F466047
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 581 | 189 | 1162 | 283 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100282498|Ga0070714_1002824981 |
| Length | 303 |
| Sequence | MASEPSTAGPPPTDSTSHGLRVVVAWLVVSAIATPLVAIYVGPLIPPGNASVEGQGQVFDNQVMTAFVTPILVLLAIFFAYGLIQFRARRNEAVLDGPPLRNDGRIQLLWIVITTTMVLFLAGFGTYELLKDGAGGGQGPNPIALPAHHQDAYQVQVIAQQWQFTYRYPSLGGVESNQLVLPADTDVELHVTSLDVVHGFWAVELGVKADANPGVDNVAYVETKSPTVFHVRCAELCGLWHGYMYNNGRVVDSTQFRSWAAQQEKLYAAIKPFMNKAPDQGGAPYAHSYLPAPGGGSPQVRAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 19 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 20 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 25 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 34 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 35 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 36 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 37 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 38 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 39 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 57 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 58 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 59 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 60 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 61 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 62 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 63 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 64 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 65 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 66 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 67 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 68 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 69 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 70 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 71 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 72 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 73 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 74 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 75 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 76 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 77 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 78 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 79 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 80 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 81 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 82 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 83 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 84 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 85 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 86 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 87 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 88 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 89 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 90 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 91 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 92 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 93 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 94 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 95 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 96 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 97 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 98 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 99 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 100 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 101 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 102 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 103 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 104 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 105 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 106 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 107 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 108 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 109 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 110 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 111 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 112 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 158 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 159 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 160 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 161 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 162 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 165 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 166 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 167 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 168 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 169 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 170 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.8 |
| Metatranscriptomes | 1.2 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.4 |
| Rhizosphere | 92.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070714_100282498 | 3300005435 | Bacteria | 1542 |
| 2 | Ga0070658_10012569 | 3300005327 | Bacteria | 6790 |
| 3 | Ga0070683_100016847 | 3300005329 | Bacteria | 6447 |
| 4 | Ga0070683_100017716 | 3300005329 | Bacteria | 6294 |
| 5 | Ga0070683_100230299 | 3300005329 | Unclassified | 1762 |
| 6 | Ga0070680_100043656 | 3300005336 | Bacteria | 3641 |
| 7 | Ga0070680_100230576 | 3300005336 | Bacteria | 1564 |
| 8 | Ga0070682_100089022 | 3300005337 | Unclassified | 2015 |
| 9 | Ga0070660_100003251 | 3300005339 | Bacteria | 11151 |
| 10 | Ga0070660_100090465 | 3300005339 | Bacteria | 2413 |
| 11 | Ga0070691_10021406 | 3300005341 | Bacteria | 2992 |
| 12 | Ga0070659_100060113 | 3300005366 | Bacteria | 3002 |
| 13 | Ga0070709_10046911 | 3300005434 | Bacteria | 2689 |
| 14 | Ga0070709_10067471 | 3300005434 | Unclassified | 2297 |
| 15 | Ga0070709_10069522 | 3300005434 | Bacteria | 2268 |
| 16 | Ga0070709_10093611 | 3300005434 | Bacteria | 1986 |
| 17 | Ga0070709_10252568 | 3300005434 | Bacteria | 1271 |
| 18 | Ga0070714_100010935 | 3300005435 | Bacteria | 7187 |
| 19 | Ga0070714_100014158 | 3300005435 | Bacteria | 6405 |
| 20 | Ga0070714_100021402 | 3300005435 | Bacteria | 5292 |
| 21 | Ga0070714_100027718 | 3300005435 | Bacteria | 4693 |
| 22 | Ga0070714_100050503 | 3300005435 | Bacteria | 3543 |
| 23 | Ga0070714_100072759 | 3300005435 | Bacteria | 2976 |
| 24 | Ga0070714_100188621 | 3300005435 | Unclassified | 1880 |
| 25 | Ga0070714_100258762 | 3300005435 | Bacteria | 1611 |
| 26 | Ga0070713_100004631 | 3300005436 | Bacteria | 9274 |
| 27 | Ga0070713_100007202 | 3300005436 | Bacteria | 7785 |
| 28 | Ga0070713_100094806 | 3300005436 | Bacteria | 2574 |
| 29 | Ga0070713_100472911 | 3300005436 | Unclassified | 1180 |
| 30 | Ga0070710_10007692 | 3300005437 | Bacteria | 5225 |
| 31 | Ga0070710_10028333 | 3300005437 | Bacteria | 2995 |
| 32 | Ga0070710_10313124 | 3300005437 | Bacteria | 1028 |
| 33 | Ga0070711_100085427 | 3300005439 | Bacteria | 2260 |
| 34 | Ga0070708_100239126 | 3300005445 | Unclassified | 1705 |
| 35 | Ga0070681_10008810 | 3300005458 | Bacteria | 9905 |
| 36 | Ga0070681_10167494 | 3300005458 | Bacteria | 2119 |
| 37 | Ga0070707_100000445 | 3300005468 | Bacteria | 40989 |
| 38 | Ga0070707_100108570 | 3300005468 | Bacteria | 2692 |
| 39 | Ga0070707_100299111 | 3300005468 | Unclassified | 1564 |
| 40 | Ga0070679_100027534 | 3300005530 | Bacteria | 5596 |
| 41 | Ga0070679_100117228 | 3300005530 | Bacteria | 2648 |
| 42 | Ga0070679_100118710 | 3300005530 | Bacteria | 2630 |
