F466007

General Info

Members Datasets Scaffolds Average Seq Length
580 249 559 174

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0193491|Ga0501047_0193491_865_1461
Length 198
Sequence MRPSPAPPARAVPRAPGTDAASSAHVLPDVLAPGLVLVFCGTAAGKRSAAEGAYYAHPGNLFWRALAEAGITPRRFAPQEFPLLPQLGIGLTDLAKRHSGNDDQLPPGAFDVPALAAKIERNAPRLLAFTSKNAARAALGHVIARYGPQDEAFGPARVFVLPSPSGQARGRWDLGPWLALGALYRRLRRQAAAQPRKR

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
5 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
6 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
7 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
8 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
9 2734482264 Dyella sp. AD052 Isolate Unclassified
10 2738543009 Luteibacter sp. OK325 Isolate Unclassified
11 2739367700 Dyella sp. YR388 Isolate Unclassified
12 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
13 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
14 2884411467 Dyella sp. AD56 Isolate Rhizosphere
15 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
16 2919085039 Luteibacter sp. 1214 Isolate Unclassified
17 2919404418 Luteibacter sp. 3190 Isolate Unclassified
18 2928963466 Dyella japonica 1073 Isolate Unclassified
19 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
20 2941471342 Luteibacter sp. 621 Isolate Unclassified
21 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
22 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
26 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
27 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
28 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
29 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
30 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
31 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
32 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
33 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
34 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
35 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
40 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
41 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
42 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
43 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
44 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
45 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
46 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
47 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
61 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
94 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
95 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
108 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
110 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
111 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
114 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
160 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
161 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
162 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
163 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
183 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
