F466042

General Info

Members Datasets Scaffolds Average Seq Length
581 244 1162 212

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100193598|Ga0070670_1001935982
Length 225
Sequence VPRFKSHQPETTVNQRLLAEIGRTQRLEILNTLKRTRGLSVNQLVARMKMSYMGIKQHCLTLERDGYLDTWRRPQKMGRPEMVYRLTRRTHALFQADSNAFTVDLLQSMEEIHGPNAPEKLLYNLFDRKTNALKARVRGATVEERAQSLANIRDEEGHMSQFVNDASEGGPQILECHSPIMNLIEKYEIIGRLEQEMFEKALQTPVRREETRTSGLYEAAFYFAI

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
100 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
181 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
182 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
183 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
184 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
185 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
186 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
220 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.61
Rhizosphere 90.71
Stem 0
Stem Tuber 0
Unclassified 27.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100193598 3300005331 Bacteria 1766
2 CNXas_1000070 3300000545 Bacteria 18945
3 JGI25406J46586_10009757 3300003203 Bacteria 4291
4 JGI25405J52794_10003097 3300003911 Bacteria 2894
5 Ga0065712_10005355 3300005290 Bacteria 3593
6 Ga0065712_10008410 3300005290 Bacteria 2469
7 Ga0065712_10113213 3300005290 Bacteria 1772
8 Ga0065715_10017440 3300005293 Bacteria 2885
9 Ga0065715_10118519 3300005293 Unclassified 2313
10 Ga0065715_10119195 3300005293 Bacteria 2293
11 Ga0065715_10228677 3300005293 Unclassified 1241
12 Ga0065715_10439925 3300005293 Unclassified 837
13 Ga0065715_10472939 3300005293 Unclassified 798
14 Ga0065707_10023319 3300005295 Bacteria 2261
15 Ga0065707_10137370 3300005295 Unclassified 1821
16 Ga0070676_10020371 3300005328 Bacteria 3701
17 Ga0070676_10061364 3300005328 Bacteria 2235
18 Ga0070683_100029292 3300005329 Bacteria 4982
19 Ga0070683_100308121 3300005329 Bacteria 1506
20 Ga0070690_100067157 3300005330 Bacteria 2323
21 Ga0070690_100137715 3300005330 Bacteria 1654
22 Ga0070670_100063069 3300005331 Bacteria 3180
23 Ga0070670_100179956 3300005331 Bacteria 1835
24 Ga0070670_100195419 3300005331 Bacteria 1757
25 Ga0070666_10054562 3300005335 Bacteria 2696
26 Ga0070666_10108350 3300005335 Bacteria 1919
27 Ga0070666_10391106 3300005335 Unclassified 999
28 Ga0070666_10486619 3300005335 Bacteria 894
29 Ga0070680_100265146 3300005336 Bacteria 1454
30 Ga0068868_100241252 3300005338 Bacteria 1518
31 Ga0068868_100568895 3300005338 Unclassified 1001
32 Ga0070660_100117769 3300005339 Bacteria 2118
33 Ga0070689_100015152 3300005340 Bacteria 5617
34 Ga0070689_100145025 3300005340 Bacteria 1912
35 Ga0070689_100174788 3300005340 Bacteria 1741
36 Ga0070689_100355854 3300005340 Bacteria 1229
37 Ga0070689_100417189 3300005340 Unclassified 1137
38 Ga0070687_100008100 3300005343 Bacteria 4428
39 Ga0070661_100522441 3300005344 Unclassified 952
40 Ga0070668_100009848 3300005347 Bacteria 7079
41 Ga0070668_100025430 3300005347 Bacteria 4488
42 Ga0070668_100034919 3300005347 Bacteria 3832
43 Ga0070668_100322549 3300005347 Bacteria 1301
44 Ga0070668_100645203 3300005347 Bacteria 930
45 Ga0070668_100686224 3300005347 Unclassified 902
46 Ga0070669_100009381 3300005353 Bacteria 6969
47 Ga0070669_100128639 3300005353 Bacteria 1940
48 Ga0070669_100163728 3300005353 Bacteria 1730
49 Ga0070675_100027739 3300005354 Bacteria 4553
50 Ga0070675_100037509 3300005354 Bacteria 3948
51 Ga0070675_100045612 3300005354 Bacteria 3587
52 Ga0070675_100327279 3300005354 Bacteria 1354
53 Ga0070675_100334689 3300005354 Bacteria 1340
54 Ga0070675_100381868 3300005354 Unclassified 1254
55 Ga0070675_100452360 3300005354 Unclassified 1152
56 Ga0070675_100484595 3300005354 Unclassified 1113
57 Ga0070671_100002816 3300005355 Bacteria 13517
58 Ga0070671_100005156 3300005355 Bacteria 10401
59 Ga0070671_100011152 3300005355 Bacteria 7217
60 Ga0070671_100105867 3300005355 Unclassified 2361
61 Ga0070671_100314924 3300005355 Unclassified 1333
62 Ga0070671_100635235 3300005355 Bacteria 924
63 Ga0070674_100005120 3300005356 Bacteria 7537
64 Ga0070674_100007839 3300005356 Bacteria 6315
65 Ga0070674_100240111 3300005356 Bacteria 1418
66 Ga0070674_100619556 3300005356 Unclassified 917
67 Ga0070673_100127183 3300005364 Bacteria 2133
68 Ga0070688_100003617 3300005365 Bacteria 7979
69 Ga0070688_100022994 3300005365 Bacteria 3660
70 Ga0070688_100174228 3300005365 Unclassified 1487
71 Ga0070659_100005840 3300005366 Bacteria 8868
72 Ga0070667_100006539 3300005367 Bacteria 9687
73 Ga0070667_100028918 3300005367 Bacteria 4615
74 Ga0070667_100035180 3300005367 Bacteria 4195
75 Ga0070709_10006361 3300005434 Bacteria 6432
76 Ga0070709_10218967 3300005434 Unclassified 1357
77 Ga0070714_100040405 3300005435 Bacteria 3932
78 Ga0070714_100281649 3300005435 Bacteria 1545
79 Ga0070714_101278431 3300005435 Unclassified 716
80 Ga0070713_100062003 3300005436 Unclassified 3130
81 Ga0070710_10043463 3300005437 Unclassified 2488
82 Ga0070710_10133644 3300005437 Viruses 1515
83 Ga0070711_100070902 3300005439 Bacteria 2455
84 Ga0070711_100103382 3300005439 Unclassified 2076
85 Ga0070711_100371782 3300005439 Unclassified 1154
86 Ga0070711_100515235 3300005439 Unclassified 988
87 Ga0070705_100533317 3300005440 Bacteria 897
88 Ga0070694_100267942 3300005444 Bacteria 1298
89 Ga0070708_100035407 3300005445 Bacteria 4350
90 Ga0070708_100041214 3300005445 Unclassified 4048
91 Ga0070708_100104187 3300005445 Bacteria 2601
92 Ga0070708_100107082 3300005445 Bacteria 2566
93 Ga0070708_100153509 3300005445 Bacteria 2142
