
693 Ga0207664_10309208
694 Ga0207665_10001018
695 Ga0207665_10186834
696 Ga0207661_10009909
697 Ga0207661_10021891
698 Ga0207667_10092945
699 Ga0207702_10028533
700 Ga0265337_1018407
701 Ga0265319_1005383
702 Ga0265319_1028836
703 Ga0265334_10000492
704 Ga0265334_10017657
705 Ga0265334_10022701
706 Ga0265334_10026718
707 Ga0265318_10000429
708 Ga0265318_10020519
709 Ga0265318_10087609
710 Ga0265322_10004312
711 Ga0265322_10004651
712 Ga0265322_10024794
713 Ga0265336_10004248
714 Ga0265336_10013473
715 Ga0265338_10002292
716 Ga0265338_10003836
717 Ga0265338_10006920
718 Ga0265338_10010581
719 Ga0265338_10010750
720 Ga0265338_10016896
721 Ga0265338_10040031
722 Ga0265338_10084685
723 Ga0265338_10113090
724 Ga0265338_10158033
725 Ga0265338_10165683
726 Ga0265338_10348960
727 Ga0265330_10000760
728 Ga0265330_10018953
729 Ga0265330_10131065
730 Ga0265332_10003620
731 Ga0265328_10000357
732 Ga0265320_10005108
733 Ga0265320_10028937
734 Ga0265320_10048354
735 Ga0265325_10027491
736 Ga0265325_10044198
737 Ga0265325_10097517
738 Ga0265329_10009037
739 Ga0265340_10068574
740 Ga0265340_10078370
741 Ga0265340_10082319
742 Ga0265339_10012774
743 Ga0265339_10026012
744 Ga0265339_10103420
745 Ga0265327_10003298
746 Ga0265327_10022747
747 Ga0265327_10066912
748 Ga0265316_10023216
749 Ga0265316_10026314
750 Ga0265316_10027658
751 Ga0265316_10102891
752 Ga0265313_10002251
753 Ga0265313_10008655
754 Ga0265313_10058430
755 Ga0265314_10011890
756 Ga0265314_10030184
757 Ga0265314_10047279
758 Ga0265342_10003288
759 Ga0265342_10011149
760 Ga0265342_10161824
761 Ga0373926_0009042
762 Ga0373944_0014503
763 Ga0373936_0024037
764 Ga0373936_0060699
765 Ga0373945_0009976
766 Ga0373943_0000708
767 Ga0373943_0006539
768 Ga0373943_0008619
769 Ga0373943_0105921
770 Ga0373946_0001448
771 Ga0373955_0113619
772 Ga0373931_0127700
773 Ga0373935_0013507
774 Ga0373935_0016019
775 Ga0373935_0247836
776 Ga0373927_0035805
777 Ga0373927_0102081
778 Ga0373933_0041646
779 Ga0373933_0194391
780 Ga0373933_0325454
781 Ga0373947_0002107
782 Ga0373947_0018607
783 Ga0373937_0000308
784 Ga0373937_0035960
785 Ga0373937_0097879
786 Ga0373937_0385477
787 Ga0373925_0001399
788 Ga0373925_0002351
789 Ga0373925_0201333
790 Ga0395899_0160788
791 Ga0395900_0009381
792 Ga0395900_0054890
793 Ga0395900_0060157
794 Ga0395900_0850738
795 Ga0395898_0016031
796 Ga0395898_0136990
797 Ga0395898_0165685
798 Ga0395901_0022593
799 Ga0395901_0073857
800 Ga0395901_0074427
801 Ga0395901_0513298
802 Ga0436365_0589664
803 Ga0436362_0122452
804 Ga0451807_0390771
805 Ga0466969_0002282
806 Ga0466969_0065240
807 Ga0466969_0157231
808 Ga0466972_0115956
809 Ga0466965_0017401
810 Ga0466965_0063526
811 Ga0466965_0096033
812 Ga0466966_0004423
813 Ga0466966_0018620
814 Ga0466966_0023443
815 Ga0466966_0060973
816 Ga0466966_0135895
817 Ga0466961_0006444
818 Ga0466961_0019637
819 Ga0466961_0032800
820 Ga0466961_0056963
821 Ga0466963_0000063
822 Ga0466963_0000532
823 Ga0466963_0001170
824 Ga0466963_0001668
825 Ga0466963_0003131
826 Ga0466963_0003410
827 Ga0466963_0004571
828 Ga0466963_0004743
829 Ga0466963_0007397
830 Ga0466963_0012078