184 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
190 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
191 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
192 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
193 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
194 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
195 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
196 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
205 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
206 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
215 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
225 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
243 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
244 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
245 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
246 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
247 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
248 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.17
Metatranscriptomes 1.21
Isolates 3.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.72
Nodule 0
Rhizoplane 1.9
Rhizosphere 65.17
Stem 0
Stem Tuber 0
Unclassified 16.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1009175 3300001904 Bacteria 1636
2 JGI24740J21852_10014053 3300001979 Bacteria 2966
3 JGI24740J21852_10075340 3300001979 Bacteria 894
4 JGI24739J22299_10000118 3300001989 Bacteria 24899
5 JGI24737J22298_10001221 3300001990 Bacteria 9059
6 JGI24737J22298_10065931 3300001990 Bacteria 1085
7 JGI24735J21928_10030492 3300002067 Bacteria 1602
8 JGI24735J21928_10048387 3300002067 Bacteria 1230
9 JGI24738J21930_10034924 3300002075 Bacteria 1024
10 JGI24738J21930_10049666 3300002075 Unclassified 854
11 JGI25156J39149_1001202 3300002705 Bacteria 11469
12 JGI25156J39149_1001485 3300002705 Bacteria 9822
13 JGI25156J39149_1005444 3300002705 Bacteria 3667
14 JGI25156J39149_1021623 3300002705 Bacteria 1109
15 JGI25162J39368_1000434 3300002737 Bacteria 33632
16 JGI25162J39368_1001914 3300002737 Bacteria 9538
17 JGI25162J39368_1002093 3300002737 Bacteria 8539
18 JGI25162J39368_1002729 3300002737 Bacteria 6347
19 JGI25154J39366_1010309 3300002738 Bacteria 1112
20 JGI25157J39369_1000527 3300002741 Bacteria 23321
21 JGI25157J39369_1000572 3300002741 Bacteria 21913
22 JGI25157J39369_1000860 3300002741 Bacteria 14747
23 JGI25157J39369_1000944 3300002741 Bacteria 13694
24 JGI25157J39369_1001150 3300002741 Bacteria 11440
25 JGI25157J39369_1003026 3300002741 Bacteria 3667
26 JGI25157J39369_1012002 3300002741 Bacteria 1109
27 JGI25163J39215_1000622 3300002771 Bacteria 9724
28 JGI25164J39214_1000143 3300002772 Bacteria 68773
29 JGI25164J39214_1000312 3300002772 Bacteria 31934
30 JGI25164J39214_1000535 3300002772 Bacteria 17725
31 JGI25164J39214_1011449 3300002772 Bacteria 849
32 JGI25165J46597_1000257 3300003214 Bacteria 71080
33 JGI25165J46597_1000586 3300003214 Bacteria 31905
34 rootH1_10093510 3300003316 Bacteria 2465
35 rootH2_10137045 3300003320 Bacteria 1800
36 rootL2_10212903 3300003322 Bacteria 1690
37 rootH1_10375640 3300003323 Bacteria 1702
38 Ga0006562J51391_1018437 3300003578 Bacteria 12000
39 Ga0006562J51391_1018441 3300003578 Bacteria 1930