94 Ga0070708_100342193 3300005445 Bacteria 1409
95 Ga0070708_101055704 3300005445 Unclassified 761
96 Ga0070663_100144852 3300005455 Unclassified 1817
97 Ga0070663_100722183 3300005455 Unclassified 848
98 Ga0070678_100090899 3300005456 Bacteria 2341
99 Ga0070678_100612702 3300005456 Unclassified 973
100 Ga0070678_100851443 3300005456 Unclassified 831
101 Ga0070662_100016352 3300005457 Bacteria 4980
102 Ga0070662_100081842 3300005457 Bacteria 2406
103 Ga0070662_100132984 3300005457 Unclassified 1920
104 Ga0070662_100153592 3300005457 Viruses 1795
105 Ga0070662_100474240 3300005457 Bacteria 1041
106 Ga0070681_10017952 3300005458 Bacteria 7071
107 Ga0068867_100273744 3300005459 Bacteria 1382
108 Ga0070685_10032453 3300005466 Bacteria 2924
109 Ga0070685_10471007 3300005466 Bacteria 884
110 Ga0070706_100000100 3300005467 Bacteria 104971
111 Ga0070706_100004978 3300005467 Bacteria 12720
112 Ga0070706_100031400 3300005467 Bacteria 4898
113 Ga0070706_100068165 3300005467 Bacteria 3290
114 Ga0070706_100220490 3300005467 Unclassified 1770
115 Ga0070706_100226300 3300005467 Bacteria 1746
116 Ga0070706_100820765 3300005467 Bacteria 860
117 Ga0070707_100007577 3300005468 Bacteria 10080
118 Ga0070707_100017700 3300005468 Bacteria 6701
119 Ga0070707_100023598 3300005468 Bacteria 5818
120 Ga0070707_100034176 3300005468 Unclassified 4848
121 Ga0070707_100075061 3300005468 Bacteria 3260
122 Ga0070707_100103672 3300005468 Bacteria 2756
123 Ga0070707_100314990 3300005468 Bacteria 1521
124 Ga0070707_100509001 3300005468 Unclassified 1166
125 Ga0070698_100006265 3300005471 Bacteria 12933
126 Ga0070698_100009364 3300005471 Bacteria 10505
127 Ga0070698_100012789 3300005471 Bacteria 8889
128 Ga0070698_100032851 3300005471 Bacteria 5375
129 Ga0070699_100139377 3300005518 Bacteria 2141
130 Ga0070699_100276407 3300005518 Bacteria 1504
131 Ga0070699_100392727 3300005518 Unclassified 1254
132 Ga0070699_100459935 3300005518 Bacteria 1154
133 Ga0070684_100020749 3300005535 Bacteria 5451
134 Ga0070697_100008252 3300005536 Bacteria 8127
135 Ga0070697_100017129 3300005536 Bacteria 5700
136 Ga0070697_100031238 3300005536 Bacteria 4282
137 Ga0070697_100091856 3300005536 Bacteria 2510
138 Ga0070697_100111773 3300005536 Bacteria 2277
139 Ga0070697_100153070 3300005536 Bacteria 1945
140 Ga0070697_100196695 3300005536 Unclassified 1713
141 Ga0070697_100285509 3300005536 Unclassified 1416
142 Ga0070697_100436634 3300005536 Unclassified 1139
143 Ga0070672_100006829 3300005543 Bacteria 7705
144 Ga0070672_100068571 3300005543 Bacteria 2813
145 Ga0070672_100276068 3300005543 Unclassified 1420
146 Ga0070672_100538620 3300005543 Bacteria 1013
147 Ga0070672_100940095 3300005543 Unclassified 765
148 Ga0070686_100247046 3300005544 Bacteria 1302
149 Ga0070695_100036039 3300005545 Bacteria 3112
150 Ga0070695_100165480 3300005545 Bacteria 1556
151 Ga0070665_100022042 3300005548 Bacteria 6408
152 Ga0070665_100036265 3300005548 Bacteria 4961
153 Ga0070665_100096131 3300005548 Bacteria 2967
154 Ga0070665_100100057 3300005548 Bacteria 2903
155 Ga0070704_100683428 3300005549 Bacteria 909
156 Ga0070664_100073183 3300005564 Bacteria 2939
157 Ga0070664_100126150 3300005564 Bacteria 2245
158 Ga0070664_100199572 3300005564 Bacteria 1785
159 Ga0068857_101073209 3300005577 Bacteria 777
160 Ga0068864_100191491 3300005618 Bacteria 1875
161 Ga0068864_100464665 3300005618 Bacteria 1212
162 Ga0068861_100635320 3300005719 Bacteria 984
163 Ga0068863_100003873 3300005841 Bacteria 14801
164 Ga0068858_100220339 3300005842 Bacteria 1797
165 Ga0068860_100113339 3300005843 Bacteria 2592
166 Ga0068862_100026706 3300005844 Bacteria 4855
167 Ga0081455_10000647 3300005937 Bacteria 45079
168 Ga0081455_10032916 3300005937 Bacteria 4664
169 Ga0081455_10059139 3300005937 Bacteria 3238
170 Ga0081455_10142384 3300005937 Bacteria 1860
171 Ga0081455_10190142 3300005937 Unclassified 1546
172 Ga0081540_1000014 3300005983 Bacteria 179266
173 Ga0081540_1036361 3300005983 Bacteria 2627
174 Ga0081540_1080517 3300005983 Unclassified 1468
175 Ga0081539_10000564 3300005985 Bacteria 76514
176 Ga0081539_10001102 3300005985 Bacteria 49012
177 Ga0081539_10010245 3300005985 Bacteria 7659
178 Ga0081539_10032544 3300005985 Unclassified 3192
179 Ga0070717_10000353 3300006028 Bacteria 29605
180 Ga0070717_10008184 3300006028 Bacteria 7807
181 Ga0070717_10051553 3300006028 Bacteria 3387
182 Ga0070717_10062157 3300006028 Bacteria 3097
183 Ga0070717_10070902 3300006028 Unclassified 2905
184 Ga0070717_10173846 3300006028 Bacteria 1874
185 Ga0070717_10230527 3300006028 Bacteria 1630
186 Ga0070715_10106341 3300006163 Bacteria 1317
187 Ga0070716_100091110 3300006173 Bacteria 1846
188 Ga0070716_100542180 3300006173 Bacteria 866
189 Ga0070712_100007800 3300006175 Bacteria 6701
190 Ga0070712_100049932 3300006175 Bacteria 2908
191 Ga0070712_100077922 3300006175 Bacteria 2390
192 Ga0070712_100102210 3300006175 Bacteria 2122
193 Ga0070712_100128862 3300006175 Bacteria 1915
194 Ga0070712_100139964 3300006175 Unclassified 1845
195 Ga0097621_100014396 3300006237 Bacteria 5920
196 Ga0097621_100019458 3300006237 Bacteria 5210
197 Ga0097621_100173159 3300006237 Bacteria 1861
198 Ga0097621_100216859 3300006237 Bacteria 1666
199 Ga0068871_100013205 3300006358 Bacteria 6126
200 Ga0068871_100048226 3300006358 Bacteria 3437
201 Ga0068871_100071954 3300006358 Bacteria 2846
202 Ga0075434_100221707 3300006871 Bacteria 1911
203 Ga0075434_100228657 3300006871 Unclassified 1879
204 Ga0068865_100152430 3300006881 Bacteria 1755
205 Ga0075436_100169426 3300006914 Bacteria 1542
206 Ga0105240_10851958 3300009093 Bacteria 984