831 Ga0466963_0024253
832 Ga0466963_0029928
833 Ga0466963_0063126
834 Ga0466963_0091513
835 Ga0466963_0186343
836 Ga0466963_0187080
837 Ga0466963_0187375
838 Ga0466964_0003765
839 Ga0466964_0010435
840 Ga0466964_0027015
841 Ga0466964_0028919
842 Ga0466964_0031370
843 Ga0466971_0000840
844 Ga0466971_0003605
845 Ga0466971_0009517
846 Ga0466971_0060122
847 Ga0466971_0075056
848 Ga0466968_0000944
849 Ga0466968_0009575
850 Ga0466968_0079911
851 Ga0466968_0101809
852 Ga0466970_0007339
853 Ga0466970_0131864
854 Ga0466957_0002652
855 Ga0466957_0004191
856 Ga0466957_0007463
857 Ga0466957_0013908
858 Ga0466957_0018542
859 Ga0466957_0018954
860 Ga0466957_0025484
861 Ga0466957_0034001
862 Ga0466960_0015030
863 Ga0466960_0061465
864 Ga0466959_0007814
865 Ga0466959_0010769
866 Ga0466959_0021405
867 Ga0466959_0053854
868 Ga0466959_0054051
869 Ga0466959_0097358
870 Ga0466959_0105001
871 Ga0466959_0199443
872 Ga0466959_0210209
873 Ga0466958_0001030
874 Ga0466958_0001870
875 Ga0466958_0008049
876 Ga0466958_0011598
877 Ga0466958_0015206
878 Ga0466958_0015349
879 Ga0466958_0017512
880 Ga0466958_0057330
881 Ga0466958_0085768
882 Ga0466958_0096346
883 Ga0466958_0103270
884 Ga0466958_0171408
885 Ga0466967_0000058
886 Ga0466967_0005619
887 Ga0466967_0005902
888 Ga0466967_0007306
889 Ga0466967_0010600
890 Ga0466967_0018957
891 Ga0466967_0033953
892 Ga0466967_0052036
893 Ga0466967_0075160
894 Ga0466967_0075935
895 Ga0466967_0100637
896 Ga0466967_0115665
897 Ga0466967_0133570
898 Ga0466967_0147083
899 Ga0466967_0149880
900 Ga0466967_0165237
901 Ga0466967_0176197
902 Ga0466967_0193063
903 Ga0466967_0257857
904 Ga0466967_0375600
905 Ga0466967_0618783
906 Ga0495592_0000410
907 Ga0495592_0004998
908 Ga0495592_0288306
909 Ga0495603_0011158
910 Ga0495603_0025944
911 Ga0495603_0197299
912 Ga0495603_0252781
913 Ga0495629_0000783
914 Ga0495629_0036254
915 Ga0495629_0041851
916 Ga0495629_0054285
917 Ga0495629_0215087
918 Ga0495641_0000421
919 Ga0495641_0007071
920 Ga0495641_0010830
921 Ga0495641_0013433
922 Ga0495651_0000034
923 Ga0495651_0001663
924 Ga0495651_0014439
925 Ga0495651_0061046
926 Ga0495651_0082424
927 Ga0495651_0206824
928 Ga0495653_0021748
929 Ga0495653_0034515
930 Ga0495653_0056787
931 Ga0495653_0125872
932 Ga0495653_0215329
933 Ga0495582_0000139
934 Ga0495582_0010406
935 Ga0495582_0023286
936 Ga0495582_0053760
937 Ga0495582_0167320
938 Ga0495639_0000166
939 Ga0495639_0004561
940 Ga0495662_0000341
941 Ga0495664_0023533
942 Ga0495664_0030358
943 Ga0495664_0055691
944 Ga0495608_0000638
945 Ga0495608_0009815
946 Ga0495608_0040572
947 Ga0495608_0074913
948 Ga0495618_0002873
949 Ga0495618_0005628
950 Ga0495618_0049437
951 Ga0495618_0171628
952 Ga0495628_0000184
953 Ga0495628_0005773
954 Ga0495628_0096398
955 Ga0495628_0112549
956 Ga0495628_0148407
957 Ga0495628_0277636
958 Ga0495628_0385659
959 Ga0495630_0002629
960 Ga0495630_0003040
961 Ga0495630_0007473
962 Ga0495630_0016688
963 Ga0495630_0060049
964 Ga0495630_0061020
965 Ga0495630_0067142
966 Ga0495666_0049517
967 Ga0495652_0000319
968 Ga0495652_0018524
969 Ga0495652_0060510
970 Ga0495665_0000480
971 Ga0495665_0003054
972 Ga0495640_0007089