40 Ga0006562J51391_1075948 3300003578 Bacteria 5800
41 Ga0006562J51391_1075949 3300003578 Bacteria 2833
42 Ga0055538_1002632 3300003751 Bacteria 2547
43 Ga0055533_1000283 3300003756 Bacteria 26708
44 Ga0055525_1000111 3300003759 Bacteria 127836
45 Ga0055527_1000363 3300003760 Bacteria 21234
46 Ga0055527_1000432 3300003760 Bacteria 16833
47 Ga0055527_1001741 3300003760 Bacteria 4206
48 Ga0055535_1000390 3300003761 Bacteria 41593
49 Ga0055535_1000430 3300003761 Bacteria 39174
50 Ga0055535_1000869 3300003761 Bacteria 21233
51 Ga0055535_1000923 3300003761 Bacteria 19726
52 Ga0055535_1001073 3300003761 Bacteria 16833
53 Ga0055542_1000409 3300003762 Bacteria 41890
54 Ga0055542_1000540 3300003762 Bacteria 33632
55 Ga0055542_1000559 3300003762 Bacteria 32915
56 Ga0055542_1000629 3300003762 Bacteria 29615
57 Ga0055542_1000865 3300003762 Bacteria 21233
58 Ga0055542_1001072 3300003762 Bacteria 16833
59 Ga0055542_1010914 3300003762 Bacteria 1636
60 Ga0055529_1000211 3300003763 Bacteria 76826
61 Ga0055529_1000244 3300003763 Bacteria 66990
62 Ga0055529_1000280 3300003763 Bacteria 60448
63 Ga0055529_1000737 3300003763 Bacteria 21234
64 Ga0055529_1013331 3300003763 Bacteria 1046
65 Ga0065165_1000113 3300005262 Bacteria 135963
66 Ga0065165_1005347 3300005262 Bacteria 7290
67 Ga0070658_10001084 3300005327 Bacteria 23268
68 Ga0070666_10000018 3300005335 Bacteria 187218
69 Ga0070680_100870768 3300005336 Bacteria 777
70 Ga0070682_100116495 3300005337 Bacteria 1787
71 Ga0070682_100337552 3300005337 Bacteria 1119
72 Ga0070660_100015354 3300005339 Bacteria 5527
73 Ga0070660_100220485 3300005339 Bacteria 1541
74 Ga0070689_100006031 3300005340 Bacteria 8349
75 Ga0070661_100013038 3300005344 Bacteria 5828
76 Ga0070661_100363780 3300005344 Bacteria 1137
77 Ga0070661_100393602 3300005344 Unclassified 1094
78 Ga0070692_10016178 3300005345 Bacteria 3544
79 Ga0070659_100074507 3300005366 Bacteria 2704
80 Ga0070659_100363358 3300005366 Bacteria 1216
81 Ga0070659_101142372 3300005366 Bacteria 687
82 Ga0070667_100032024 3300005367 Bacteria 4384
83 Ga0070709_10130967 3300005434 Bacteria 1712
84 Ga0070714_100003062 3300005435 Bacteria 12403
85 Ga0070714_100012139 3300005435 Bacteria 6863
86 Ga0070714_100085598 3300005435 Bacteria 2753
87 Ga0070713_100008958 3300005436 Bacteria 7131
88 Ga0070710_10032219 3300005437 Bacteria 2838
89 Ga0070663_100053003 3300005455 Bacteria 2895
90 Ga0070663_100053108 3300005455 Bacteria 2892
91 Ga0070663_100241523 3300005455 Bacteria 1426
92 Ga0070663_100563614 3300005455 Bacteria 954
93 Ga0070663_100583513 3300005455 Unclassified 938
94 Ga0070663_100700258 3300005455 Unclassified 861
95 Ga0070662_100075947 3300005457 Bacteria 2489
96 Ga0070662_100852720 3300005457 Bacteria 776
97 Ga0070681_10011680 3300005458 Bacteria 8698
98 Ga0070681_10030069 3300005458 Bacteria 5450
99 Ga0070681_10967567 3300005458 Bacteria 771
100 Ga0070679_100039017 3300005530 Bacteria 4721
101 Ga0068853_100387278 3300005539 Bacteria 1306
102 Ga0068853_100638702 3300005539 Bacteria 1013
103 Ga0070696_100001026 3300005546 Bacteria 18027
104 Ga0070696_100107773 3300005546 Bacteria 2004
105 Ga0068855_100013790 3300005563 Bacteria 9743