| 43 | Ga0070684_100008226 | 3300005535 | Bacteria | 8151 |
| 44 | Ga0068855_100015736 | 3300005563 | Bacteria | 9099 |
| 45 | Ga0068856_100009230 | 3300005614 | Bacteria | 9593 |
| 46 | Ga0070717_10001383 | 3300006028 | Bacteria | 16698 |
| 47 | Ga0070717_10016886 | 3300006028 | Bacteria | 5667 |
| 48 | Ga0070717_10027281 | 3300006028 | Bacteria | 4564 |
| 49 | Ga0070717_10043441 | 3300006028 | Bacteria | 3668 |
| 50 | Ga0070717_10114565 | 3300006028 | Bacteria | 2303 |
| 51 | Ga0070715_10000206 | 3300006163 | Bacteria | 13864 |
| 52 | Ga0070716_100001775 | 3300006173 | Bacteria | 9763 |
| 53 | Ga0070716_100270063 | 3300006173 | Bacteria | 1168 |
| 54 | Ga0070712_100008799 | 3300006175 | Bacteria | 6357 |
| 55 | Ga0075436_100150345 | 3300006914 | Bacteria | 1638 |
| 56 | Ga0105240_10280904 | 3300009093 | Bacteria | 1912 |
| 57 | Ga0105240_10420847 | 3300009093 | Bacteria | 1501 |
| 58 | Ga0105241_10455230 | 3300009174 | Bacteria | 1133 |
| 59 | Ga0105241_10524945 | 3300009174 | Bacteria | 1059 |
| 60 | Ga0105237_10006254 | 3300009545 | Bacteria | 13254 |
| 61 | Ga0105237_10056066 | 3300009545 | Bacteria | 3945 |
| 62 | Ga0105238_10018870 | 3300009551 | Bacteria | 7021 |
| 63 | Ga0157370_10072644 | 3300013104 | Bacteria | 3245 |
| 64 | Ga0157369_10003395 | 3300013105 | Bacteria | 18891 |
| 65 | Ga0157369_10003872 | 3300013105 | Bacteria | 17775 |
| 66 | Ga0157369_10016029 | 3300013105 | Bacteria | 8433 |
| 67 | Ga0157369_10027514 | 3300013105 | Bacteria | 6302 |
| 68 | Ga0157369_10036119 | 3300013105 | Bacteria | 5416 |
| 69 | Ga0157374_10070638 | 3300013296 | Bacteria | 3291 |
| 70 | Ga0157374_10499886 | 3300013296 | Bacteria | 1220 |
| 71 | Ga0157372_10034070 | 3300013307 | Bacteria | 5596 |
| 72 | Ga0182008_10068705 | 3300014497 | Bacteria | 1743 |
| 73 | Ga0182008_10167561 | 3300014497 | Bacteria | 1108 |
| 74 | Ga0197907_10665034 | 3300020069 | Bacteria | 2009 |
| 75 | Ga0206356_11250198 | 3300020070 | Bacteria | 1853 |
| 76 | Ga0206356_11468005 | 3300020070 | Bacteria | 1064 |
| 77 | Ga0206355_1603386 | 3300020076 | Unclassified | 1485 |
| 78 | Ga0206353_11140038 | 3300020082 | Bacteria | 5979 |
| 79 | Ga0224712_10001598 | 3300022467 | Bacteria | 5308 |
| 80 | Ga0224712_10023150 | 3300022467 | Unclassified | 2152 |
| 81 | Ga0207699_10039611 | 3300025906 | Bacteria | 2709 |
| 82 | Ga0207699_10044460 | 3300025906 | Bacteria | 2586 |
| 83 | Ga0207699_10078389 | 3300025906 | Unclassified | 2040 |
| 84 | Ga0207705_10028060 | 3300025909 | Bacteria | 4013 |
| 85 | Ga0207707_10016175 | 3300025912 | Bacteria | 6509 |
| 86 | Ga0207707_10387726 | 3300025912 | Bacteria | 1200 |
| 87 | Ga0207695_10087217 | 3300025913 | Bacteria | 3144 |
| 88 | Ga0207695_10173356 | 3300025913 | Unclassified | 2081 |
| 89 | Ga0207695_10195276 | 3300025913 | Bacteria | 1940 |
| 90 | Ga0207671_10109252 | 3300025914 | Bacteria | 2102 |
| 91 | Ga0207693_10006828 | 3300025915 | Bacteria | 9428 |
| 92 | Ga0207693_10014121 | 3300025915 | Bacteria | 6431 |
| 93 | Ga0207663_10055545 | 3300025916 | Bacteria | 2485 |
| 94 | Ga0207663_10092870 | 3300025916 | Bacteria | 2007 |
| 95 | Ga0207660_10180742 | 3300025917 | Bacteria | 1638 |
| 96 | Ga0207657_10019430 | 3300025919 | Bacteria | 6452 |
| 97 | Ga0207657_10118159 | 3300025919 | Bacteria | 2183 |
| 98 | Ga0207652_10086255 | 3300025921 | Bacteria | 2752 |
| 99 | Ga0207652_10429111 | 3300025921 | Unclassified | 1192 |
| 100 | Ga0207646_10001908 | 3300025922 | Bacteria | 25106 |
| 101 | Ga0207646_10184016 | 3300025922 | Bacteria | 1887 |
| 102 | Ga0207700_10039956 | 3300025928 | Bacteria | 3420 |
| 103 | Ga0207700_10062066 | 3300025928 | Bacteria | 2837 |
| 104 | Ga0207700_10178701 | 3300025928 | Bacteria | 1775 |
| 105 | Ga0207664_10004541 | 3300025929 | Bacteria | 9408 |
| 106 | Ga0207664_10025574 | 3300025929 | Bacteria | 4451 |
| 107 | Ga0207664_10073204 | 3300025929 | Bacteria | 2764 |
| 108 | Ga0207664_10119335 | 3300025929 | Bacteria | 2205 |
| 109 | Ga0207664_10134009 | 3300025929 | Bacteria | 2088 |
| 110 | Ga0207664_10145380 | 3300025929 | Bacteria | 2010 |
| 111 | Ga0207664_10180819 | 3300025929 | Bacteria | 1810 |
| 112 | Ga0207664_10309208 | 3300025929 | Bacteria | 1392 |
| 113 | Ga0207665_10001018 | 3300025939 | Bacteria | 18916 |
| 114 | Ga0207665_10186834 | 3300025939 | Unclassified | 1504 |
| 115 | Ga0207661_10009909 | 3300025944 | Bacteria | 6843 |
| 116 | Ga0207661_10021891 | 3300025944 | Bacteria | 4799 |
| 117 | Ga0207667_10092945 | 3300025949 | Bacteria | 3115 |
| 118 | Ga0207702_10028533 | 3300026078 | Bacteria | 4639 |
| 119 | Ga0265337_1018407 | 3300028556 | Unclassified | 2220 |
| 120 | Ga0265319_1005383 | 3300028563 | Bacteria | 6131 |
| 121 | Ga0265319_1028836 | 3300028563 | Bacteria | 1953 |
| 122 | Ga0265334_10000492 | 3300028573 | Bacteria | 20354 |
| 123 | Ga0265334_10017657 | 3300028573 | Bacteria | 2943 |
| 124 | Ga0265334_10022701 | 3300028573 | Bacteria | 2554 |
| 125 | Ga0265334_10026718 | 3300028573 | Bacteria | 2329 |
| 126 | Ga0265318_10000429 | 3300028577 | Bacteria | 31981 |
| 127 | Ga0265318_10020519 | 3300028577 | Bacteria | 2665 |
| 128 | Ga0265318_10087609 | 3300028577 | Unclassified | 1147 |
| 129 | Ga0265322_10004312 | 3300028654 | Bacteria | 4247 |
| 130 | Ga0265322_10004651 | 3300028654 | Bacteria | 4078 |
| 131 | Ga0265322_10024794 | 3300028654 | Unclassified | 1716 |
| 132 | Ga0265336_10004248 | 3300028666 | Bacteria | 5451 |
| 133 | Ga0265336_10013473 | 3300028666 | Bacteria | 2726 |
| 134 | Ga0265338_10002292 | 3300028800 | Bacteria | 29139 |
| 135 | Ga0265338_10003836 | 3300028800 | Bacteria | 20883 |
| 136 | Ga0265338_10006920 | 3300028800 | Bacteria | 14272 |
| 137 | Ga0265338_10010581 | 3300028800 | Bacteria | 10789 |
| 138 | Ga0265338_10010750 | 3300028800 | Bacteria | 10680 |
| 139 | Ga0265338_10016896 | 3300028800 | Bacteria | 7898 |
| 140 | Ga0265338_10040031 | 3300028800 | Bacteria | 4409 |
| 141 | Ga0265338_10084685 | 3300028800 | Bacteria | 2645 |
| 142 | Ga0265338_10113090 | 3300028800 | Bacteria | 2181 |
| 143 | Ga0265338_10158033 | 3300028800 | Bacteria | 1754 |
| 144 | Ga0265338_10165683 | 3300028800 | Unclassified | 1701 |
| 145 | Ga0265338_10348960 | 3300028800 | Bacteria | 1064 |
| 146 | Ga0265330_10000760 | 3300031235 | Bacteria | 20237 |
| 147 | Ga0265330_10018953 | 3300031235 | Bacteria | 3158 |
| 148 | Ga0265330_10131065 | 3300031235 | Unclassified | 1067 |
| 149 | Ga0265332_10003620 | 3300031238 | Bacteria | 7404 |
| 150 | Ga0265328_10000357 | 3300031239 | Bacteria | 21493 |
| 151 | Ga0265320_10005108 | 3300031240 | Bacteria | 8478 |
| 152 | Ga0265320_10028937 | 3300031240 | Bacteria | 2872 |
| 153 | Ga0265320_10048354 | 3300031240 | Bacteria | 2076 |
| 154 | Ga0265325_10027491 | 3300031241 | Bacteria | 3075 |
| 155 | Ga0265325_10044198 | 3300031241 | Bacteria | 2321 |
| 156 | Ga0265325_10097517 | 3300031241 | Bacteria | 1443 |
| 157 | Ga0265329_10009037 | 3300031242 | Bacteria | 3741 |
| 158 | Ga0265340_10068574 | 3300031247 | Bacteria | 1684 |
| 159 | Ga0265340_10078370 | 3300031247 | Unclassified | 1558 |
| 160 | Ga0265340_10082319 | 3300031247 | Unclassified | 1514 |
| 161 | Ga0265339_10012774 | 3300031249 | Bacteria | 5106 |
| 162 | Ga0265339_10026012 | 3300031249 | Bacteria | 3354 |
| 163 | Ga0265339_10103420 | 3300031249 | Bacteria | 1479 |
| 164 | Ga0265327_10003298 | 3300031251 | Bacteria | 15633 |
| 165 | Ga0265327_10022747 | 3300031251 | Bacteria | 3735 |
| 166 | Ga0265327_10066912 | 3300031251 | Bacteria | 1811 |
| 167 | Ga0265316_10023216 | 3300031344 | Bacteria | 5215 |
| 168 | Ga0265316_10026314 | 3300031344 | Bacteria | 4841 |
| 169 | Ga0265316_10027658 | 3300031344 | Bacteria | 4690 |