973 Ga0495586_0006570
974 Ga0495587_0000055
975 Ga0495587_0002592
976 Ga0495587_0032097
977 Ga0495587_0108855
978 Ga0495587_0109056
979 Ga0495645_0000170
980 Ga0495645_0013468
981 Ga0495645_0015728
982 Ga0495645_0035610
983 Ga0495645_0052364
984 Ga0495645_0185589
985 Ga0495645_0263809
986 Ga0495667_0040483
987 Ga0495667_0074754
988 Ga0495667_0095005
989 Ga0495667_0116701
990 Ga0495667_0138400
991 Ga0495634_0001802
992 Ga0495634_0002962
993 Ga0495634_0024046
994 Ga0495634_0024882
995 Ga0495634_0034030
996 Ga0495634_0034790
997 Ga0495634_0091635
998 Ga0495635_0005146
999 Ga0495635_0009812
1000 Ga0495635_0039758
1001 Ga0495635_0053555
1002 Ga0495635_0054820
1003 Ga0495635_0061115
1004 Ga0495635_0094532
1005 Ga0495588_0187710
1006 Ga0495657_0008362
1007 Ga0495657_0041983
1008 Ga0495657_0045150
1009 Ga0495657_0100708
1010 Ga0495657_0105235
1011 Ga0495657_0124920
1012 Ga0495599_0001220
1013 Ga0495599_0047059
1014 Ga0495623_0000149
1015 Ga0495623_0024677
1016 Ga0495646_0008095
1017 Ga0495646_0071362
1018 Ga0495646_0187561
1019 Ga0495647_0003022
1020 Ga0495658_0000149
1021 Ga0495658_0017571
1022 Ga0495658_0044577
1023 Ga0495658_0059638
1024 Ga0495613_0002462
1025 Ga0495613_0007620
1026 Ga0495613_0019064
1027 Ga0495624_0023223
1028 Ga0495624_0026778
1029 Ga0495624_0104593
1030 Ga0495600_0055747
1031 Ga0495600_0128675
1032 Ga0495600_0231467
1033 Ga0495600_0231649
1034 Ga0495581_0000900
1035 Ga0495581_0021505
1036 Ga0495604_0000019
1037 Ga0495604_0000194
1038 Ga0495604_0105060
1039 Ga0495604_0175438
1040 Ga0495604_0276915
1041 Ga0495674_0015705
1042 Ga0495674_0019031
1043 Ga0495674_0024937
1044 Ga0495674_0066636
1045 Ga0495674_0078544
1046 Ga0495674_0338473
1047 Ga0495676_0001858
1048 Ga0495676_0113726
1049 Ga0495676_0116853
1050 Ga0495676_0133919
1051 Ga0495680_0001661
1052 Ga0495680_0002927
1053 Ga0495680_0027260
1054 Ga0495680_0053584
1055 Ga0495680_0064483
1056 Ga0495680_0075254
1057 Ga0495680_0097218
1058 Ga0495675_0000029
1059 Ga0495684_0010365
1060 Ga0495684_0044227
1061 Ga0495684_0047784
1062 Ga0495593_0000750
1063 Ga0495593_0038252
1064 Ga0495602_0000741
1065 Ga0495602_0044523
1066 Ga0495602_0086379
1067 Ga0495602_0226180
1068 Ga0495614_0001705
1069 Ga0495614_0002889
1070 Ga0495614_0025227
1071 Ga0496100_0023490
1072 Ga0496102_0174908
1073 Ga0496103_0289586
1074 Ga0496104_0025508
1075 Ga0496104_0029797
1076 Ga0496104_0149395
1077 Ga0496104_0192358
1078 Ga0496105_0002189
1079 Ga0496105_0013935
1080 Ga0496106_0005421
1081 Ga0496106_0007960
1082 Ga0496106_0064804
1083 Ga0496108_0006809
1084 Ga0496108_0038294
1085 Ga0496109_0004307
1086 Ga0496109_0020876
1087 Ga0496109_0811175
1088 Ga0496110_0000970
1089 Ga0496110_0012177
1090 Ga0496110_0052905
1091 Ga0496110_0121100
1092 Ga0496110_0163604
1093 Ga0496110_0167814
1094 Ga0496111_0002051
1095 Ga0496111_0065565
1096 Ga0496111_0280125
1097 Ga0496112_0006882
1098 Ga0496112_0014169
1099 Ga0496112_0067391
1100 Ga0496112_0068703
1101 Ga0496112_0071821
1102 Ga0496112_0204075
1103 Ga0496112_0211145
1104 Ga0496113_0008476
1105 Ga0496113_0060115
1106 Ga0496113_0073471
1107 Ga0496113_0159916
1108 Ga0496114_0005225