106 Ga0068855_100046572 3300005563 Bacteria 5125
107 Ga0068855_100243506 3300005563 Bacteria 2008
108 Ga0068857_100000998 3300005577 Bacteria 21742
109 Ga0068857_100036672 3300005577 Bacteria 4344
110 Ga0068854_100001113 3300005578 Bacteria 16151
111 Ga0068854_100003601 3300005578 Bacteria 9691
112 Ga0068854_100024671 3300005578 Bacteria 4120
113 Ga0068854_100061134 3300005578 Bacteria 2727
114 Ga0068856_100000582 3300005614 Bacteria 39927
115 Ga0068856_100030736 3300005614 Bacteria 5251
116 Ga0068859_100183748 3300005617 Bacteria 2174
117 Ga0068851_10045776 3300005834 Bacteria 2212
118 Ga0068858_100003142 3300005842 Bacteria 16534
119 Ga0068858_100048183 3300005842 Bacteria 3949
120 Ga0068860_100431504 3300005843 Bacteria 1308
121 Ga0068862_100033999 3300005844 Bacteria 4312
122 Ga0097620_100183747 3300006931 Bacteria 2174
123 Ga0105240_10023357 3300009093 Bacteria 8180
124 Ga0105240_10038461 3300009093 Bacteria 6137
125 Ga0105240_10046303 3300009093 Bacteria 5512
126 Ga0105240_10113171 3300009093 Bacteria 3279
127 Ga0105247_10013285 3300009101 Bacteria 4942
128 Ga0105237_10000352 3300009545 Bacteria 64865
129 Ga0105237_10000675 3300009545 Bacteria 47159
130 Ga0105237_10104805 3300009545 Bacteria 2819
131 Ga0105238_10000319 3300009551 Bacteria 52428
132 Ga0105238_10134894 3300009551 Bacteria 2446
133 Ga0105238_10139480 3300009551 Bacteria 2402
134 Ga0105238_10158449 3300009551 Bacteria 2239
135 Ga0105238_10242673 3300009551 Bacteria 1779
136 Ga0105238_10434374 3300009551 Bacteria 1309
137 Ga0105238_10794666 3300009551 Bacteria 962
138 Ga0105239_10034580 3300010375 Bacteria 5550
139 Ga0105239_10051215 3300010375 Bacteria 4526
140 Ga0105239_10565946 3300010375 Bacteria 1295
141 Ga0157314_1000067 3300012500 Bacteria 10972
142 Ga0157373_10175488 3300013100 Bacteria 1508
143 Ga0157373_10220809 3300013100 Bacteria 1337
144 Ga0157373_10244559 3300013100 Bacteria 1268
145 Ga0157373_10350706 3300013100 Bacteria 1053
146 Ga0157371_10020571 3300013102 Bacteria 4856
147 Ga0157371_11044648 3300013102 Bacteria 625
148 Ga0157370_10005510 3300013104 Bacteria 14184
149 Ga0157370_10005522 3300013104 Bacteria 14176
150 Ga0157370_10020890 3300013104 Bacteria 6531
151 Ga0157370_10225550 3300013104 Bacteria 1735
152 Ga0157370_10385467 3300013104 Bacteria 1291
153 Ga0157370_10555975 3300013104 Bacteria 1052
154 Ga0157369_10013431 3300013105 Bacteria 9258
155 Ga0157369_10017478 3300013105 Bacteria 8059
156 Ga0157369_10077917 3300013105 Bacteria 3552
157 Ga0163162_10001986 3300013306 Bacteria 19222
158 Ga0163162_10044158 3300013306 Bacteria 4463
159 Ga0157372_10078548 3300013307 Bacteria 3729
160 Ga0157372_10187634 3300013307 Bacteria 2394
161 Ga0157372_10579649 3300013307 Bacteria 1308
162 Ga0157372_11580578 3300013307 Bacteria 755
163 Ga0182008_10024600 3300014497 Bacteria 3064
164 Ga0182008_10104256 3300014497 Bacteria 1403
165 Ga0182008_10117096 3300014497 Bacteria 1322
166 Ga0182008_10128417 3300014497 Bacteria 1263
167 Ga0182008_10175347 3300014497 Bacteria 1083
168 Ga0182006_1000223 3300015261 Bacteria 55257
169 Ga0182006_1030240 3300015261 Bacteria 2189
170 Ga0182006_1041204 3300015261 Bacteria 1814
171 Ga0182007_10017898 3300015262 Bacteria 2579