| 170 | Ga0265316_10102891 | 3300031344 | Bacteria | 2169 |
| 171 | Ga0265313_10002251 | 3300031595 | Bacteria | 16966 |
| 172 | Ga0265313_10008655 | 3300031595 | Bacteria | 6730 |
| 173 | Ga0265313_10058430 | 3300031595 | Unclassified | 1818 |
| 174 | Ga0265314_10011890 | 3300031711 | Bacteria | 7149 |
| 175 | Ga0265314_10030184 | 3300031711 | Bacteria | 4016 |
| 176 | Ga0265314_10047279 | 3300031711 | Bacteria | 3029 |
| 177 | Ga0265342_10003288 | 3300031712 | Bacteria | 13375 |
| 178 | Ga0265342_10011149 | 3300031712 | Bacteria | 6169 |
| 179 | Ga0265342_10161824 | 3300031712 | Bacteria | 1237 |
| 180 | Ga0373926_0009042 | 3300035083 | Bacteria | 3323 |
| 181 | Ga0373944_0014503 | 3300035089 | Bacteria | 2200 |
| 182 | Ga0373936_0024037 | 3300035113 | Bacteria | 2377 |
| 183 | Ga0373936_0060699 | 3300035113 | Viruses | 1543 |
| 184 | Ga0373945_0009976 | 3300035116 | Bacteria | 3121 |
| 185 | Ga0373943_0000708 | 3300035170 | Bacteria | 14561 |
| 186 | Ga0373943_0006539 | 3300035170 | Bacteria | 5233 |
| 187 | Ga0373943_0008619 | 3300035170 | Bacteria | 4572 |
| 188 | Ga0373943_0105921 | 3300035170 | Bacteria | 1477 |
| 189 | Ga0373946_0001448 | 3300035171 | Bacteria | 8253 |
| 190 | Ga0373955_0113619 | 3300035172 | Bacteria | 1568 |
| 191 | Ga0373931_0127700 | 3300035691 | Unclassified | 1460 |
| 192 | Ga0373935_0013507 | 3300035692 | Bacteria | 4927 |
| 193 | Ga0373935_0016019 | 3300035692 | Bacteria | 4537 |
| 194 | Ga0373935_0247836 | 3300035692 | Bacteria | 1246 |
| 195 | Ga0373927_0035805 | 3300035695 | Bacteria | 3229 |
| 196 | Ga0373927_0102081 | 3300035695 | Bacteria | 1866 |
| 197 | Ga0373933_0041646 | 3300035724 | Bacteria | 2712 |
| 198 | Ga0373933_0194391 | 3300035724 | Bacteria | 1297 |
| 199 | Ga0373933_0325454 | 3300035724 | Bacteria | 997 |
| 200 | Ga0373947_0002107 | 3300035725 | Bacteria | 12123 |
| 201 | Ga0373947_0018607 | 3300035725 | Bacteria | 4000 |
| 202 | Ga0373937_0000308 | 3300036401 | Bacteria | 46115 |
| 203 | Ga0373937_0035960 | 3300036401 | Bacteria | 4511 |
| 204 | Ga0373937_0097879 | 3300036401 | Bacteria | 2721 |
| 205 | Ga0373937_0385477 | 3300036401 | Bacteria | 1329 |
| 206 | Ga0373925_0001399 | 3300037068 | Bacteria | 20978 |
| 207 | Ga0373925_0002351 | 3300037068 | Bacteria | 15189 |
| 208 | Ga0373925_0201333 | 3300037068 | Unclassified | 1583 |
| 209 | Ga0395899_0160788 | 3300037312 | Bacteria | 1587 |
| 210 | Ga0395900_0009381 | 3300037418 | Bacteria | 10033 |
| 211 | Ga0395900_0054890 | 3300037418 | Bacteria | 4102 |
| 212 | Ga0395900_0060157 | 3300037418 | Bacteria | 3910 |
| 213 | Ga0395900_0850738 | 3300037418 | Bacteria | 838 |
| 214 | Ga0395898_0016031 | 3300037466 | Bacteria | 7675 |
| 215 | Ga0395898_0136990 | 3300037466 | Bacteria | 2344 |
| 216 | Ga0395898_0165685 | 3300037466 | Unclassified | 2114 |
| 217 | Ga0395901_0022593 | 3300038443 | Bacteria | 6448 |
| 218 | Ga0395901_0073857 | 3300038443 | Bacteria | 3557 |
| 219 | Ga0395901_0074427 | 3300038443 | Bacteria | 3543 |
| 220 | Ga0395901_0513298 | 3300038443 | Bacteria | 1219 |
| 221 | Ga0436365_0589664 | 3300039437 | Bacteria | 5984 |
| 222 | Ga0436362_0122452 | 3300039453 | Bacteria | 1699 |
| 223 | Ga0451807_0390771 | 3300041486 | Unclassified | 929 |
| 224 | Ga0466969_0002282 | 3300044656 | Bacteria | 10243 |
| 225 | Ga0466969_0065240 | 3300044656 | Unclassified | 1761 |
| 226 | Ga0466969_0157231 | 3300044656 | Bacteria | 1045 |
| 227 | Ga0466972_0115956 | 3300044658 | Unclassified | 1264 |
| 228 | Ga0466965_0017401 | 3300044683 | Bacteria | 3436 |
| 229 | Ga0466965_0063526 | 3300044683 | Bacteria | 1848 |
| 230 | Ga0466965_0096033 | 3300044683 | Unclassified | 1512 |
| 231 | Ga0466966_0004423 | 3300044684 | Bacteria | 9266 |
| 232 | Ga0466966_0018620 | 3300044684 | Bacteria | 4576 |
| 233 | Ga0466966_0023443 | 3300044684 | Bacteria | 4041 |
| 234 | Ga0466966_0060973 | 3300044684 | Bacteria | 2380 |
| 235 | Ga0466966_0135895 | 3300044684 | Bacteria | 1503 |
| 236 | Ga0466961_0006444 | 3300044693 | Bacteria | 7453 |
| 237 | Ga0466961_0019637 | 3300044693 | Bacteria | 4348 |
| 238 | Ga0466961_0032800 | 3300044693 | Bacteria | 3336 |
| 239 | Ga0466961_0056963 | 3300044693 | Bacteria | 2489 |
| 240 | Ga0466963_0000063 | 3300044694 | Bacteria | 36209 |
| 241 | Ga0466963_0000532 | 3300044694 | Bacteria | 17888 |
| 242 | Ga0466963_0001170 | 3300044694 | Bacteria | 13766 |
| 243 | Ga0466963_0001668 | 3300044694 | Bacteria | 12099 |
| 244 | Ga0466963_0003131 | 3300044694 | Bacteria | 9383 |
| 245 | Ga0466963_0003410 | 3300044694 | Bacteria | 9092 |
| 246 | Ga0466963_0004571 | 3300044694 | Bacteria | 8055 |
| 247 | Ga0466963_0004743 | 3300044694 | Bacteria | 7935 |
| 248 | Ga0466963_0007397 | 3300044694 | Bacteria | 6543 |
| 249 | Ga0466963_0012078 | 3300044694 | Bacteria | 5277 |
| 250 | Ga0466963_0024253 | 3300044694 | Bacteria | 3861 |
| 251 | Ga0466963_0029928 | 3300044694 | Bacteria | 3508 |
| 252 | Ga0466963_0063126 | 3300044694 | Bacteria | 2479 |
| 253 | Ga0466963_0091513 | 3300044694 | Unclassified | 2072 |
| 254 | Ga0466963_0186343 | 3300044694 | Bacteria | 1449 |
| 255 | Ga0466963_0187080 | 3300044694 | Bacteria | 1446 |
| 256 | Ga0466963_0187375 | 3300044694 | Unclassified | 1445 |
| 257 | Ga0466964_0003765 | 3300044706 | Bacteria | 5559 |
| 258 | Ga0466964_0010435 | 3300044706 | Bacteria | 3504 |
| 259 | Ga0466964_0027015 | 3300044706 | Unclassified | 2250 |
| 260 | Ga0466964_0028919 | 3300044706 | Unclassified | 2186 |
| 261 | Ga0466964_0031370 | 3300044706 | Bacteria | 2107 |
| 262 | Ga0466971_0000840 | 3300044719 | Bacteria | 12499 |
| 263 | Ga0466971_0003605 | 3300044719 | Bacteria | 6616 |
| 264 | Ga0466971_0009517 | 3300044719 | Bacteria | 4243 |
| 265 | Ga0466971_0060122 | 3300044719 | Bacteria | 1717 |
| 266 | Ga0466971_0075056 | 3300044719 | Bacteria | 1537 |
| 267 | Ga0466968_0000944 | 3300044735 | Bacteria | 10230 |
| 268 | Ga0466968_0009575 | 3300044735 | Bacteria | 3729 |
| 269 | Ga0466968_0079911 | 3300044735 | Unclassified | 1435 |
| 270 | Ga0466968_0101809 | 3300044735 | Bacteria | 1283 |
| 271 | Ga0466970_0007339 | 3300044765 | Bacteria | 5522 |
| 272 | Ga0466970_0131864 | 3300044765 | Unclassified | 1373 |
| 273 | Ga0466957_0002652 | 3300044842 | Bacteria | 9652 |
| 274 | Ga0466957_0004191 | 3300044842 | Bacteria | 7991 |
| 275 | Ga0466957_0007463 | 3300044842 | Bacteria | 6175 |
| 276 | Ga0466957_0013908 | 3300044842 | Bacteria | 4679 |
| 277 | Ga0466957_0018542 | 3300044842 | Bacteria | 4087 |
| 278 | Ga0466957_0018954 | 3300044842 | Bacteria | 4045 |
| 279 | Ga0466957_0025484 | 3300044842 | Bacteria | 3506 |
| 280 | Ga0466957_0034001 | 3300044842 | Bacteria | 3058 |
| 281 | Ga0466960_0015030 | 3300044901 | Bacteria | 3330 |
| 282 | Ga0466960_0061465 | 3300044901 | Unclassified | 1844 |
| 283 | Ga0466959_0007814 | 3300045049 | Bacteria | 7526 |
| 284 | Ga0466959_0010769 | 3300045049 | Bacteria | 6552 |
| 285 | Ga0466959_0021405 | 3300045049 | Bacteria | 4768 |
| 286 | Ga0466959_0053854 | 3300045049 | Bacteria | 2941 |
| 287 | Ga0466959_0054051 | 3300045049 | Bacteria | 2935 |
| 288 | Ga0466959_0097358 | 3300045049 | Unclassified | 2109 |
| 289 | Ga0466959_0105001 | 3300045049 | Unclassified | 2020 |
| 290 | Ga0466959_0199443 | 3300045049 | Bacteria | 1394 |
| 291 | Ga0466959_0210209 | 3300045049 | Unclassified | 1352 |
| 292 | Ga0466958_0001030 | 3300045836 | Bacteria | 12726 |
| 293 | Ga0466958_0001870 | 3300045836 | Bacteria | 10285 |
| 294 | Ga0466958_0008049 | 3300045836 | Bacteria | 5829 |
| 295 | Ga0466958_0011598 | 3300045836 | Bacteria | 4967 |
| 296 | Ga0466958_0015206 | 3300045836 | Bacteria | 4406 |