207 Ga0111539_11346821 3300009094 Unclassified 828
208 Ga0105245_10016101 3300009098 Bacteria 6515
209 Ga0105245_10016127 3300009098 Bacteria 6510
210 Ga0105245_10265523 3300009098 Unclassified 1672
211 Ga0105245_10627130 3300009098 Bacteria 1104
212 Ga0114129_10000103 3300009147 Bacteria 83612
213 Ga0114129_10146941 3300009147 Bacteria 3228
214 Ga0105243_10187082 3300009148 Bacteria 1806
215 Ga0105242_10358675 3300009176 Unclassified 1349
216 Ga0105248_10510440 3300009177 Unclassified 1356
217 Ga0105248_11486792 3300009177 Unclassified 767
218 Ga0105237_10358869 3300009545 Bacteria 1462
219 Ga0105249_10009172 3300009553 Bacteria 8649
220 Ga0105249_10177632 3300009553 Unclassified 2069
221 Ga0099796_10038899 3300010159 Bacteria 1598
222 Ga0105239_10035872 3300010375 Bacteria 5445
223 Ga0105239_10600289 3300010375 Bacteria 1256
224 Ga0105246_10129039 3300011119 Bacteria 1885
225 Ga0105246_10395519 3300011119 Bacteria 1146
226 Ga0157373_10521910 3300013100 Unclassified 859
227 Ga0157370_10101583 3300013104 Unclassified 2693
228 Ga0157369_10035621 3300013105 Bacteria 5455
229 Ga0157374_10011540 3300013296 Bacteria 7657
230 Ga0157374_10031354 3300013296 Bacteria 4831
231 Ga0157374_10049705 3300013296 Bacteria 3895
232 Ga0157374_10088218 3300013296 Bacteria 2954
233 Ga0157374_10098012 3300013296 Unclassified 2806
234 Ga0157374_10122434 3300013296 Bacteria 2512
235 Ga0157374_10522793 3300013296 Unclassified 1193
236 Ga0157378_10008152 3300013297 Bacteria 9142
237 Ga0157378_10027826 3300013297 Bacteria 4986
238 Ga0157378_10060976 3300013297 Bacteria 3365
239 Ga0157378_10061483 3300013297 Bacteria 3352
240 Ga0157378_10107029 3300013297 Unclassified 2558
241 Ga0157378_10115079 3300013297 Bacteria 2471
242 Ga0157378_10160039 3300013297 Bacteria 2105
243 Ga0157378_10295679 3300013297 Bacteria 1565
244 Ga0163162_10022200 3300013306 Bacteria 6256
245 Ga0163162_10023016 3300013306 Bacteria 6144
246 Ga0163162_10036991 3300013306 Bacteria 4869
247 Ga0163162_10089840 3300013306 Bacteria 3153
248 Ga0163162_10185324 3300013306 Bacteria 2208
249 Ga0163162_10366580 3300013306 Bacteria 1574
250 Ga0163162_10636183 3300013306 Unclassified 1191
251 Ga0163162_10638633 3300013306 Bacteria 1189
252 Ga0157372_10024418 3300013307 Bacteria 6565
253 Ga0157372_10068559 3300013307 Bacteria 3988
254 Ga0157372_10129331 3300013307 Unclassified 2904
255 Ga0157372_10476037 3300013307 Bacteria 1456
256 Ga0157372_10536017 3300013307 Unclassified 1364
257 Ga0157372_11309381 3300013307 Bacteria 836
258 Ga0157372_11315645 3300013307 Unclassified 834
259 Ga0157375_10003875 3300013308 Bacteria 12982
260 Ga0157375_10104826 3300013308 Bacteria 2917
261 Ga0157375_10495790 3300013308 Unclassified 1386
262 Ga0157375_10518026 3300013308 Unclassified 1356
263 Ga0157375_10891107 3300013308 Bacteria 1034
264 Ga0163163_10388754 3300014325 Bacteria 1453
265 Ga0182008_10108221 3300014497 Bacteria 1376
266 Ga0157377_10410131 3300014745 Bacteria 925
267 Ga0157379_10448645 3300014968 Unclassified 1190
268 Ga0157376_10055041 3300014969 Bacteria 3319
269 Ga0157376_10091861 3300014969 Bacteria 2630
270 Ga0157376_10178239 3300014969 Unclassified 1940
271 Ga0157376_10333108 3300014969 Bacteria 1447
272 Ga0157376_10439351 3300014969 Bacteria 1270
273 Ga0182007_10049199 3300015262 Bacteria 1393
274 Ga0163161_10307784 3300017792 Bacteria 1249
275 Ga0213874_10138870 3300021377 Bacteria 840
276 Ga0207666_1003095 3300025271 Unclassified 2027
277 Ga0207666_1038686 3300025271 Bacteria 743
278 Ga0207673_1004566 3300025290 Bacteria 1661
279 Ga0207697_10000199 3300025315 Bacteria 32092
280 Ga0207697_10000361 3300025315 Bacteria 25436
281 Ga0207697_10009146 3300025315 Bacteria 4291
282 Ga0207697_10024264 3300025315 Bacteria 2483
283 Ga0207697_10040926 3300025315 Bacteria 1903
284 Ga0207697_10053115 3300025315 Unclassified 1678
285 Ga0207697_10091687 3300025315 Bacteria 1288
286 Ga0207697_10214750 3300025315 Bacteria 848
287 Ga0207653_10070544 3300025885 Bacteria 1193
288 Ga0207682_10046934 3300025893 Bacteria 1777
289 Ga0207688_10038259 3300025901 Bacteria 2662
290 Ga0207688_10057625 3300025901 Bacteria 2184
291 Ga0207680_10048758 3300025903 Bacteria 2517
292 Ga0207680_10375597 3300025903 Unclassified 1001
293 Ga0207699_10275439 3300025906 Unclassified 1167
294 Ga0207645_10001104 3300025907 Bacteria 22279
295 Ga0207645_10004341 3300025907 Bacteria 10501
296 Ga0207645_10016309 3300025907 Bacteria 4920
297 Ga0207645_10058141 3300025907 Bacteria 2469
298 Ga0207645_10068119 3300025907 Bacteria 2275
299 Ga0207645_10280174 3300025907 Bacteria 1107
300 Ga0207645_10539095 3300025907 Unclassified 791
301 Ga0207684_10000128 3300025910 Bacteria 139233
302 Ga0207684_10016286 3300025910 Bacteria 6383
303 Ga0207684_10020779 3300025910 Bacteria 5609
304 Ga0207684_10023451 3300025910 Bacteria 5269
305 Ga0207684_10028908 3300025910 Bacteria 4721
306 Ga0207684_10251709 3300025910 Bacteria 1524
307 Ga0207684_10290112 3300025910 Bacteria 1411
308 Ga0207684_10302933 3300025910 Bacteria 1378
309 Ga0207684_10679856 3300025910 Unclassified 876
310 Ga0207654_10150033 3300025911 Bacteria 1495
311 Ga0207693_10004299 3300025915 Bacteria 12062
312 Ga0207693_10054808 3300025915 Bacteria 3127
313 Ga0207693_10057085 3300025915 Unclassified 3060
314 Ga0207693_10094133 3300025915 Bacteria 2348
315 Ga0207693_10150166 3300025915 Unclassified 1832
316 Ga0207663_10065960 3300025916 Bacteria 2315
317 Ga0207663_10093637 3300025916 Unclassified 2000
318 Ga0207663_10098258 3300025916 Bacteria 1960
319 Ga0207663_10573697 3300025916 Unclassified 884
320 Ga0207660_10318158 3300025917 Unclassified 1242