172 Ga0182007_10020699 3300015262 Bacteria 2347
173 Ga0182007_10056977 3300015262 Bacteria 1283
174 Ga0182007_10070933 3300015262 Bacteria 1141
175 Ga0182007_10094659 3300015262 Bacteria 985
176 Ga0182007_10100133 3300015262 Bacteria 959
177 Ga0182005_1000228 3300015265 Bacteria 36744
178 Ga0182005_1004950 3300015265 Bacteria 4223
179 Ga0182005_1014663 3300015265 Bacteria 2192
180 Ga0182005_1047758 3300015265 Bacteria 1163
181 Ga0183369_1007 3300015685 Bacteria 414878
182 Ga0183368_1002 3300015687 Bacteria 1865598
183 Ga0163161_10016902 3300017792 Bacteria 5099
184 Ga0197907_10972301 3300020069 Bacteria 1451
185 Ga0206356_11478499 3300020070 Bacteria 5285
186 Ga0206353_11923352 3300020082 Bacteria 2583
187 Ga0209760_100556 3300025207 Bacteria 6860
188 Ga0209784_100167 3300025224 Bacteria 56563
189 Ga0209566_108076 3300025225 Bacteria 1152
190 Ga0209674_100043 3300025226 Bacteria 369728
191 Ga0209674_100407 3300025226 Bacteria 21399
192 Ga0209674_100902 3300025226 Bacteria 9606
193 Ga0209674_102072 3300025226 Bacteria 4567
194 Ga0209672_100004 3300025228 Bacteria 1467504
195 Ga0209672_100029 3300025228 Bacteria 339298
196 Ga0209672_100143 3300025228 Bacteria 67036
197 Ga0209672_100738 3300025228 Bacteria 15999
198 Ga0209672_101903 3300025228 Bacteria 6039
199 Ga0209672_110773 3300025228 Bacteria 1217
200 Ga0209563_100103 3300025230 Bacteria 151835
201 Ga0207427_100144 3300025231 Bacteria 82742
202 Ga0207427_100209 3300025231 Bacteria 53322
203 Ga0207427_100327 3300025231 Bacteria 31981
204 Ga0207427_105019 3300025231 Bacteria 1990
205 Ga0209437_100020 3300025233 Bacteria 656374
206 Ga0209437_100193 3300025233 Bacteria 122027
207 Ga0209437_100256 3300025233 Bacteria 82734
208 Ga0209437_100465 3300025233 Bacteria 31828
209 Ga0209437_108993 3300025233 Bacteria 1575
210 Ga0209258_100003 3300025242 Bacteria 1467504
211 Ga0209258_100053 3300025242 Bacteria 339233
212 Ga0209258_100149 3300025242 Bacteria 162184
213 Ga0209258_100329 3300025242 Bacteria 71786
214 Ga0209258_100407 3300025242 Bacteria 52342
215 Ga0209258_101049 3300025242 Bacteria 12182
216 Ga0209258_102073 3300025242 Bacteria 5682
217 Ga0209646_1001715 3300025246 Bacteria 5541
218 Ga0209646_1002822 3300025246 Bacteria 3659
219 Ga0209646_1004407 3300025246 Bacteria 2570
220 Ga0209646_1007805 3300025246 Bacteria 1736
221 Ga0209026_1000060 3300025250 Bacteria 220052
222 Ga0209026_1000098 3300025250 Bacteria 161845
223 Ga0209026_1000274 3300025250 Bacteria 61312
224 Ga0209026_1000293 3300025250 Bacteria 55650
225 Ga0209026_1000516 3300025250 Bacteria 27200
226 Ga0209026_1005183 3300025250 Bacteria 3578
227 Ga0209677_102308 3300025253 Bacteria 7335
228 Ga0209148_1000002 3300025254 Bacteria 2399500
229 Ga0209148_1000009 3300025254 Bacteria 1395625
230 Ga0209148_1000010 3300025254 Bacteria 1265567
231 Ga0209148_1000025 3300025254 Bacteria 663262
232 Ga0209148_1000039 3300025254 Bacteria 482479
233 Ga0209148_1000143 3300025254 Bacteria 162184
234 Ga0209148_1001049 3300025254 Bacteria 17095
235 Ga0209759_1000658 3300025256 Bacteria 32027
236 Ga0209759_1000668 3300025256 Bacteria 31765
237 Ga0209759_1001181 3300025256 Bacteria 16384
238 Ga0209759_1005375 3300025256 Bacteria 4506