| 297 | Ga0466958_0015349 | 3300045836 | Bacteria | 4388 |
| 298 | Ga0466958_0017512 | 3300045836 | Bacteria | 4144 |
| 299 | Ga0466958_0057330 | 3300045836 | Bacteria | 2367 |
| 300 | Ga0466958_0085768 | 3300045836 | Unclassified | 1942 |
| 301 | Ga0466958_0096346 | 3300045836 | Unclassified | 1835 |
| 302 | Ga0466958_0103270 | 3300045836 | Bacteria | 1774 |
| 303 | Ga0466958_0171408 | 3300045836 | Unclassified | 1374 |
| 304 | Ga0466967_0000058 | 3300045976 | Bacteria | 40166 |
| 305 | Ga0466967_0005619 | 3300045976 | Bacteria | 8722 |
| 306 | Ga0466967_0005902 | 3300045976 | Bacteria | 8583 |
| 307 | Ga0466967_0007306 | 3300045976 | Bacteria | 7955 |
| 308 | Ga0466967_0010600 | 3300045976 | Bacteria | 6924 |
| 309 | Ga0466967_0018957 | 3300045976 | Bacteria | 5519 |
| 310 | Ga0466967_0033953 | 3300045976 | Bacteria | 4324 |
| 311 | Ga0466967_0052036 | 3300045976 | Bacteria | 3592 |
| 312 | Ga0466967_0075160 | 3300045976 | Bacteria | 3036 |
| 313 | Ga0466967_0075935 | 3300045976 | Bacteria | 3021 |
| 314 | Ga0466967_0100637 | 3300045976 | Bacteria | 2641 |
| 315 | Ga0466967_0115665 | 3300045976 | Bacteria | 2470 |
| 316 | Ga0466967_0133570 | 3300045976 | Bacteria | 2306 |
| 317 | Ga0466967_0147083 | 3300045976 | Bacteria | 2198 |
| 318 | Ga0466967_0149880 | 3300045976 | Unclassified | 2179 |
| 319 | Ga0466967_0165237 | 3300045976 | Bacteria | 2079 |
| 320 | Ga0466967_0176197 | 3300045976 | Bacteria | 2014 |
| 321 | Ga0466967_0193063 | 3300045976 | Unclassified | 1925 |
| 322 | Ga0466967_0257857 | 3300045976 | Unclassified | 1667 |
| 323 | Ga0466967_0375600 | 3300045976 | Bacteria | 1379 |
| 324 | Ga0466967_0618783 | 3300045976 | Bacteria | 1069 |
| 325 | Ga0495592_0000410 | 3300046454 | Bacteria | 32753 |
| 326 | Ga0495592_0004998 | 3300046454 | Bacteria | 9763 |
| 327 | Ga0495592_0288306 | 3300046454 | Unclassified | 1071 |
| 328 | Ga0495603_0011158 | 3300046455 | Bacteria | 5447 |
| 329 | Ga0495603_0025944 | 3300046455 | Bacteria | 3543 |
| 330 | Ga0495603_0197299 | 3300046455 | Unclassified | 1163 |
| 331 | Ga0495603_0252781 | 3300046455 | Bacteria | 1015 |
| 332 | Ga0495629_0000783 | 3300046459 | Bacteria | 25631 |
| 333 | Ga0495629_0036254 | 3300046459 | Bacteria | 3483 |
| 334 | Ga0495629_0041851 | 3300046459 | Bacteria | 3221 |
| 335 | Ga0495629_0054285 | 3300046459 | Bacteria | 2802 |
| 336 | Ga0495629_0215087 | 3300046459 | Bacteria | 1327 |
| 337 | Ga0495641_0000421 | 3300046461 | Bacteria | 35438 |
| 338 | Ga0495641_0007071 | 3300046461 | Bacteria | 7106 |
| 339 | Ga0495641_0010830 | 3300046461 | Bacteria | 5244 |
| 340 | Ga0495641_0013433 | 3300046461 | Bacteria | 4501 |
| 341 | Ga0495651_0000034 | 3300046462 | Bacteria | 99213 |
| 342 | Ga0495651_0001663 | 3300046462 | Bacteria | 17191 |
| 343 | Ga0495651_0014439 | 3300046462 | Bacteria | 6105 |
| 344 | Ga0495651_0061046 | 3300046462 | Bacteria | 2886 |
| 345 | Ga0495651_0082424 | 3300046462 | Unclassified | 2427 |
| 346 | Ga0495651_0206824 | 3300046462 | Bacteria | 1369 |
| 347 | Ga0495653_0021748 | 3300046463 | Bacteria | 5193 |
| 348 | Ga0495653_0034515 | 3300046463 | Bacteria | 4000 |
| 349 | Ga0495653_0056787 | 3300046463 | Bacteria | 2982 |
| 350 | Ga0495653_0125872 | 3300046463 | Bacteria | 1820 |
| 351 | Ga0495653_0215329 | 3300046463 | Unclassified | 1295 |
| 352 | Ga0495582_0000139 | 3300046473 | Bacteria | 39203 |
| 353 | Ga0495582_0010406 | 3300046473 | Bacteria | 5116 |
| 354 | Ga0495582_0023286 | 3300046473 | Bacteria | 3389 |
| 355 | Ga0495582_0053760 | 3300046473 | Bacteria | 2221 |
| 356 | Ga0495582_0167320 | 3300046473 | Unclassified | 1251 |
| 357 | Ga0495639_0000166 | 3300046475 | Bacteria | 34551 |
| 358 | Ga0495639_0004561 | 3300046475 | Bacteria | 5938 |
| 359 | Ga0495662_0000341 | 3300046476 | Bacteria | 20401 |
| 360 | Ga0495664_0023533 | 3300046477 | Bacteria | 3575 |
| 361 | Ga0495664_0030358 | 3300046477 | Bacteria | 3166 |
| 362 | Ga0495664_0055691 | 3300046477 | Bacteria | 2353 |
| 363 | Ga0495608_0000638 | 3300046511 | Bacteria | 24128 |
| 364 | Ga0495608_0009815 | 3300046511 | Bacteria | 6682 |
| 365 | Ga0495608_0040572 | 3300046511 | Bacteria | 3118 |
| 366 | Ga0495608_0074913 | 3300046511 | Bacteria | 2206 |
| 367 | Ga0495618_0002873 | 3300046514 | Bacteria | 10921 |
| 368 | Ga0495618_0005628 | 3300046514 | Bacteria | 7617 |
| 369 | Ga0495618_0049437 | 3300046514 | Bacteria | 2655 |
| 370 | Ga0495618_0171628 | 3300046514 | Bacteria | 1380 |
| 371 | Ga0495628_0000184 | 3300046516 | Bacteria | 54832 |
| 372 | Ga0495628_0005773 | 3300046516 | Bacteria | 10845 |
| 373 | Ga0495628_0096398 | 3300046516 | Bacteria | 2285 |
| 374 | Ga0495628_0112549 | 3300046516 | Bacteria | 2092 |
| 375 | Ga0495628_0148407 | 3300046516 | Unclassified | 1787 |
| 376 | Ga0495628_0277636 | 3300046516 | Bacteria | 1245 |
| 377 | Ga0495628_0385659 | 3300046516 | Unclassified | 1025 |
| 378 | Ga0495630_0002629 | 3300046517 | Bacteria | 12438 |
| 379 | Ga0495630_0003040 | 3300046517 | Bacteria | 11642 |
| 380 | Ga0495630_0007473 | 3300046517 | Bacteria | 7809 |
| 381 | Ga0495630_0016688 | 3300046517 | Bacteria | 5369 |
| 382 | Ga0495630_0060049 | 3300046517 | Bacteria | 2853 |
| 383 | Ga0495630_0061020 | 3300046517 | Bacteria | 2831 |
| 384 | Ga0495630_0067142 | 3300046517 | Bacteria | 2695 |
| 385 | Ga0495666_0049517 | 3300046526 | Viruses | 2021 |
| 386 | Ga0495652_0000319 | 3300046529 | Bacteria | 56845 |
| 387 | Ga0495652_0018524 | 3300046529 | Bacteria | 6207 |
| 388 | Ga0495652_0060510 | 3300046529 | Bacteria | 3200 |
| 389 | Ga0495665_0000480 | 3300046531 | Bacteria | 20086 |
| 390 | Ga0495665_0003054 | 3300046531 | Bacteria | 9046 |
| 391 | Ga0495640_0007089 | 3300046533 | Bacteria | 8819 |
| 392 | Ga0495586_0006570 | 3300046535 | Bacteria | 6213 |
| 393 | Ga0495587_0000055 | 3300046536 | Bacteria | 97024 |
| 394 | Ga0495587_0002592 | 3300046536 | Bacteria | 12074 |
| 395 | Ga0495587_0032097 | 3300046536 | Bacteria | 3177 |
| 396 | Ga0495587_0108855 | 3300046536 | Unclassified | 1593 |
| 397 | Ga0495587_0109056 | 3300046536 | Bacteria | 1591 |
| 398 | Ga0495645_0000170 | 3300046543 | Bacteria | 45455 |
| 399 | Ga0495645_0013468 | 3300046543 | Bacteria | 5782 |
| 400 | Ga0495645_0015728 | 3300046543 | Bacteria | 5386 |
| 401 | Ga0495645_0035610 | 3300046543 | Bacteria | 3628 |
| 402 | Ga0495645_0052364 | 3300046543 | Bacteria | 2970 |
| 403 | Ga0495645_0185589 | 3300046543 | Unclassified | 1421 |
| 404 | Ga0495645_0263809 | 3300046543 | Bacteria | 1139 |
| 405 | Ga0495667_0040483 | 3300046559 | Bacteria | 3094 |
| 406 | Ga0495667_0074754 | 3300046559 | Bacteria | 2206 |
| 407 | Ga0495667_0095005 | 3300046559 | Bacteria | 1930 |
| 408 | Ga0495667_0116701 | 3300046559 | Bacteria | 1724 |
| 409 | Ga0495667_0138400 | 3300046559 | Bacteria | 1569 |
| 410 | Ga0495634_0001802 | 3300046642 | Bacteria | 18504 |
| 411 | Ga0495634_0002962 | 3300046642 | Bacteria | 13857 |
| 412 | Ga0495634_0024046 | 3300046642 | Bacteria | 4278 |
| 413 | Ga0495634_0024882 | 3300046642 | Bacteria | 4197 |
| 414 | Ga0495634_0034030 | 3300046642 | Bacteria | 3497 |
| 415 | Ga0495634_0034790 | 3300046642 | Bacteria | 3454 |
| 416 | Ga0495634_0091635 | 3300046642 | Bacteria | 1973 |
| 417 | Ga0495635_0005146 | 3300046663 | Bacteria | 9104 |
| 418 | Ga0495635_0009812 | 3300046663 | Bacteria | 6695 |
| 419 | Ga0495635_0039758 | 3300046663 | Bacteria | 3253 |
| 420 | Ga0495635_0053555 | 3300046663 | Bacteria | 2780 |
| 421 | Ga0495635_0054820 | 3300046663 | Bacteria | 2746 |
| 422 | Ga0495635_0061115 | 3300046663 | Bacteria | 2588 |
| 423 | Ga0495635_0094532 | 3300046663 | Bacteria | 2043 |