321 Ga0207662_10001771 3300025918 Bacteria 10599
322 Ga0207649_10052099 3300025920 Bacteria 2538
323 Ga0207646_10002214 3300025922 Bacteria 23143
324 Ga0207646_10016016 3300025922 Bacteria 7048
325 Ga0207646_10079966 3300025922 Bacteria 2922
326 Ga0207646_10080188 3300025922 Bacteria 2919
327 Ga0207646_10090180 3300025922 Bacteria 2744
328 Ga0207646_10146623 3300025922 Unclassified 2127
329 Ga0207646_10192416 3300025922 Unclassified 1842
330 Ga0207646_10227170 3300025922 Unclassified 1686
331 Ga0207646_10365761 3300025922 Bacteria 1303
332 Ga0207681_10174773 3300025923 Unclassified 1631
333 Ga0207681_10344725 3300025923 Bacteria 1191
334 Ga0207681_10596711 3300025923 Bacteria 912
335 Ga0207650_10190049 3300025925 Bacteria 1640
336 Ga0207650_10241430 3300025925 Bacteria 1460
337 Ga0207650_10466493 3300025925 Unclassified 1052
338 Ga0207659_10055038 3300025926 Bacteria 2843
339 Ga0207659_10082186 3300025926 Unclassified 2384
340 Ga0207659_10169430 3300025926 Bacteria 1722
341 Ga0207659_10453101 3300025926 Unclassified 1081
342 Ga0207659_10838161 3300025926 Unclassified 790
343 Ga0207687_10049938 3300025927 Bacteria 2910
344 Ga0207700_10018530 3300025928 Bacteria 4681
345 Ga0207700_10307196 3300025928 Unclassified 1371
346 Ga0207664_10052699 3300025929 Bacteria 3218
347 Ga0207664_10412217 3300025929 Bacteria 1203
348 Ga0207644_10028785 3300025931 Unclassified 3850
349 Ga0207644_10058375 3300025931 Bacteria 2789
350 Ga0207644_10085969 3300025931 Bacteria 2334
351 Ga0207644_10243169 3300025931 Bacteria 1433
352 Ga0207690_10018410 3300025932 Bacteria 4283
353 Ga0207706_10001926 3300025933 Bacteria 20387
354 Ga0207706_10006587 3300025933 Bacteria 10756
355 Ga0207706_10072829 3300025933 Bacteria 3020
356 Ga0207706_10343136 3300025933 Bacteria 1299
357 Ga0207686_10261308 3300025934 Bacteria 1269
358 Ga0207670_10105611 3300025936 Bacteria 2019
359 Ga0207670_10153923 3300025936 Bacteria 1709
360 Ga0207670_10259262 3300025936 Bacteria 1347
361 Ga0207670_10340643 3300025936 Unclassified 1185
362 Ga0207704_10224997 3300025938 Bacteria 1391
363 Ga0207665_10019634 3300025939 Bacteria 4444
364 Ga0207665_10179498 3300025939 Bacteria 1533
365 Ga0207665_10433897 3300025939 Bacteria 1006
366 Ga0207691_10000297 3300025940 Bacteria 49253
367 Ga0207691_10112979 3300025940 Bacteria 2414
368 Ga0207691_10252749 3300025940 Bacteria 1521
369 Ga0207691_10642038 3300025940 Bacteria 897
370 Ga0207711_10290992 3300025941 Bacteria 1505
371 Ga0207689_10247579 3300025942 Bacteria 1474
372 Ga0207661_10308765 3300025944 Bacteria 1419
373 Ga0207661_10375589 3300025944 Bacteria 1286
374 Ga0207679_10069587 3300025945 Bacteria 2649
375 Ga0207679_10296444 3300025945 Unclassified 1392
376 Ga0207679_10329197 3300025945 Bacteria 1325
377 Ga0207679_10447408 3300025945 Unclassified 1145
378 Ga0207651_10028869 3300025960 Bacteria 3506
379 Ga0207651_10529240 3300025960 Bacteria 1022
380 Ga0207668_10463206 3300025972 Bacteria 1084
381 Ga0207668_10619180 3300025972 Bacteria 944
382 Ga0207640_10483474 3300025981 Bacteria 1028
383 Ga0207658_10141142 3300025986 Bacteria 1949
384 Ga0207658_10510740 3300025986 Bacteria 1071
385 Ga0207677_10074081 3300026023 Bacteria 2414
386 Ga0207677_10083175 3300026023 Unclassified 2303
387 Ga0207703_10085194 3300026035 Bacteria 2644
388 Ga0207678_10003530 3300026067 Bacteria 14066
389 Ga0207678_10528780 3300026067 Bacteria 1030
390 Ga0207678_10530077 3300026067 Bacteria 1028
391 Ga0207702_11190480 3300026078 Bacteria 756
392 Ga0207641_10027464 3300026088 Bacteria 4700
393 Ga0207641_10114150 3300026088 Unclassified 2400
394 Ga0207641_10264119 3300026088 Bacteria 1613
395 Ga0207648_10035589 3300026089 Bacteria 4387
396 Ga0207676_10446189 3300026095 Unclassified 1219
397 Ga0207674_10707230 3300026116 Unclassified 973
398 Ga0207675_100174129 3300026118 Bacteria 2058
399 Ga0207675_100326272 3300026118 Bacteria 1500
400 Ga0207683_10004680 3300026121 Bacteria 11790
401 Ga0207683_10049284 3300026121 Bacteria 3687
402 Ga0207683_10107876 3300026121 Bacteria 2491
403 Ga0207683_10455469 3300026121 Unclassified 1180
404 Ga0207683_10540419 3300026121 Bacteria 1077
405 Ga0207683_10725859 3300026121 Unclassified 921
406 Ga0210002_1006447 3300027617 Unclassified 1771
407 Ga0209998_10016256 3300027717 Unclassified 1565
408 Ga0209974_10004965 3300027876 Bacteria 4705
409 Ga0268266_10011382 3300028379 Bacteria 7736
410 Ga0268266_10014373 3300028379 Bacteria 6809
411 Ga0268266_10034277 3300028379 Bacteria 4318
412 Ga0268266_10040030 3300028379 Bacteria 3993
413 Ga0268266_10122343 3300028379 Unclassified 2317
414 Ga0268264_10380517 3300028381 Bacteria 1351
415 Ga0268264_10585938 3300028381 Bacteria 1098
416 Ga0307513_10092194 3300031456 Bacteria 3085
417 Ga0373926_0127380 3300035083 Unclassified 963
418 Ga0373944_0100244 3300035089 Bacteria 978
419 Ga0373944_0203705 3300035089 Unclassified 717
420 Ga0373923_0241730 3300035111 Bacteria 843
421 Ga0373936_0323214 3300035113 Unclassified 699
422 Ga0373945_0159192 3300035116 Unclassified 920
423 Ga0373953_0022603 3300035117 Unclassified 2373
424 Ga0373956_0100582 3300035119 Unclassified 1341
425 Ga0373957_0025941 3300035120 Bacteria 2116
426 Ga0373943_0033416 3300035170 Bacteria 2450
427 Ga0373943_0110426 3300035170 Bacteria 1450
428 Ga0373946_0196832 3300035171 Bacteria 964
429 Ga0373955_0215524 3300035172 Bacteria 1146
430 Ga0373955_0675570 3300035172 Unclassified 634
431 Ga0373931_0050071 3300035691 Bacteria 2222
432 Ga0373935_0021170 3300035692 Bacteria 3980
433 Ga0373935_0481147 3300035692 Unclassified 900
434 Ga0373927_0062462 3300035695 Bacteria 2409