239 Ga0209759_1008242 3300025256 Bacteria 3265
240 Ga0209759_1034101 3300025256 Bacteria 955
241 Ga0209129_1000766 3300025258 Bacteria 20440
242 Ga0209129_1009423 3300025258 Bacteria 2575
243 Ga0209233_1000009 3300025261 Bacteria 1265567
244 Ga0209233_1000020 3300025261 Bacteria 798224
245 Ga0209233_1000151 3300025261 Bacteria 176515
246 Ga0209233_1007475 3300025261 Bacteria 3458
247 Ga0209455_1000004 3300025272 Bacteria 1467504
248 Ga0209455_1000034 3300025272 Bacteria 483129
249 Ga0209455_1000060 3300025272 Bacteria 339298
250 Ga0209455_1000086 3300025272 Bacteria 244650
251 Ga0209455_1000095 3300025272 Bacteria 217487
252 Ga0209455_1010803 3300025272 Bacteria 2295
253 Ga0209455_1014179 3300025272 Bacteria 1815
254 Ga0209758_1000812 3300025297 Bacteria 43987
255 Ga0209758_1120924 3300025297 Bacteria 707
256 Ga0209051_1022835 3300025303 Bacteria 2621
257 Ga0207692_10027067 3300025898 Bacteria 2696
258 Ga0207710_10003795 3300025900 Bacteria 6677
259 Ga0207680_10000002 3300025903 Bacteria 1018646
260 Ga0207647_10000228 3300025904 Bacteria 46540
261 Ga0207647_10002628 3300025904 Bacteria 13590
262 Ga0207647_10021560 3300025904 Bacteria 4300
263 Ga0207647_10049605 3300025904 Bacteria 2603
264 Ga0207699_10117469 3300025906 Bacteria 1715
265 Ga0207705_10002226 3300025909 Bacteria 14973
266 Ga0207705_10016407 3300025909 Bacteria 5310
267 Ga0207707_10013804 3300025912 Bacteria 7045
268 Ga0207695_10003135 3300025913 Bacteria 23618
269 Ga0207695_10009256 3300025913 Bacteria 12203
270 Ga0207695_10042600 3300025913 Bacteria 4845
271 Ga0207695_10080322 3300025913 Bacteria 3303
272 Ga0207671_10000021 3300025914 Bacteria 300409
273 Ga0207671_10001518 3300025914 Bacteria 26689
274 Ga0207657_10111058 3300025919 Bacteria 2264
275 Ga0207657_10141324 3300025919 Bacteria 1966
276 Ga0207657_10312938 3300025919 Bacteria 1243
277 Ga0207657_10342392 3300025919 Bacteria 1180
278 Ga0207649_10017391 3300025920 Bacteria 4074
279 Ga0207649_10134976 3300025920 Bacteria 1681
280 Ga0207649_10340022 3300025920 Unclassified 1108
281 Ga0207649_10439231 3300025920 Bacteria 983
282 Ga0207694_10000388 3300025924 Bacteria 40972
283 Ga0207694_10077903 3300025924 Bacteria 2598
284 Ga0207694_10079355 3300025924 Bacteria 2574
285 Ga0207694_10100095 3300025924 Bacteria 2296
286 Ga0207694_10130122 3300025924 Bacteria 2017
287 Ga0207700_10144494 3300025928 Bacteria 1959
288 Ga0207664_10001322 3300025929 Bacteria 16316
289 Ga0207664_10001329 3300025929 Bacteria 16293
290 Ga0207664_10152943 3300025929 Bacteria 1961
291 Ga0207690_10002706 3300025932 Bacteria 10697
292 Ga0207690_10011239 3300025932 Bacteria 5346
293 Ga0207690_10012135 3300025932 Bacteria 5155
294 Ga0207690_10245677 3300025932 Bacteria 1380
295 Ga0207706_10044623 3300025933 Bacteria 3929
296 Ga0207706_10282740 3300025933 Bacteria 1446
297 Ga0207706_10576527 3300025933 Bacteria 967
298 Ga0207706_10852087 3300025933 Bacteria 772
299 Ga0207670_10003893 3300025936 Bacteria 7963
300 Ga0207667_10000737 3300025949 Bacteria 42563
301 Ga0207667_10002458 3300025949 Bacteria 23165
302 Ga0207667_10193917 3300025949 Bacteria 2084
303 Ga0207667_10993606 3300025949 Bacteria 827
304 Ga0207667_11323550 3300025949 Bacteria 696