| 424 | Ga0495588_0187710 | 3300046674 | Bacteria | 1092 |
| 425 | Ga0495657_0008362 | 3300046675 | Bacteria | 7925 |
| 426 | Ga0495657_0041983 | 3300046675 | Bacteria | 3126 |
| 427 | Ga0495657_0045150 | 3300046675 | Bacteria | 2992 |
| 428 | Ga0495657_0100708 | 3300046675 | Bacteria | 1841 |
| 429 | Ga0495657_0105235 | 3300046675 | Bacteria | 1793 |
| 430 | Ga0495657_0124920 | 3300046675 | Bacteria | 1617 |
| 431 | Ga0495599_0001220 | 3300046678 | Bacteria | 14572 |
| 432 | Ga0495599_0047059 | 3300046678 | Bacteria | 2704 |
| 433 | Ga0495623_0000149 | 3300046679 | Bacteria | 42958 |
| 434 | Ga0495623_0024677 | 3300046679 | Bacteria | 3871 |
| 435 | Ga0495646_0008095 | 3300046680 | Bacteria | 6684 |
| 436 | Ga0495646_0071362 | 3300046680 | Bacteria | 2043 |
| 437 | Ga0495646_0187561 | 3300046680 | Bacteria | 1132 |
| 438 | Ga0495647_0003022 | 3300046681 | Bacteria | 5355 |
| 439 | Ga0495658_0000149 | 3300046683 | Bacteria | 39059 |
| 440 | Ga0495658_0017571 | 3300046683 | Bacteria | 3698 |
| 441 | Ga0495658_0044577 | 3300046683 | Unclassified | 2486 |
| 442 | Ga0495658_0059638 | 3300046683 | Unclassified | 2186 |
| 443 | Ga0495613_0002462 | 3300046689 | Bacteria | 13954 |
| 444 | Ga0495613_0007620 | 3300046689 | Bacteria | 8050 |
| 445 | Ga0495613_0019064 | 3300046689 | Bacteria | 5113 |
| 446 | Ga0495624_0023223 | 3300046690 | Bacteria | 4091 |
| 447 | Ga0495624_0026778 | 3300046690 | Bacteria | 3778 |
| 448 | Ga0495624_0104593 | 3300046690 | Bacteria | 1742 |
| 449 | Ga0495600_0055747 | 3300046809 | Bacteria | 2581 |
| 450 | Ga0495600_0128675 | 3300046809 | Unclassified | 1646 |
| 451 | Ga0495600_0231467 | 3300046809 | Bacteria | 1180 |
| 452 | Ga0495600_0231649 | 3300046809 | Bacteria | 1179 |
| 453 | Ga0495581_0000900 | 3300047315 | Bacteria | 15923 |
| 454 | Ga0495581_0021505 | 3300047315 | Bacteria | 3738 |
| 455 | Ga0495604_0000019 | 3300047317 | Bacteria | 175064 |
| 456 | Ga0495604_0000194 | 3300047317 | Bacteria | 54877 |
| 457 | Ga0495604_0105060 | 3300047317 | Bacteria | 2068 |
| 458 | Ga0495604_0175438 | 3300047317 | Bacteria | 1503 |
| 459 | Ga0495604_0276915 | 3300047317 | Bacteria | 1135 |
| 460 | Ga0495674_0015705 | 3300047319 | Bacteria | 7068 |
| 461 | Ga0495674_0019031 | 3300047319 | Bacteria | 6384 |
| 462 | Ga0495674_0024937 | 3300047319 | Bacteria | 5488 |
| 463 | Ga0495674_0066636 | 3300047319 | Bacteria | 3123 |
| 464 | Ga0495674_0078544 | 3300047319 | Bacteria | 2835 |
| 465 | Ga0495674_0338473 | 3300047319 | Unclassified | 1223 |
| 466 | Ga0495676_0001858 | 3300047321 | Bacteria | 18533 |
| 467 | Ga0495676_0113726 | 3300047321 | Unclassified | 1981 |
| 468 | Ga0495676_0116853 | 3300047321 | Bacteria | 1947 |
| 469 | Ga0495676_0133919 | 3300047321 | Unclassified | 1785 |
| 470 | Ga0495680_0001661 | 3300047322 | Bacteria | 23654 |
| 471 | Ga0495680_0002927 | 3300047322 | Bacteria | 17149 |
| 472 | Ga0495680_0027260 | 3300047322 | Bacteria | 4696 |
| 473 | Ga0495680_0053584 | 3300047322 | Bacteria | 3138 |
| 474 | Ga0495680_0064483 | 3300047322 | Bacteria | 2809 |
| 475 | Ga0495680_0075254 | 3300047322 | Bacteria | 2562 |
| 476 | Ga0495680_0097218 | 3300047322 | Bacteria | 2198 |
| 477 | Ga0495675_0000029 | 3300047444 | Bacteria | 105305 |
| 478 | Ga0495684_0010365 | 3300047471 | Bacteria | 7210 |
| 479 | Ga0495684_0044227 | 3300047471 | Bacteria | 3409 |
| 480 | Ga0495684_0047784 | 3300047471 | Bacteria | 3272 |
| 481 | Ga0495593_0000750 | 3300047673 | Bacteria | 18855 |
| 482 | Ga0495593_0038252 | 3300047673 | Bacteria | 2591 |
| 483 | Ga0495602_0000741 | 3300048088 | Bacteria | 30911 |
| 484 | Ga0495602_0044523 | 3300048088 | Bacteria | 4025 |
| 485 | Ga0495602_0086379 | 3300048088 | Bacteria | 2619 |
| 486 | Ga0495602_0226180 | 3300048088 | Unclassified | 1409 |
| 487 | Ga0495614_0001705 | 3300048089 | Bacteria | 9587 |
| 488 | Ga0495614_0002889 | 3300048089 | Bacteria | 7649 |
| 489 | Ga0495614_0025227 | 3300048089 | Bacteria | 2564 |
| 490 | Ga0496100_0023490 | 3300048903 | Bacteria | 3746 |
| 491 | Ga0496102_0174908 | 3300048905 | Bacteria | 2021 |
| 492 | Ga0496103_0289586 | 3300048906 | Unclassified | 1053 |
| 493 | Ga0496104_0025508 | 3300048907 | Bacteria | 5449 |
| 494 | Ga0496104_0029797 | 3300048907 | Bacteria | 5065 |
| 495 | Ga0496104_0149395 | 3300048907 | Bacteria | 2243 |
| 496 | Ga0496104_0192358 | 3300048907 | Unclassified | 1952 |
| 497 | Ga0496105_0002189 | 3300048908 | Bacteria | 14153 |
| 498 | Ga0496105_0013935 | 3300048908 | Bacteria | 6390 |
| 499 | Ga0496106_0005421 | 3300048909 | Bacteria | 9436 |
| 500 | Ga0496106_0007960 | 3300048909 | Bacteria | 7831 |
| 501 | Ga0496106_0064804 | 3300048909 | Unclassified | 2781 |
| 502 | Ga0496108_0006809 | 3300048911 | Bacteria | 9249 |
| 503 | Ga0496108_0038294 | 3300048911 | Bacteria | 3994 |
| 504 | Ga0496109_0004307 | 3300048912 | Bacteria | 11885 |
| 505 | Ga0496109_0020876 | 3300048912 | Bacteria | 5789 |
| 506 | Ga0496109_0811175 | 3300048912 | Unclassified | 874 |
| 507 | Ga0496110_0000970 | 3300048913 | Bacteria | 20097 |
| 508 | Ga0496110_0012177 | 3300048913 | Bacteria | 7066 |
| 509 | Ga0496110_0052905 | 3300048913 | Bacteria | 3568 |
| 510 | Ga0496110_0121100 | 3300048913 | Unclassified | 2357 |
| 511 | Ga0496110_0163604 | 3300048913 | Bacteria | 2017 |
| 512 | Ga0496110_0167814 | 3300048913 | Bacteria | 1991 |
| 513 | Ga0496111_0002051 | 3300048914 | Bacteria | 12004 |
| 514 | Ga0496111_0065565 | 3300048914 | Bacteria | 2636 |
| 515 | Ga0496111_0280125 | 3300048914 | Bacteria | 1236 |
| 516 | Ga0496112_0006882 | 3300048915 | Bacteria | 10027 |
| 517 | Ga0496112_0014169 | 3300048915 | Bacteria | 7388 |
| 518 | Ga0496112_0067391 | 3300048915 | Bacteria | 3533 |
| 519 | Ga0496112_0068703 | 3300048915 | Bacteria | 3499 |
| 520 | Ga0496112_0071821 | 3300048915 | Bacteria | 3421 |
| 521 | Ga0496112_0204075 | 3300048915 | Bacteria | 1935 |
| 522 | Ga0496112_0211145 | 3300048915 | Unclassified | 1898 |
| 523 | Ga0496113_0008476 | 3300048916 | Bacteria | 6700 |
| 524 | Ga0496113_0060115 | 3300048916 | Bacteria | 2864 |
| 525 | Ga0496113_0073471 | 3300048916 | Bacteria | 2605 |
| 526 | Ga0496113_0159916 | 3300048916 | Unclassified | 1780 |
| 527 | Ga0496114_0005225 | 3300048917 | Bacteria | 10144 |
| 528 | Ga0496114_0076244 | 3300048917 | Bacteria | 2825 |
| 529 | Ga0496115_0009386 | 3300048918 | Bacteria | 7270 |
| 530 | Ga0496115_0025593 | 3300048918 | Bacteria | 4597 |
| 531 | Ga0496115_0340776 | 3300048918 | Unclassified | 1223 |
| 532 | Ga0501041_0074476 | 3300049577 | Unclassified | 2086 |
| 533 | Ga0501043_0335532 | 3300049579 | Bacteria | 1151 |
| 534 | Ga0501046_0023635 | 3300049580 | Bacteria | 5052 |
| 535 | Ga0501047_0035997 | 3300049581 | Bacteria | 4783 |
| 536 | Ga0501047_0097518 | 3300049581 | Bacteria | 2818 |
| 537 | Ga0501067_0011371 | 3300049583 | Bacteria | 4929 |
| 538 | Ga0501069_0007840 | 3300049585 | Bacteria | 5605 |
| 539 | Ga0501069_0015309 | 3300049585 | Bacteria | 4110 |
| 540 | Ga0501070_0002407 | 3300049586 | Bacteria | 16412 |
| 541 | Ga0501070_0015806 | 3300049586 | Bacteria | 6346 |
| 542 | Ga0501072_0003796 | 3300049588 | Bacteria | 11406 |
| 543 | Ga0501073_0041383 | 3300049589 | Bacteria | 3256 |
| 544 | Ga0501074_0003122 | 3300049590 | Bacteria | 11682 |
| 545 | Ga0501074_0003478 | 3300049590 | Bacteria | 11175 |
| 546 | Ga0501074_0046635 | 3300049590 | Bacteria | 3133 |
| 547 | Ga0501074_0296729 | 3300049590 | Unclassified | 1148 |
| 548 | Ga0501079_0051760 | 3300049741 | Bacteria | 3171 |
| 549 | Ga0501080_0011497 | 3300049742 | Bacteria | 8104 |
| 550 | Ga0501080_0019295 | 3300049742 | Bacteria | 6317 |