435 Ga0373927_0066989 3300035695 Bacteria 2323
436 Ga0373933_0127191 3300035724 Bacteria 1600
437 Ga0373947_0042000 3300035725 Bacteria 2729
438 Ga0373947_0069696 3300035725 Unclassified 2153
439 Ga0373947_0078444 3300035725 Unclassified 2039
440 Ga0373947_0214234 3300035725 Bacteria 1264
441 Ga0373937_0026427 3300036401 Bacteria 5246
442 Ga0373937_0200769 3300036401 Unclassified 1874
443 Ga0373937_0213605 3300036401 Bacteria 1815
444 Ga0373937_0765825 3300036401 Unclassified 913
445 Ga0373925_0033326 3300037068 Bacteria 3796
446 Ga0373925_0034937 3300037068 Bacteria 3707
447 Ga0395899_0068042 3300037312 Unclassified 2612
448 Ga0395900_0071590 3300037418 Unclassified 3564
449 Ga0395900_0123722 3300037418 Bacteria 2653
450 Ga0395900_0204553 3300037418 Bacteria 1996
451 Ga0395900_0294071 3300037418 Unclassified 1612
452 Ga0395900_0752226 3300037418 Unclassified 905
453 Ga0395900_0807987 3300037418 Bacteria 865
454 Ga0395900_0839558 3300037418 Unclassified 845
455 Ga0395898_0054679 3300037466 Unclassified 3895
456 Ga0395898_0388523 3300037466 Bacteria 1331
457 Ga0395905_0046584 3300037471 Unclassified 4066
458 Ga0395905_1031607 3300037471 Unclassified 726
459 Ga0395901_0004662 3300038443 Bacteria 13824
460 Ga0395901_0420829 3300038443 Bacteria 1370
461 Ga0436363_1380724 3300039450 Bacteria 1175
462 Ga0436362_0212700 3300039453 Unclassified 839
463 Ga0436362_1270231 3300039453 Unclassified 883
464 Ga0451802_1626399 3300041460 Bacteria 966
465 Ga0451807_1257180 3300041486 Bacteria 1003
466 Ga0451807_2471656 3300041486 Bacteria 1084
467 Ga0451849_0862530 3300041505 Bacteria 851
468 Ga0439451_046201 3300042009 Unclassified 872
469 Ga0439455_0010287 3300042012 Bacteria 2055
470 Ga0439464_0053896 3300042439 Unclassified 1168
471 Ga0439440_0093212 3300042993 Unclassified 811
472 Ga0451576_0650283 3300045051 Bacteria 1108
473 Ga0451576_1538555 3300045051 Unclassified 691
474 Ga0466967_0378057 3300045976 Unclassified 1375
475 Ga0495592_0003865 3300046454 Bacteria 10834
476 Ga0495603_0334260 3300046455 Bacteria 869
477 Ga0495651_0134703 3300046462 Unclassified 1799
478 Ga0495580_0221345 3300046472 Unclassified 1301
479 Ga0495580_0407583 3300046472 Bacteria 916
480 Ga0495585_0255546 3300046492 Unclassified 873
481 Ga0495594_0251903 3300046499 Unclassified 1006
482 Ga0495618_0365988 3300046514 Bacteria 886
483 Ga0495628_0015946 3300046516 Bacteria 6269
484 Ga0495628_0059824 3300046516 Bacteria 2990
485 Ga0495630_0444516 3300046517 Unclassified 993
486 Ga0495642_0021269 3300046528 Bacteria 2552
487 Ga0495652_0008447 3300046529 Bacteria 9395
488 Ga0495652_0141167 3300046529 Bacteria 1894
489 Ga0495652_0155150 3300046529 Bacteria 1784
490 Ga0495640_0322673 3300046533 Bacteria 956
491 Ga0495598_0080839 3300046537 Bacteria 1042
492 Ga0495598_0100234 3300046537 Unclassified 957
493 Ga0495645_0003233 3300046543 Bacteria 11055
494 Ga0495645_0222791 3300046543 Bacteria 1268
495 Ga0495633_0220763 3300046558 Bacteria 868
496 Ga0495667_0297700 3300046559 Bacteria 1022
497 Ga0495659_0195166 3300046664 Bacteria 829
498 Ga0495599_0000832 3300046678 Bacteria 17422
499 Ga0495623_0017118 3300046679 Unclassified 4682
500 Ga0495646_0004443 3300046680 Bacteria 8834
501 Ga0495647_0035802 3300046681 Bacteria 1866
502 Ga0495658_0062726 3300046683 Bacteria 2137
503 Ga0495658_0080586 3300046683 Bacteria 1910
504 Ga0495669_0003285 3300046684 Bacteria 6656
505 Ga0495669_0112585 3300046684 Bacteria 1271
506 Ga0495613_0096564 3300046689 Bacteria 2137
507 Ga0495670_0274688 3300046691 Unclassified 901
508 Ga0495589_0257316 3300046794 Unclassified 815
509 Ga0495604_0045381 3300047317 Bacteria 3430
510 Ga0495604_0165026 3300047317 Unclassified 1562
511 Ga0495674_0161860 3300047319 Unclassified 1872
512 Ga0495680_0130223 3300047322 Unclassified 1850
513 Ga0495680_0333748 3300047322 Bacteria 1059
514 Ga0495675_0015154 3300047444 Unclassified 4873
515 Ga0495675_0097772 3300047444 Bacteria 1839
516 Ga0495677_0097641 3300047445 Unclassified 1110
517 Ga0495681_0266838 3300047470 Unclassified 671
518 Ga0495602_0014432 3300048088 Bacteria 8018
519 Ga0495602_0126951 3300048088 Bacteria 2042
520 Ga0496100_0056561 3300048903 Bacteria 2567
521 Ga0496100_0114596 3300048903 Bacteria 1878
522 Ga0496100_0377716 3300048903 Unclassified 1076
523 Ga0496100_0553672 3300048903 Unclassified 890
524 Ga0496101_0175545 3300048904 Unclassified 1648
525 Ga0496101_0796208 3300048904 Bacteria 745
526 Ga0496102_0519905 3300048905 Bacteria 1113
527 Ga0496104_0019656 3300048907 Bacteria 6185
528 Ga0496104_0154263 3300048907 Bacteria 2204
529 Ga0496104_0351975 3300048907 Unclassified 1386
530 Ga0496104_0564528 3300048907 Bacteria 1049
531 Ga0496104_0928805 3300048907 Bacteria 775
532 Ga0496105_0009303 3300048908 Bacteria 7679
533 Ga0496105_0103715 3300048908 Bacteria 2349
534 Ga0496105_0225614 3300048908 Unclassified 1524
535 Ga0496106_0052028 3300048909 Bacteria 3089
536 Ga0496107_0173404 3300048910 Unclassified 1601
537 Ga0496108_0169005 3300048911 Bacteria 1892
538 Ga0496108_0252980 3300048911 Bacteria 1533
539 Ga0496108_0261347 3300048911 Bacteria 1506
540 Ga0496108_0273317 3300048911 Unclassified 1471
541 Ga0496108_0308939 3300048911 Unclassified 1378
542 Ga0496108_0820208 3300048911 Unclassified 802
543 Ga0496109_0021610 3300048912 Bacteria 5693
544 Ga0496109_0266972 3300048912 Bacteria 1612
545 Ga0496109_0331936 3300048912 Bacteria 1436
546 Ga0496109_0500397 3300048912 Bacteria 1147
547 Ga0496109_0567710 3300048912 Unclassified 1070
548 Ga0496110_0335143 3300048913 Bacteria 1378
549 Ga0496111_0173809 3300048914 Unclassified 1601