1109 Ga0496114_0076244
1110 Ga0496115_0009386
1111 Ga0496115_0025593
1112 Ga0496115_0340776
1113 Ga0501041_0074476
1114 Ga0501043_0335532
1115 Ga0501046_0023635
1116 Ga0501047_0035997
1117 Ga0501047_0097518
1118 Ga0501067_0011371
1119 Ga0501069_0007840
1120 Ga0501069_0015309
1121 Ga0501070_0002407
1122 Ga0501070_0015806
1123 Ga0501072_0003796
1124 Ga0501073_0041383
1125 Ga0501074_0003122
1126 Ga0501074_0003478
1127 Ga0501074_0046635
1128 Ga0501074_0296729
1129 Ga0501079_0051760
1130 Ga0501080_0011497
1131 Ga0501080_0019295
1132 Ga0501080_0240149
1133 Ga0501081_0397569
1134 Ga0501083_0000442
1135 nmdc:mga08x19_68103_c1
1136 Ga0495601_0000082
1137 Ga0495601_0001051
1138 Ga0495601_0006082
1139 Ga0495601_0007828
1140 Ga0495601_0099983
1141 Ga0495601_0162291
1142 Ga0495612_0000412
1143 Ga0495612_0026622
1144 Ga0495612_0047789
1145 Ga0495595_0006938
1146 Ga0495595_0014501
1147 Ga0495595_0125392
1148 Ga0495595_0144205
1149 Ga0495619_0000901
1150 Ga0495619_0004401
1151 Ga0495619_0011606
1152 Ga0495619_0016589
1153 Ga0495619_0018500
1154 Ga0495619_0023764
1155 Ga0495619_0036400
1156 Ga0495619_0051144
1157 Ga0466962_0000979
1158 Ga0466962_0001028
1159 Ga0466962_0002528
1160 Ga0466962_0005923
1161 Ga0466962_0017151
1162 Ga0466962_0038683

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

174

251

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4w9z-assembly1.cif.gz_A crystal structure of the periplasmic domain of subunit ii of cytochrome oxidase (coxb) of bradyrhizobium japonicum 0.9071 143 263
1cyx-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii with engineered cu-a binding site)(cyoa) 0.9023 147 258
1cyw-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii) (cyoa) 0.8989 147 258
2yev-assembly2.cif.gz_B structure of caa3-type cytochrome oxidase 0.8962 48 254
4txv-assembly2.cif.gz_D crystal structure of the mixed disulfide intermediate between thioredoxin-like tlpas(c110s) and subunit ii of cytochrome c oxidase coxbpd (c233s) 0.8876 143 264
ID Description Score Start End Superfamily
2yevE02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.916 144 256 2.60.40.420
af_Q2FZJ9_108_266_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9092 144 258 2.60.40.420
3hb3B01 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9034 144 260 2.60.40.420
af_A0A1D6ED90_406_498_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.896 172 255 2.60.40.420
4txvD00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8876 143 264 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A355BYQ2-F1-model_v4 cytochrome-c oxidase (EC 7.1.1.9) 0.9323 150 264 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A1F8JDM8-F1-model_v4 deleted 0.9294 149 258
AF-A0A2M7PUM5-F1-model_v4 Cytochrome c oxidase subunit II 0.9229 144 255 GO:0004129
GO:0005507
GO:0016020
GO:0020037
GO:0042773
AF-A0A2E8WUX5-F1-model_v4 Cytochrome c oxidase subunit II 0.9193 143 257 GO:0004129
GO:0005507
GO:0016020
GO:0020037
GO:0042773
AF-A0A8A5SUA7-F1-model_v4 cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome c oxidase polypeptide II) 0.9181 151 262 GO:0004129
GO:0005507
GO:0031966
GO:0042773

Map