| 551 | Ga0501080_0240149 | 3300049742 | Unclassified | 1654 |
| 552 | Ga0501081_0397569 | 3300049743 | Bacteria | 1020 |
| 553 | Ga0501083_0000442 | 3300049744 | Bacteria | 26662 |
| 554 | nmdc:mga08x19_68103_c1 | 3300050514 | Unclassified | 2316 |
| 555 | Ga0495601_0000082 | 3300053077 | Bacteria | 51242 |
| 556 | Ga0495601_0001051 | 3300053077 | Bacteria | 15116 |
| 557 | Ga0495601_0006082 | 3300053077 | Bacteria | 7041 |
| 558 | Ga0495601_0007828 | 3300053077 | Bacteria | 6287 |
| 559 | Ga0495601_0099983 | 3300053077 | Bacteria | 1873 |
| 560 | Ga0495601_0162291 | 3300053077 | Bacteria | 1461 |
| 561 | Ga0495612_0000412 | 3300053078 | Bacteria | 17061 |
| 562 | Ga0495612_0026622 | 3300053078 | Bacteria | 2324 |
| 563 | Ga0495612_0047789 | 3300053078 | Bacteria | 1754 |
| 564 | Ga0495595_0006938 | 3300053084 | Bacteria | 4624 |
| 565 | Ga0495595_0014501 | 3300053084 | Bacteria | 3346 |
| 566 | Ga0495595_0125392 | 3300053084 | Bacteria | 1253 |
| 567 | Ga0495595_0144205 | 3300053084 | Bacteria | 1169 |
| 568 | Ga0495619_0000901 | 3300053085 | Bacteria | 19446 |
| 569 | Ga0495619_0004401 | 3300053085 | Bacteria | 8985 |
| 570 | Ga0495619_0011606 | 3300053085 | Bacteria | 5551 |
| 571 | Ga0495619_0016589 | 3300053085 | Bacteria | 4662 |
| 572 | Ga0495619_0018500 | 3300053085 | Bacteria | 4419 |
| 573 | Ga0495619_0023764 | 3300053085 | Bacteria | 3929 |
| 574 | Ga0495619_0036400 | 3300053085 | Bacteria | 3205 |
| 575 | Ga0495619_0051144 | 3300053085 | Bacteria | 2730 |
| 576 | Ga0466962_0000979 | 3300061719 | Bacteria | 12991 |
| 577 | Ga0466962_0001028 | 3300061719 | Bacteria | 12768 |
| 578 | Ga0466962_0002528 | 3300061719 | Bacteria | 8686 |
| 579 | Ga0466962_0005923 | 3300061719 | Bacteria | 5875 |
| 580 | Ga0466962_0017151 | 3300061719 | Bacteria | 3489 |
| 581 | Ga0466962_0038683 | 3300061719 | Unclassified | 2284 |
| 582 | Ga0070714_100282498 | |||
| 583 | Ga0070658_10012569 | |||
| 584 | Ga0070683_100016847 | |||
| 585 | Ga0070683_100017716 | |||
| 586 | Ga0070683_100230299 | |||
| 587 | Ga0070680_100043656 | |||
| 588 | Ga0070680_100230576 | |||
| 589 | Ga0070682_100089022 | |||
| 590 | Ga0070660_100003251 | |||
| 591 | Ga0070660_100090465 | |||
| 592 | Ga0070691_10021406 | |||
| 593 | Ga0070659_100060113 | |||
| 594 | Ga0070709_10046911 | |||
| 595 | Ga0070709_10067471 | |||
| 596 | Ga0070709_10069522 | |||
| 597 | Ga0070709_10093611 | |||
| 598 | Ga0070709_10252568 | |||
| 599 | Ga0070714_100010935 | |||
| 600 | Ga0070714_100014158 | |||
| 601 | Ga0070714_100021402 | |||
| 602 | Ga0070714_100027718 | |||
| 603 | Ga0070714_100050503 | |||
| 604 | Ga0070714_100072759 | |||
| 605 | Ga0070714_100188621 | |||
| 606 | Ga0070714_100258762 | |||
| 607 | Ga0070713_100004631 | |||
| 608 | Ga0070713_100007202 | |||
| 609 | Ga0070713_100094806 | |||
| 610 | Ga0070713_100472911 | |||
| 611 | Ga0070710_10007692 | |||
| 612 | Ga0070710_10028333 | |||
| 613 | Ga0070710_10313124 | |||
| 614 | Ga0070711_100085427 | |||
| 615 | Ga0070708_100239126 | |||
| 616 | Ga0070681_10008810 | |||
| 617 | Ga0070681_10167494 | |||
| 618 | Ga0070707_100000445 | |||
| 619 | Ga0070707_100108570 | |||
| 620 | Ga0070707_100299111 | |||
| 621 | Ga0070679_100027534 | |||
| 622 | Ga0070679_100117228 | |||
| 623 | Ga0070679_100118710 | |||
| 624 | Ga0070684_100008226 | |||
| 625 | Ga0068855_100015736 | |||
| 626 | Ga0068856_100009230 | |||
| 627 | Ga0070717_10001383 | |||
| 628 | Ga0070717_10016886 | |||
| 629 | Ga0070717_10027281 | |||
| 630 | Ga0070717_10043441 | |||
| 631 | Ga0070717_10114565 | |||
| 632 | Ga0070715_10000206 | |||
| 633 | Ga0070716_100001775 | |||
| 634 | Ga0070716_100270063 | |||
| 635 | Ga0070712_100008799 | |||
| 636 | Ga0075436_100150345 | |||
| 637 | Ga0105240_10280904 | |||
| 638 | Ga0105240_10420847 | |||
| 639 | Ga0105241_10455230 | |||
| 640 | Ga0105241_10524945 | |||
| 641 | Ga0105237_10006254 | |||
| 642 | Ga0105237_10056066 | |||
| 643 | Ga0105238_10018870 | |||
| 644 | Ga0157370_10072644 | |||
| 645 | Ga0157369_10003395 | |||
| 646 | Ga0157369_10003872 | |||
| 647 | Ga0157369_10016029 | |||
| 648 | Ga0157369_10027514 | |||
| 649 | Ga0157369_10036119 | |||
| 650 | Ga0157374_10070638 | |||
| 651 | Ga0157374_10499886 | |||
| 652 | Ga0157372_10034070 | |||
| 653 | Ga0182008_10068705 | |||
| 654 | Ga0182008_10167561 | |||
| 655 | Ga0197907_10665034 | |||
| 656 | Ga0206356_11250198 | |||
| 657 | Ga0206356_11468005 | |||
| 658 | Ga0206355_1603386 | |||
| 659 | Ga0206353_11140038 | |||
| 660 | Ga0224712_10001598 | |||
| 661 | Ga0224712_10023150 | |||
| 662 | Ga0207699_10039611 | |||
| 663 | Ga0207699_10044460 | |||
| 664 | Ga0207699_10078389 | |||
| 665 | Ga0207705_10028060 | |||
| 666 | Ga0207707_10016175 | |||
| 667 | Ga0207707_10387726 | |||
| 668 | Ga0207695_10087217 | |||
| 669 | Ga0207695_10173356 | |||
| 670 | Ga0207695_10195276 | |||
| 671 | Ga0207671_10109252 | |||
| 672 | Ga0207693_10006828 | |||
| 673 | Ga0207693_10014121 | |||
| 674 | Ga0207663_10055545 | |||
| 675 | Ga0207663_10092870 | |||
| 676 | Ga0207660_10180742 | |||
| 677 | Ga0207657_10019430 | |||
| 678 | Ga0207657_10118159 | |||
| 679 | Ga0207652_10086255 | |||
| 680 | Ga0207652_10429111 | |||
| 681 | Ga0207646_10001908 | |||
| 682 | Ga0207646_10184016 | |||
| 683 | Ga0207700_10039956 | |||
| 684 | Ga0207700_10062066 | |||
| 685 | Ga0207700_10178701 | |||
| 686 | Ga0207664_10004541 | |||
| 687 | Ga0207664_10025574 | |||
| 688 | Ga0207664_10073204 | |||
| 689 | Ga0207664_10119335 | |||
| 690 | Ga0207664_10134009 | |||
| 691 | Ga0207664_10145380 | |||
| 692 | Ga0207664_10180819 | |||
| 693 | Ga0207664_10309208 | |||
| 694 | Ga0207665_10001018 | |||
| 695 | Ga0207665_10186834 | |||
| 696 | Ga0207661_10009909 | |||
| 697 | Ga0207661_10021891 | |||
| 698 | Ga0207667_10092945 | |||
| 699 | Ga0207702_10028533 | |||
| 700 | Ga0265337_1018407 | |||
| 701 | Ga0265319_1005383 | |||
| 702 | Ga0265319_1028836 | |||
| 703 | Ga0265334_10000492 | |||
| 704 | Ga0265334_10017657 | |||
| 705 | Ga0265334_10022701 | |||
| 706 | Ga0265334_10026718 | |||
| 707 | Ga0265318_10000429 | |||
| 708 | Ga0265318_10020519 | |||
| 709 | Ga0265318_10087609 | |||
| 710 | Ga0265322_10004312 | |||
| 711 | Ga0265322_10004651 | |||
| 712 | Ga0265322_10024794 | |||
| 713 | Ga0265336_10004248 | |||
| 714 | Ga0265336_10013473 | |||
| 715 | Ga0265338_10002292 | |||
| 716 | Ga0265338_10003836 | |||
| 717 | Ga0265338_10006920 | |||
| 718 | Ga0265338_10010581 | |||
| 719 | Ga0265338_10010750 | |||
| 720 | Ga0265338_10016896 | |||
| 721 | Ga0265338_10040031 | |||
| 722 | Ga0265338_10084685 | |||
| 723 | Ga0265338_10113090 | |||
| 724 | Ga0265338_10158033 | |||
| 725 | Ga0265338_10165683 | |||
| 726 | Ga0265338_10348960 | |||
| 727 | Ga0265330_10000760 | |||
| 728 | Ga0265330_10018953 | |||
| 729 | Ga0265330_10131065 | |||
| 730 | Ga0265332_10003620 | |||
| 731 | Ga0265328_10000357 | |||
| 732 | Ga0265320_10005108 | |||
| 733 | Ga0265320_10028937 | |||
| 734 | Ga0265320_10048354 | |||
| 735 | Ga0265325_10027491 | |||
| 736 | Ga0265325_10044198 | |||
| 737 | Ga0265325_10097517 | |||
| 738 | Ga0265329_10009037 | |||
| 739 | Ga0265340_10068574 | |||
| 740 | Ga0265340_10078370 | |||
| 741 | Ga0265340_10082319 | |||
| 742 | Ga0265339_10012774 | |||
| 743 | Ga0265339_10026012 | |||
| 744 | Ga0265339_10103420 | |||
| 745 | Ga0265327_10003298 | |||
| 746 | Ga0265327_10022747 | |||
| 747 | Ga0265327_10066912 | |||
| 748 | Ga0265316_10023216 | |||
| 749 | Ga0265316_10026314 | |||
| 750 | Ga0265316_10027658 | |||
| 751 | Ga0265316_10102891 | |||
| 752 | Ga0265313_10002251 | |||
| 753 | Ga0265313_10008655 | |||
| 754 | Ga0265313_10058430 | |||
| 755 | Ga0265314_10011890 | |||