550 Ga0496112_0018017 3300048915 Bacteria 6646
551 Ga0496112_0021439 3300048915 Bacteria 6145
552 Ga0496112_0029133 3300048915 Bacteria 5337
553 Ga0496112_0176012 3300048915 Bacteria 2105
554 Ga0496112_0200947 3300048915 Bacteria 1952
555 Ga0496112_0332613 3300048915 Bacteria 1463
556 Ga0496112_0628287 3300048915 Unclassified 1005
557 Ga0496112_0788717 3300048915 Unclassified 875
558 Ga0496113_0129912 3300048916 Bacteria 1976
559 Ga0496114_0394130 3300048917 Unclassified 1226
560 Ga0496114_0718885 3300048917 Unclassified 875
561 Ga0496115_0001790 3300048918 Bacteria 15389
562 Ga0496115_0041187 3300048918 Bacteria 3675
563 Ga0496115_0107407 3300048918 Unclassified 2291
564 Ga0496115_0123869 3300048918 Unclassified 2128
565 Ga0496115_0181091 3300048918 Viruses 1742
566 Ga0496115_0763613 3300048918 Bacteria 755
567 nmdc:mga05p37_277201_c1 3300050507 Bacteria 2001
568 nmdc:mga05p37_286196_c1 3300050507 Bacteria 1963
569 nmdc:mga05p37_406089_c1 3300050507 Bacteria 1589
570 nmdc:mga05p37_98781_c1 3300050507 Bacteria 3596
571 nmdc:mga08y16_1165126_c1 3300050511 Unclassified 743
572 nmdc:mga08y16_791716_c1 3300050511 Bacteria 941
573 nmdc:mga0n895_217581_c1 3300050512 Bacteria 1939
574 nmdc:mga0n895_559927_c1 3300050512 Bacteria 1148
575 nmdc:mga0n895_873565_c1 3300050512 Bacteria 886
576 nmdc:mga0rr50_124725_c1 3300050513 Bacteria 2054
577 nmdc:mga08x19_157238_c1 3300050514 Bacteria 1542
578 nmdc:mga08x19_89370_c1 3300050514 Bacteria 2031
579 Ga0495601_0010764 3300053077 Bacteria 5457
580 Ga0495612_0025665 3300053078 Unclassified 2366
581 Ga0495595_0087373 3300053084 Bacteria 1493
582 Ga0070670_100193598
583 CNXas_1000070
584 JGI25406J46586_10009757
585 JGI25405J52794_10003097
586 Ga0065712_10005355
587 Ga0065712_10008410
588 Ga0065712_10113213
589 Ga0065715_10017440
590 Ga0065715_10118519
591 Ga0065715_10119195
592 Ga0065715_10228677
593 Ga0065715_10439925
594 Ga0065715_10472939
595 Ga0065707_10023319
596 Ga0065707_10137370
597 Ga0070676_10020371
598 Ga0070676_10061364
599 Ga0070683_100029292
600 Ga0070683_100308121
601 Ga0070690_100067157
602 Ga0070690_100137715
603 Ga0070670_100063069
604 Ga0070670_100179956
605 Ga0070670_100195419
606 Ga0070666_10054562
607 Ga0070666_10108350
608 Ga0070666_10391106
609 Ga0070666_10486619
610 Ga0070680_100265146
611 Ga0068868_100241252
612 Ga0068868_100568895
613 Ga0070660_100117769
614 Ga0070689_100015152
615 Ga0070689_100145025
616 Ga0070689_100174788
617 Ga0070689_100355854
618 Ga0070689_100417189
619 Ga0070687_100008100
620 Ga0070661_100522441
621 Ga0070668_100009848
622 Ga0070668_100025430
623 Ga0070668_100034919
624 Ga0070668_100322549
625 Ga0070668_100645203
626 Ga0070668_100686224
627 Ga0070669_100009381
628 Ga0070669_100128639
629 Ga0070669_100163728
630 Ga0070675_100027739
631 Ga0070675_100037509
632 Ga0070675_100045612
633 Ga0070675_100327279
634 Ga0070675_100334689
635 Ga0070675_100381868
636 Ga0070675_100452360
637 Ga0070675_100484595
638 Ga0070671_100002816
639 Ga0070671_100005156
640 Ga0070671_100011152
641 Ga0070671_100105867
642 Ga0070671_100314924
643 Ga0070671_100635235
644 Ga0070674_100005120
645 Ga0070674_100007839
646 Ga0070674_100240111
647 Ga0070674_100619556
648 Ga0070673_100127183
649 Ga0070688_100003617
650 Ga0070688_100022994
651 Ga0070688_100174228
652 Ga0070659_100005840
653 Ga0070667_100006539
654 Ga0070667_100028918
655 Ga0070667_100035180
656 Ga0070709_10006361
657 Ga0070709_10218967
658 Ga0070714_100040405
659 Ga0070714_100281649
660 Ga0070714_101278431
661 Ga0070713_100062003
662 Ga0070710_10043463
663 Ga0070710_10133644
664 Ga0070711_100070902
665 Ga0070711_100103382
666 Ga0070711_100371782
667 Ga0070711_100515235
668 Ga0070705_100533317
669 Ga0070694_100267942
670 Ga0070708_100035407
671 Ga0070708_100041214
672 Ga0070708_100104187
673 Ga0070708_100107082
674 Ga0070708_100153509
675 Ga0070708_100342193
676 Ga0070708_101055704
677 Ga0070663_100144852
678 Ga0070663_100722183
679 Ga0070678_100090899
680 Ga0070678_100612702
681 Ga0070678_100851443
682 Ga0070662_100016352
683 Ga0070662_100081842
684 Ga0070662_100132984
685 Ga0070662_100153592
686 Ga0070662_100474240
687 Ga0070681_10017952
688 Ga0068867_100273744
689 Ga0070685_10032453
690 Ga0070685_10471007
691 Ga0070706_100000100
692 Ga0070706_100004978
693 Ga0070706_100031400
694 Ga0070706_100068165
695 Ga0070706_100220490
696 Ga0070706_100226300
697 Ga0070706_100820765
698 Ga0070707_100007577
699 Ga0070707_100017700
700 Ga0070707_100023598
701 Ga0070707_100034176
702 Ga0070707_100075061
703 Ga0070707_100103672
704 Ga0070707_100314990
705 Ga0070707_100509001
706 Ga0070698_100006265
707 Ga0070698_100009364
708 Ga0070698_100012789
709 Ga0070698_100032851
710 Ga0070699_100139377
711 Ga0070699_100276407
712 Ga0070699_100392727
713 Ga0070699_100459935
714 Ga0070684_100020749
715 Ga0070697_100008252
716 Ga0070697_100017129
717 Ga0070697_100031238
718 Ga0070697_100091856
719 Ga0070697_100111773
720 Ga0070697_100153070
721 Ga0070697_100196695
722 Ga0070697_100285509
723 Ga0070697_100436634
724 Ga0070672_100006829
725 Ga0070672_100068571
726 Ga0070672_100276068
727 Ga0070672_100538620
728 Ga0070672_100940095
729 Ga0070686_100247046
730 Ga0070695_100036039
731 Ga0070695_100165480
732 Ga0070665_100022042
733 Ga0070665_100036265
734 Ga0070665_100096131
735 Ga0070665_100100057
736 Ga0070704_100683428
737 Ga0070664_100073183
738 Ga0070664_100126150
739 Ga0070664_100199572
740 Ga0068857_101073209
741 Ga0068864_100191491
742 Ga0068864_100464665
743 Ga0068861_100635320
744 Ga0068863_100003873
745 Ga0068858_100220339
746 Ga0068860_100113339
747 Ga0068862_100026706
748 Ga0081455_10000647
749 Ga0081455_10032916
750 Ga0081455_10059139
751 Ga0081455_10142384
752 Ga0081455_10190142
753 Ga0081540_1000014
754 Ga0081540_1036361
755 Ga0081540_1080517
756 Ga0081539_10000564
757 Ga0081539_10001102
758 Ga0081539_10010245
759 Ga0081539_10032544
760 Ga0070717_10000353
761 Ga0070717_10008184
762 Ga0070717_10051553
763 Ga0070717_10062157
764 Ga0070717_10070902
765 Ga0070717_10173846
766 Ga0070717_10230527
767 Ga0070715_10106341
768 Ga0070716_100091110
769 Ga0070716_100542180
770 Ga0070712_100007800
771 Ga0070712_100049932
772 Ga0070712_100077922
773 Ga0070712_100102210
774 Ga0070712_100128862
775 Ga0070712_100139964
776 Ga0097621_100014396
777 Ga0097621_100019458
778 Ga0097621_100173159
779 Ga0097621_100216859
780 Ga0068871_100013205
781 Ga0068871_100048226
782 Ga0068871_100071954
783 Ga0075434_100221707
784 Ga0075434_100228657
785 Ga0068865_100152430
786 Ga0075436_100169426
787 Ga0105240_10851958
788 Ga0111539_11346821
789 Ga0105245_10016101
790 Ga0105245_10016127
791 Ga0105245_10265523
792 Ga0105245_10627130
793 Ga0114129_10000103
794 Ga0114129_10146941
795 Ga0105243_10187082
796 Ga0105242_10358675
797 Ga0105248_10510440
798 Ga0105248_11486792
799 Ga0105237_10358869
800 Ga0105249_10009172
801 Ga0105249_10177632
802 Ga0099796_10038899
803 Ga0105239_10035872
804 Ga0105239_10600289
805 Ga0105246_10129039
806 Ga0105246_10395519
807 Ga0157373_10521910
808 Ga0157370_10101583
809 Ga0157369_10035621
810 Ga0157374_10011540
811 Ga0157374_10031354
812 Ga0157374_10049705
813 Ga0157374_10088218
814 Ga0157374_10098012
815 Ga0157374_10122434
816 Ga0157374_10522793
817 Ga0157378_10008152
818 Ga0157378_10027826
819 Ga0157378_10060976
820 Ga0157378_10061483
821 Ga0157378_10107029
822 Ga0157378_10115079
823 Ga0157378_10160039
824 Ga0157378_10295679
825 Ga0163162_10022200
826 Ga0163162_10023016
827 Ga0163162_10036991
828 Ga0163162_10089840
829 Ga0163162_10185324
830 Ga0163162_10366580
831 Ga0163162_10636183
832 Ga0163162_10638633
833 Ga0157372_10024418
834 Ga0157372_10068559
835 Ga0157372_10129331
836 Ga0157372_10476037
837 Ga0157372_10536017
838 Ga0157372_11309381
839 Ga0157372_11315645
840 Ga0157375_10003875
841 Ga0157375_10104826
842 Ga0157375_10495790
843 Ga0157375_10518026
844 Ga0157375_10891107
845 Ga0163163_10388754
846 Ga0182008_10108221
847 Ga0157377_10410131
848 Ga0157379_10448645
849 Ga0157376_10055041
850 Ga0157376_10091861
851 Ga0157376_10178239
852 Ga0157376_10333108
853 Ga0157376_10439351
854 Ga0182007_10049199
855 Ga0163161_10307784
856 Ga0213874_10138870
857 Ga0207666_1003095
858 Ga0207666_1038686
859 Ga0207673_1004566
860 Ga0207697_10000199
861 Ga0207697_10000361
862 Ga0207697_10009146
863 Ga0207697_10024264
864 Ga0207697_10040926
865 Ga0207697_10053115
866 Ga0207697_10091687
867 Ga0207697_10214750
868 Ga0207653_10070544
869 Ga0207682_10046934
870 Ga0207688_10038259
871 Ga0207688_10057625
872 Ga0207680_10048758
873 Ga0207680_10375597
874 Ga0207699_10275439
875 Ga0207645_10001104
876 Ga0207645_10004341
877 Ga0207645_10016309
878 Ga0207645_10058141
879 Ga0207645_10068119
880 Ga0207645_10280174
881 Ga0207645_10539095
882 Ga0207684_10000128
883 Ga0207684_10016286
884 Ga0207684_10020779
885 Ga0207684_10023451
886 Ga0207684_10028908
887 Ga0207684_10251709
888 Ga0207684_10290112
889 Ga0207684_10302933
890 Ga0207684_10679856
891 Ga0207654_10150033
892 Ga0207693_10004299
893 Ga0207693_10054808
894 Ga0207693_10057085
895 Ga0207693_10094133
896 Ga0207693_10150166
897 Ga0207663_10065960
898 Ga0207663_10093637
899 Ga0207663_10098258
900 Ga0207663_10573697
901 Ga0207660_10318158
902 Ga0207662_10001771
903 Ga0207649_10052099
904 Ga0207646_10002214
905 Ga0207646_10016016
906 Ga0207646_10079966
907 Ga0207646_10080188
908 Ga0207646_10090180
909 Ga0207646_10146623
910 Ga0207646_10192416
911 Ga0207646_10227170
912 Ga0207646_10365761
913 Ga0207681_10174773
914 Ga0207681_10344725
915 Ga0207681_10596711
916 Ga0207650_10190049
917 Ga0207650_10241430
918 Ga0207650_10466493
919 Ga0207659_10055038
920 Ga0207659_10082186
921 Ga0207659_10169430
922 Ga0207659_10453101
923 Ga0207659_10838161
924 Ga0207687_10049938
925 Ga0207700_10018530
926 Ga0207700_10307196
927 Ga0207664_10052699
928 Ga0207664_10412217
929 Ga0207644_10028785
930 Ga0207644_10058375
931 Ga0207644_10085969
932 Ga0207644_10243169
933 Ga0207690_10018410
934 Ga0207706_10001926
935 Ga0207706_10006587
936 Ga0207706_10072829
937 Ga0207706_10343136
938 Ga0207686_10261308
939 Ga0207670_10105611
940 Ga0207670_10153923
941 Ga0207670_10259262
942 Ga0207670_10340643
943 Ga0207704_10224997
944 Ga0207665_10019634
945 Ga0207665_10179498
946 Ga0207665_10433897
947 Ga0207691_10000297
948 Ga0207691_10112979
949 Ga0207691_10252749
950 Ga0207691_10642038
951 Ga0207711_10290992
952 Ga0207689_10247579
953 Ga0207661_10308765
954 Ga0207661_10375589
955 Ga0207679_10069587
956 Ga0207679_10296444
957 Ga0207679_10329197
958 Ga0207679_10447408
959 Ga0207651_10028869
960 Ga0207651_10529240
961 Ga0207668_10463206
962 Ga0207668_10619180
963 Ga0207640_10483474
964 Ga0207658_10141142
965 Ga0207658_10510740
966 Ga0207677_10074081
967 Ga0207677_10083175
968 Ga0207703_10085194
969 Ga0207678_10003530
970 Ga0207678_10528780
971 Ga0207678_10530077
972 Ga0207702_11190480
973 Ga0207641_10027464
974 Ga0207641_10114150
975 Ga0207641_10264119
976 Ga0207648_10035589
977 Ga0207676_10446189
978 Ga0207674_10707230
979 Ga0207675_100174129
980 Ga0207675_100326272
981 Ga0207683_10004680
982 Ga0207683_10049284
983 Ga0207683_10107876
984 Ga0207683_10455469
985 Ga0207683_10540419
986 Ga0207683_10725859
987 Ga0210002_1006447
988 Ga0209998_10016256