| 756 | Ga0265314_10030184 | |||
| 757 | Ga0265314_10047279 | |||
| 758 | Ga0265342_10003288 | |||
| 759 | Ga0265342_10011149 | |||
| 760 | Ga0265342_10161824 | |||
| 761 | Ga0373926_0009042 | |||
| 762 | Ga0373944_0014503 | |||
| 763 | Ga0373936_0024037 | |||
| 764 | Ga0373936_0060699 | |||
| 765 | Ga0373945_0009976 | |||
| 766 | Ga0373943_0000708 | |||
| 767 | Ga0373943_0006539 | |||
| 768 | Ga0373943_0008619 | |||
| 769 | Ga0373943_0105921 | |||
| 770 | Ga0373946_0001448 | |||
| 771 | Ga0373955_0113619 | |||
| 772 | Ga0373931_0127700 | |||
| 773 | Ga0373935_0013507 | |||
| 774 | Ga0373935_0016019 | |||
| 775 | Ga0373935_0247836 | |||
| 776 | Ga0373927_0035805 | |||
| 777 | Ga0373927_0102081 | |||
| 778 | Ga0373933_0041646 | |||
| 779 | Ga0373933_0194391 | |||
| 780 | Ga0373933_0325454 | |||
| 781 | Ga0373947_0002107 | |||
| 782 | Ga0373947_0018607 | |||
| 783 | Ga0373937_0000308 | |||
| 784 | Ga0373937_0035960 | |||
| 785 | Ga0373937_0097879 | |||
| 786 | Ga0373937_0385477 | |||
| 787 | Ga0373925_0001399 | |||
| 788 | Ga0373925_0002351 | |||
| 789 | Ga0373925_0201333 | |||
| 790 | Ga0395899_0160788 | |||
| 791 | Ga0395900_0009381 | |||
| 792 | Ga0395900_0054890 | |||
| 793 | Ga0395900_0060157 | |||
| 794 | Ga0395900_0850738 | |||
| 795 | Ga0395898_0016031 | |||
| 796 | Ga0395898_0136990 | |||
| 797 | Ga0395898_0165685 | |||
| 798 | Ga0395901_0022593 | |||
| 799 | Ga0395901_0073857 | |||
| 800 | Ga0395901_0074427 | |||
| 801 | Ga0395901_0513298 | |||
| 802 | Ga0436365_0589664 | |||
| 803 | Ga0436362_0122452 | |||
| 804 | Ga0451807_0390771 | |||
| 805 | Ga0466969_0002282 | |||
| 806 | Ga0466969_0065240 | |||
| 807 | Ga0466969_0157231 | |||
| 808 | Ga0466972_0115956 | |||
| 809 | Ga0466965_0017401 | |||
| 810 | Ga0466965_0063526 | |||
| 811 | Ga0466965_0096033 | |||
| 812 | Ga0466966_0004423 | |||
| 813 | Ga0466966_0018620 | |||
| 814 | Ga0466966_0023443 | |||
| 815 | Ga0466966_0060973 | |||
| 816 | Ga0466966_0135895 | |||
| 817 | Ga0466961_0006444 | |||
| 818 | Ga0466961_0019637 | |||
| 819 | Ga0466961_0032800 | |||
| 820 | Ga0466961_0056963 | |||
| 821 | Ga0466963_0000063 | |||
| 822 | Ga0466963_0000532 | |||
| 823 | Ga0466963_0001170 | |||
| 824 | Ga0466963_0001668 | |||
| 825 | Ga0466963_0003131 | |||
| 826 | Ga0466963_0003410 | |||
| 827 | Ga0466963_0004571 | |||
| 828 | Ga0466963_0004743 | |||
| 829 | Ga0466963_0007397 | |||
| 830 | Ga0466963_0012078 | |||
| 831 | Ga0466963_0024253 | |||
| 832 | Ga0466963_0029928 | |||
| 833 | Ga0466963_0063126 | |||
| 834 | Ga0466963_0091513 | |||
| 835 | Ga0466963_0186343 | |||
| 836 | Ga0466963_0187080 | |||
| 837 | Ga0466963_0187375 | |||
| 838 | Ga0466964_0003765 | |||
| 839 | Ga0466964_0010435 | |||
| 840 | Ga0466964_0027015 | |||
| 841 | Ga0466964_0028919 | |||
| 842 | Ga0466964_0031370 | |||
| 843 | Ga0466971_0000840 | |||
| 844 | Ga0466971_0003605 | |||
| 845 | Ga0466971_0009517 | |||
| 846 | Ga0466971_0060122 | |||
| 847 | Ga0466971_0075056 | |||
| 848 | Ga0466968_0000944 | |||
| 849 | Ga0466968_0009575 | |||
| 850 | Ga0466968_0079911 | |||
| 851 | Ga0466968_0101809 | |||
| 852 | Ga0466970_0007339 | |||
| 853 | Ga0466970_0131864 | |||
| 854 | Ga0466957_0002652 | |||
| 855 | Ga0466957_0004191 | |||
| 856 | Ga0466957_0007463 | |||
| 857 | Ga0466957_0013908 | |||
| 858 | Ga0466957_0018542 | |||
| 859 | Ga0466957_0018954 | |||
| 860 | Ga0466957_0025484 | |||
| 861 | Ga0466957_0034001 | |||
| 862 | Ga0466960_0015030 | |||
| 863 | Ga0466960_0061465 | |||
| 864 | Ga0466959_0007814 | |||
| 865 | Ga0466959_0010769 | |||
| 866 | Ga0466959_0021405 | |||
| 867 | Ga0466959_0053854 | |||
| 868 | Ga0466959_0054051 | |||
| 869 | Ga0466959_0097358 | |||
| 870 | Ga0466959_0105001 | |||
| 871 | Ga0466959_0199443 | |||
| 872 | Ga0466959_0210209 | |||
| 873 | Ga0466958_0001030 | |||
| 874 | Ga0466958_0001870 | |||
| 875 | Ga0466958_0008049 | |||
| 876 | Ga0466958_0011598 | |||
| 877 | Ga0466958_0015206 | |||
| 878 | Ga0466958_0015349 | |||
| 879 | Ga0466958_0017512 | |||
| 880 | Ga0466958_0057330 | |||
| 881 | Ga0466958_0085768 | |||
| 882 | Ga0466958_0096346 | |||
| 883 | Ga0466958_0103270 | |||
| 884 | Ga0466958_0171408 | |||
| 885 | Ga0466967_0000058 | |||
| 886 | Ga0466967_0005619 | |||
| 887 | Ga0466967_0005902 | |||
| 888 | Ga0466967_0007306 | |||
| 889 | Ga0466967_0010600 | |||
| 890 | Ga0466967_0018957 | |||
| 891 | Ga0466967_0033953 | |||
| 892 | Ga0466967_0052036 | |||
| 893 | Ga0466967_0075160 | |||
| 894 | Ga0466967_0075935 | |||
| 895 | Ga0466967_0100637 | |||
| 896 | Ga0466967_0115665 | |||
| 897 | Ga0466967_0133570 | |||
| 898 | Ga0466967_0147083 | |||
| 899 | Ga0466967_0149880 | |||
| 900 | Ga0466967_0165237 | |||
| 901 | Ga0466967_0176197 | |||
| 902 | Ga0466967_0193063 | |||
| 903 | Ga0466967_0257857 | |||
| 904 | Ga0466967_0375600 | |||
| 905 | Ga0466967_0618783 | |||
| 906 | Ga0495592_0000410 | |||
| 907 | Ga0495592_0004998 | |||
| 908 | Ga0495592_0288306 | |||
| 909 | Ga0495603_0011158 | |||
| 910 | Ga0495603_0025944 | |||
| 911 | Ga0495603_0197299 | |||
| 912 | Ga0495603_0252781 | |||
| 913 | Ga0495629_0000783 | |||
| 914 | Ga0495629_0036254 | |||
| 915 | Ga0495629_0041851 | |||
| 916 | Ga0495629_0054285 | |||
| 917 | Ga0495629_0215087 | |||
| 918 | Ga0495641_0000421 | |||
| 919 | Ga0495641_0007071 | |||
| 920 | Ga0495641_0010830 | |||
| 921 | Ga0495641_0013433 | |||
| 922 | Ga0495651_0000034 | |||
| 923 | Ga0495651_0001663 | |||
| 924 | Ga0495651_0014439 | |||
| 925 | Ga0495651_0061046 | |||
| 926 | Ga0495651_0082424 | |||
| 927 | Ga0495651_0206824 | |||
| 928 | Ga0495653_0021748 | |||
| 929 | Ga0495653_0034515 | |||
| 930 | Ga0495653_0056787 | |||
| 931 | Ga0495653_0125872 | |||
| 932 | Ga0495653_0215329 | |||
| 933 | Ga0495582_0000139 | |||
| 934 | Ga0495582_0010406 | |||
| 935 | Ga0495582_0023286 | |||
| 936 | Ga0495582_0053760 | |||
| 937 | Ga0495582_0167320 | |||
| 938 | Ga0495639_0000166 | |||
| 939 | Ga0495639_0004561 | |||
| 940 | Ga0495662_0000341 | |||
| 941 | Ga0495664_0023533 | |||
| 942 | Ga0495664_0030358 | |||
| 943 | Ga0495664_0055691 | |||
| 944 | Ga0495608_0000638 | |||
| 945 | Ga0495608_0009815 | |||
| 946 | Ga0495608_0040572 | |||
| 947 | Ga0495608_0074913 | |||
| 948 | Ga0495618_0002873 | |||
| 949 | Ga0495618_0005628 | |||
| 950 | Ga0495618_0049437 | |||
| 951 | Ga0495618_0171628 | |||
| 952 | Ga0495628_0000184 | |||
| 953 | Ga0495628_0005773 | |||
| 954 | Ga0495628_0096398 | |||
| 955 | Ga0495628_0112549 | |||
| 956 | Ga0495628_0148407 | |||
| 957 | Ga0495628_0277636 | |||
| 958 | Ga0495628_0385659 | |||
| 959 | Ga0495630_0002629 | |||
| 960 | Ga0495630_0003040 | |||
| 961 | Ga0495630_0007473 | |||
| 962 | Ga0495630_0016688 | |||
| 963 | Ga0495630_0060049 | |||
| 964 | Ga0495630_0061020 | |||
| 965 | Ga0495630_0067142 | |||
| 966 | Ga0495666_0049517 | |||
| 967 | Ga0495652_0000319 | |||
| 968 | Ga0495652_0018524 | |||
| 969 | Ga0495652_0060510 | |||
| 970 | Ga0495665_0000480 | |||
| 971 | Ga0495665_0003054 | |||
| 972 | Ga0495640_0007089 | |||
| 973 | Ga0495586_0006570 | |||
| 974 | Ga0495587_0000055 | |||
| 975 | Ga0495587_0002592 | |||
| 976 | Ga0495587_0032097 | |||
| 977 | Ga0495587_0108855 | |||
| 978 | Ga0495587_0109056 | |||
| 979 | Ga0495645_0000170 | |||
| 980 | Ga0495645_0013468 | |||
| 981 | Ga0495645_0015728 | |||
| 982 | Ga0495645_0035610 | |||
| 983 | Ga0495645_0052364 | |||
| 984 | Ga0495645_0185589 | |||
| 985 | Ga0495645_0263809 | |||
| 986 | Ga0495667_0040483 | |||
| 987 | Ga0495667_0074754 | |||
| 988 | Ga0495667_0095005 | |||
| 989 | Ga0495667_0116701 | |||
| 990 | Ga0495667_0138400 | |||
| 991 | Ga0495634_0001802 | |||
| 992 | Ga0495634_0002962 | |||
| 993 | Ga0495634_0024046 | |||