989 Ga0209974_10004965
990 Ga0268266_10011382
991 Ga0268266_10014373
992 Ga0268266_10034277
993 Ga0268266_10040030
994 Ga0268266_10122343
995 Ga0268264_10380517
996 Ga0268264_10585938
997 Ga0307513_10092194
998 Ga0373926_0127380
999 Ga0373944_0100244
1000 Ga0373944_0203705
1001 Ga0373923_0241730
1002 Ga0373936_0323214
1003 Ga0373945_0159192
1004 Ga0373953_0022603
1005 Ga0373956_0100582
1006 Ga0373957_0025941
1007 Ga0373943_0033416
1008 Ga0373943_0110426
1009 Ga0373946_0196832
1010 Ga0373955_0215524
1011 Ga0373955_0675570
1012 Ga0373931_0050071
1013 Ga0373935_0021170
1014 Ga0373935_0481147
1015 Ga0373927_0062462
1016 Ga0373927_0066989
1017 Ga0373933_0127191
1018 Ga0373947_0042000
1019 Ga0373947_0069696
1020 Ga0373947_0078444
1021 Ga0373947_0214234
1022 Ga0373937_0026427
1023 Ga0373937_0200769
1024 Ga0373937_0213605
1025 Ga0373937_0765825
1026 Ga0373925_0033326
1027 Ga0373925_0034937
1028 Ga0395899_0068042
1029 Ga0395900_0071590
1030 Ga0395900_0123722
1031 Ga0395900_0204553
1032 Ga0395900_0294071
1033 Ga0395900_0752226
1034 Ga0395900_0807987
1035 Ga0395900_0839558
1036 Ga0395898_0054679
1037 Ga0395898_0388523
1038 Ga0395905_0046584
1039 Ga0395905_1031607
1040 Ga0395901_0004662
1041 Ga0395901_0420829
1042 Ga0436363_1380724
1043 Ga0436362_0212700
1044 Ga0436362_1270231
1045 Ga0451802_1626399
1046 Ga0451807_1257180
1047 Ga0451807_2471656
1048 Ga0451849_0862530
1049 Ga0439451_046201
1050 Ga0439455_0010287
1051 Ga0439464_0053896
1052 Ga0439440_0093212
1053 Ga0451576_0650283
1054 Ga0451576_1538555
1055 Ga0466967_0378057
1056 Ga0495592_0003865
1057 Ga0495603_0334260
1058 Ga0495651_0134703
1059 Ga0495580_0221345
1060 Ga0495580_0407583
1061 Ga0495585_0255546
1062 Ga0495594_0251903
1063 Ga0495618_0365988
1064 Ga0495628_0015946
1065 Ga0495628_0059824
1066 Ga0495630_0444516
1067 Ga0495642_0021269
1068 Ga0495652_0008447
1069 Ga0495652_0141167
1070 Ga0495652_0155150
1071 Ga0495640_0322673
1072 Ga0495598_0080839
1073 Ga0495598_0100234
1074 Ga0495645_0003233
1075 Ga0495645_0222791
1076 Ga0495633_0220763
1077 Ga0495667_0297700
1078 Ga0495659_0195166
1079 Ga0495599_0000832
1080 Ga0495623_0017118
1081 Ga0495646_0004443
1082 Ga0495647_0035802
1083 Ga0495658_0062726
1084 Ga0495658_0080586
1085 Ga0495669_0003285
1086 Ga0495669_0112585
1087 Ga0495613_0096564
1088 Ga0495670_0274688
1089 Ga0495589_0257316
1090 Ga0495604_0045381
1091 Ga0495604_0165026
1092 Ga0495674_0161860
1093 Ga0495680_0130223
1094 Ga0495680_0333748
1095 Ga0495675_0015154
1096 Ga0495675_0097772
1097 Ga0495677_0097641
1098 Ga0495681_0266838
1099 Ga0495602_0014432
1100 Ga0495602_0126951
1101 Ga0496100_0056561
1102 Ga0496100_0114596
1103 Ga0496100_0377716
1104 Ga0496100_0553672
1105 Ga0496101_0175545
1106 Ga0496101_0796208
1107 Ga0496102_0519905
1108 Ga0496104_0019656
1109 Ga0496104_0154263
1110 Ga0496104_0351975
1111 Ga0496104_0564528
1112 Ga0496104_0928805
1113 Ga0496105_0009303
1114 Ga0496105_0103715
1115 Ga0496105_0225614
1116 Ga0496106_0052028
1117 Ga0496107_0173404
1118 Ga0496108_0169005
1119 Ga0496108_0252980
1120 Ga0496108_0261347
1121 Ga0496108_0273317
1122 Ga0496108_0308939
1123 Ga0496108_0820208
1124 Ga0496109_0021610
1125 Ga0496109_0266972
1126 Ga0496109_0331936
1127 Ga0496109_0500397
1128 Ga0496109_0567710
1129 Ga0496110_0335143
1130 Ga0496111_0173809
1131 Ga0496112_0018017
1132 Ga0496112_0021439
1133 Ga0496112_0029133
1134 Ga0496112_0176012
1135 Ga0496112_0200947
1136 Ga0496112_0332613
1137 Ga0496112_0628287
1138 Ga0496112_0788717
1139 Ga0496113_0129912
1140 Ga0496114_0394130
1141 Ga0496114_0718885
1142 Ga0496115_0001790
1143 Ga0496115_0041187
1144 Ga0496115_0107407
1145 Ga0496115_0123869
1146 Ga0496115_0181091
1147 Ga0496115_0763613
1148 nmdc:mga05p37_277201_c1
1149 nmdc:mga05p37_286196_c1
1150 nmdc:mga05p37_406089_c1
1151 nmdc:mga05p37_98781_c1
1152 nmdc:mga08y16_1165126_c1
1153 nmdc:mga08y16_791716_c1
1154 nmdc:mga0n895_217581_c1
1155 nmdc:mga0n895_559927_c1
1156 nmdc:mga0n895_873565_c1
1157 nmdc:mga0rr50_124725_c1
1158 nmdc:mga08x19_157238_c1
1159 nmdc:mga08x19_89370_c1
1160 Ga0495601_0010764
1161 Ga0495612_0025665
1162 Ga0495595_0087373

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cda-assembly1.cif.gz_A-2 crystal structure of l34a czra in the zn(ii)bound state 0.9431 2 60
1sfx-assembly1.cif.gz_A x-ray crystal structure of putative hth transcription regulator from archaeoglobus fulgidus 0.9304 2 60
1r1u-assembly1.cif.gz_B crystal structure of the metal-sensing transcriptional repressor czra from staphylococcus aureus in the apo-form 0.923 3 60
1u2w-assembly1.cif.gz_A crystal structure of the staphylococcus aureus pi258 cadc 0.9159 2 60
3cuo-assembly2.cif.gz_C crystal structure of the predicted dna-binding transcriptional regulator from e. coli 0.9106 3 60
ID Description Score Start End Superfamily
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9375 13 45 1.10.10.10
af_Q58948_3_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9097 2 67 1.10.10.10
af_Q5QM91_2_83_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9081 6 59 1.10.10.10
2hoeA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8963 1 61 1.10.10.10
af_P71699_45_188_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8952 2 67 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V6HTW1-F1-model_v4 Transcriptional regulator 0.9864 2 68
AF-A0A7X7CCG5-F1-model_v4 ROK family transcriptional regulator 0.9762 3 60 GO:0003677
GO:0003700
GO:0003824
AF-A0A2V6E581-F1-model_v4 Transcriptional regulator 0.9746 86 199
AF-A0A2V6E581-F1-model_v4 Transcriptional regulator 0.9661 86 199
AF-A0A2V6EYD1-F1-model_v4 Transcriptional regulator 0.963 61 199

Map