| 994 | Ga0495634_0024882 | |||
| 995 | Ga0495634_0034030 | |||
| 996 | Ga0495634_0034790 | |||
| 997 | Ga0495634_0091635 | |||
| 998 | Ga0495635_0005146 | |||
| 999 | Ga0495635_0009812 | |||
| 1000 | Ga0495635_0039758 | |||
| 1001 | Ga0495635_0053555 | |||
| 1002 | Ga0495635_0054820 | |||
| 1003 | Ga0495635_0061115 | |||
| 1004 | Ga0495635_0094532 | |||
| 1005 | Ga0495588_0187710 | |||
| 1006 | Ga0495657_0008362 | |||
| 1007 | Ga0495657_0041983 | |||
| 1008 | Ga0495657_0045150 | |||
| 1009 | Ga0495657_0100708 | |||
| 1010 | Ga0495657_0105235 | |||
| 1011 | Ga0495657_0124920 | |||
| 1012 | Ga0495599_0001220 | |||
| 1013 | Ga0495599_0047059 | |||
| 1014 | Ga0495623_0000149 | |||
| 1015 | Ga0495623_0024677 | |||
| 1016 | Ga0495646_0008095 | |||
| 1017 | Ga0495646_0071362 | |||
| 1018 | Ga0495646_0187561 | |||
| 1019 | Ga0495647_0003022 | |||
| 1020 | Ga0495658_0000149 | |||
| 1021 | Ga0495658_0017571 | |||
| 1022 | Ga0495658_0044577 | |||
| 1023 | Ga0495658_0059638 | |||
| 1024 | Ga0495613_0002462 | |||
| 1025 | Ga0495613_0007620 | |||
| 1026 | Ga0495613_0019064 | |||
| 1027 | Ga0495624_0023223 | |||
| 1028 | Ga0495624_0026778 | |||
| 1029 | Ga0495624_0104593 | |||
| 1030 | Ga0495600_0055747 | |||
| 1031 | Ga0495600_0128675 | |||
| 1032 | Ga0495600_0231467 | |||
| 1033 | Ga0495600_0231649 | |||
| 1034 | Ga0495581_0000900 | |||
| 1035 | Ga0495581_0021505 | |||
| 1036 | Ga0495604_0000019 | |||
| 1037 | Ga0495604_0000194 | |||
| 1038 | Ga0495604_0105060 | |||
| 1039 | Ga0495604_0175438 | |||
| 1040 | Ga0495604_0276915 | |||
| 1041 | Ga0495674_0015705 | |||
| 1042 | Ga0495674_0019031 | |||
| 1043 | Ga0495674_0024937 | |||
| 1044 | Ga0495674_0066636 | |||
| 1045 | Ga0495674_0078544 | |||
| 1046 | Ga0495674_0338473 | |||
| 1047 | Ga0495676_0001858 | |||
| 1048 | Ga0495676_0113726 | |||
| 1049 | Ga0495676_0116853 | |||
| 1050 | Ga0495676_0133919 | |||
| 1051 | Ga0495680_0001661 | |||
| 1052 | Ga0495680_0002927 | |||
| 1053 | Ga0495680_0027260 | |||
| 1054 | Ga0495680_0053584 | |||
| 1055 | Ga0495680_0064483 | |||
| 1056 | Ga0495680_0075254 | |||
| 1057 | Ga0495680_0097218 | |||
| 1058 | Ga0495675_0000029 | |||
| 1059 | Ga0495684_0010365 | |||
| 1060 | Ga0495684_0044227 | |||
| 1061 | Ga0495684_0047784 | |||
| 1062 | Ga0495593_0000750 | |||
| 1063 | Ga0495593_0038252 | |||
| 1064 | Ga0495602_0000741 | |||
| 1065 | Ga0495602_0044523 | |||
| 1066 | Ga0495602_0086379 | |||
| 1067 | Ga0495602_0226180 | |||
| 1068 | Ga0495614_0001705 | |||
| 1069 | Ga0495614_0002889 | |||
| 1070 | Ga0495614_0025227 | |||
| 1071 | Ga0496100_0023490 | |||
| 1072 | Ga0496102_0174908 | |||
| 1073 | Ga0496103_0289586 | |||
| 1074 | Ga0496104_0025508 | |||
| 1075 | Ga0496104_0029797 | |||
| 1076 | Ga0496104_0149395 | |||
| 1077 | Ga0496104_0192358 | |||
| 1078 | Ga0496105_0002189 | |||
| 1079 | Ga0496105_0013935 | |||
| 1080 | Ga0496106_0005421 | |||
| 1081 | Ga0496106_0007960 | |||
| 1082 | Ga0496106_0064804 | |||
| 1083 | Ga0496108_0006809 | |||
| 1084 | Ga0496108_0038294 | |||
| 1085 | Ga0496109_0004307 | |||
| 1086 | Ga0496109_0020876 | |||
| 1087 | Ga0496109_0811175 | |||
| 1088 | Ga0496110_0000970 | |||
| 1089 | Ga0496110_0012177 | |||
| 1090 | Ga0496110_0052905 | |||
| 1091 | Ga0496110_0121100 | |||
| 1092 | Ga0496110_0163604 | |||
| 1093 | Ga0496110_0167814 | |||
| 1094 | Ga0496111_0002051 | |||
| 1095 | Ga0496111_0065565 | |||
| 1096 | Ga0496111_0280125 | |||
| 1097 | Ga0496112_0006882 | |||
| 1098 | Ga0496112_0014169 | |||
| 1099 | Ga0496112_0067391 | |||
| 1100 | Ga0496112_0068703 | |||
| 1101 | Ga0496112_0071821 | |||
| 1102 | Ga0496112_0204075 | |||
| 1103 | Ga0496112_0211145 | |||
| 1104 | Ga0496113_0008476 | |||
| 1105 | Ga0496113_0060115 | |||
| 1106 | Ga0496113_0073471 | |||
| 1107 | Ga0496113_0159916 | |||
| 1108 | Ga0496114_0005225 | |||
| 1109 | Ga0496114_0076244 | |||
| 1110 | Ga0496115_0009386 | |||
| 1111 | Ga0496115_0025593 | |||
| 1112 | Ga0496115_0340776 | |||
| 1113 | Ga0501041_0074476 | |||
| 1114 | Ga0501043_0335532 | |||
| 1115 | Ga0501046_0023635 | |||
| 1116 | Ga0501047_0035997 | |||
| 1117 | Ga0501047_0097518 | |||
| 1118 | Ga0501067_0011371 | |||
| 1119 | Ga0501069_0007840 | |||
| 1120 | Ga0501069_0015309 | |||
| 1121 | Ga0501070_0002407 | |||
| 1122 | Ga0501070_0015806 | |||
| 1123 | Ga0501072_0003796 | |||
| 1124 | Ga0501073_0041383 | |||
| 1125 | Ga0501074_0003122 | |||
| 1126 | Ga0501074_0003478 | |||
| 1127 | Ga0501074_0046635 | |||
| 1128 | Ga0501074_0296729 | |||
| 1129 | Ga0501079_0051760 | |||
| 1130 | Ga0501080_0011497 | |||
| 1131 | Ga0501080_0019295 | |||
| 1132 | Ga0501080_0240149 | |||
| 1133 | Ga0501081_0397569 | |||
| 1134 | Ga0501083_0000442 | |||
| 1135 | nmdc:mga08x19_68103_c1 | |||
| 1136 | Ga0495601_0000082 | |||
| 1137 | Ga0495601_0001051 | |||
| 1138 | Ga0495601_0006082 | |||
| 1139 | Ga0495601_0007828 | |||
| 1140 | Ga0495601_0099983 | |||
| 1141 | Ga0495601_0162291 | |||
| 1142 | Ga0495612_0000412 | |||
| 1143 | Ga0495612_0026622 | |||
| 1144 | Ga0495612_0047789 | |||
| 1145 | Ga0495595_0006938 | |||
| 1146 | Ga0495595_0014501 | |||
| 1147 | Ga0495595_0125392 | |||
| 1148 | Ga0495595_0144205 | |||
| 1149 | Ga0495619_0000901 | |||
| 1150 | Ga0495619_0004401 | |||
| 1151 | Ga0495619_0011606 | |||
| 1152 | Ga0495619_0016589 | |||
| 1153 | Ga0495619_0018500 | |||
| 1154 | Ga0495619_0023764 | |||
| 1155 | Ga0495619_0036400 | |||
| 1156 | Ga0495619_0051144 | |||
| 1157 | Ga0466962_0000979 | |||
| 1158 | Ga0466962_0001028 | |||
| 1159 | Ga0466962_0002528 | |||
| 1160 | Ga0466962_0005923 | |||
| 1161 | Ga0466962_0017151 | |||
| 1162 | Ga0466962_0038683 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4w9z-assembly1.cif.gz_A | crystal structure of the periplasmic domain of subunit ii of cytochrome oxidase (coxb) of bradyrhizobium japonicum | 0.9071 | 143 | 263 |
| 1cyx-assembly1.cif.gz_A | quinol oxidase (periplasmic fragment of subunit ii with engineered cu-a binding site)(cyoa) | 0.9023 | 147 | 258 |
| 1cyw-assembly1.cif.gz_A | quinol oxidase (periplasmic fragment of subunit ii) (cyoa) | 0.8989 | 147 | 258 |
| 2yev-assembly2.cif.gz_B | structure of caa3-type cytochrome oxidase | 0.8962 | 48 | 254 |
| 4txv-assembly2.cif.gz_D | crystal structure of the mixed disulfide intermediate between thioredoxin-like tlpas(c110s) and subunit ii of cytochrome c oxidase coxbpd (c233s) | 0.8876 | 143 | 264 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2yevE02 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.916 | 144 | 256 | 2.60.40.420 |
| af_Q2FZJ9_108_266_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9092 | 144 | 258 | 2.60.40.420 |
| 3hb3B01 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9034 | 144 | 260 | 2.60.40.420 |
| af_A0A1D6ED90_406_498_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.896 | 172 | 255 | 2.60.40.420 |
| 4txvD00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8876 | 143 | 264 | 2.60.40.420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A355BYQ2-F1-model_v4 | cytochrome-c oxidase (EC 7.1.1.9) | 0.9323 | 150 | 264 |
GO:0004129
GO:0005507 GO:0016020 GO:0042773 |
| AF-A0A1F8JDM8-F1-model_v4 | deleted | 0.9294 | 149 | 258 |
|
| AF-A0A2M7PUM5-F1-model_v4 | Cytochrome c oxidase subunit II | 0.9229 | 144 | 255 |
GO:0004129
GO:0005507 GO:0016020 GO:0020037 GO:0042773 |
| AF-A0A2E8WUX5-F1-model_v4 | Cytochrome c oxidase subunit II | 0.9193 | 143 | 257 |
GO:0004129
GO:0005507 GO:0016020 GO:0020037 GO:0042773 |
| AF-A0A8A5SUA7-F1-model_v4 | cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome c oxidase polypeptide II) | 0.9181 | 151 | 262 |
GO:0004129
GO:0005507 GO:0031966 GO:0042773 |