305 Ga0207668_10227036 3300025972 Bacteria 1503
306 Ga0207640_10000095 3300025981 Bacteria 69753
307 Ga0207640_10003159 3300025981 Bacteria 8866
308 Ga0207640_10014885 3300025981 Bacteria 4488
309 Ga0207640_10335726 3300025981 Bacteria 1209
310 Ga0207658_10222345 3300025986 Bacteria 1589
311 Ga0207703_10013607 3300026035 Bacteria 6341
312 Ga0207639_10143187 3300026041 Bacteria 1994
313 Ga0207678_10043258 3300026067 Bacteria 3898
314 Ga0207678_10053142 3300026067 Bacteria 3492
315 Ga0207678_10111625 3300026067 Bacteria 2332
316 Ga0207678_10681408 3300026067 Unclassified 904
317 Ga0207702_10000132 3300026078 Bacteria 88794
318 Ga0207702_10000718 3300026078 Bacteria 35528
319 Ga0207674_10002447 3300026116 Bacteria 23450
320 Ga0207674_10041964 3300026116 Bacteria 4728
321 Ga0207674_10313573 3300026116 Bacteria 1518
322 Ga0268266_10000004 3300028379 Bacteria 1495817
323 Ga0268265_10019013 3300028380 Bacteria 4770
324 Ga0268264_10460845 3300028381 Bacteria 1233
325 Ga0307517_10106765 3300028786 Bacteria 2163
326 Ga0307405_10271708 3300031731 Bacteria 1271
327 Ga0307413_10317349 3300031824 Bacteria 1189
328 Ga0307412_10008842 3300031911 Bacteria 5766
329 Ga0307510_10005448 3300033180 Bacteria 15156
330 Ga0307510_10036409 3300033180 Bacteria 5476
331 Ga0395899_0000068 3300037312 Bacteria 202264
332 Ga0395899_0003136 3300037312 Bacteria 13152
333 Ga0395899_0037111 3300037312 Bacteria 3653
334 Ga0395899_0060697 3300037312 Bacteria 2785
335 Ga0395899_0113194 3300037312 Bacteria 1949
336 Ga0395900_0382753 3300037418 Bacteria 1374
337 Ga0395900_0537975 3300037418 Bacteria 1114
338 Ga0395900_1009231 3300037418 Bacteria 752
339 Ga0395898_0000558 3300037466 Bacteria 69802
340 Ga0395898_0000600 3300037466 Bacteria 66858
341 Ga0395898_0007440 3300037466 Bacteria 11622
342 Ga0395898_0068334 3300037466 Bacteria 3438
343 Ga0395898_0415275 3300037466 Bacteria 1282
344 Ga0395901_0001533 3300038443 Bacteria 23956
345 Ga0395901_0009999 3300038443 Bacteria 9614
346 Ga0395901_0015703 3300038443 Bacteria 7714
347 Ga0395901_0059771 3300038443 Bacteria 3965
348 Ga0395901_0206482 3300038443 Bacteria 2057
349 Ga0395901_0607444 3300038443 Bacteria 1102
350 Ga0439436_0000010 3300041404 Bacteria 104480
351 Ga0439465_0001623 3300041413 Bacteria 7321
352 Ga0451793_1564549 3300041452 Bacteria 3988
353 Ga0451802_0494732 3300041460 Bacteria 774
354 Ga0439448_0084631 3300042005 Bacteria 1068
355 Ga0439432_056434 3300042006 Bacteria 1217
356 Ga0466969_0002795 3300044656 Bacteria 9322
357 Ga0466969_0016222 3300044656 Bacteria 3901
358 Ga0466969_0024665 3300044656 Bacteria 3094
359 Ga0466972_0318676 3300044658 Bacteria 726
360 Ga0466982_0000005 3300044672 Bacteria 364340
361 Ga0466982_0000059 3300044672 Bacteria 30023
362 Ga0466965_0003379 3300044683 Bacteria 6989
363 Ga0466965_0254167 3300044683 Bacteria 943
364 Ga0466966_0002888 3300044684 Bacteria 11330
365 Ga0466966_0006724 3300044684 Bacteria 7616
366 Ga0466966_0042154 3300044684 Bacteria 2931
367 Ga0466961_0007178 3300044693 Bacteria 7088
368 Ga0466961_0049701 3300044693 Bacteria 2679
369 Ga0466961_0394083 3300044693 Bacteria 840
370 Ga0466961_0533300 3300044693 Unclassified 707
371 Ga0466963_0065789 3300044694 Bacteria 2431
372 Ga0466963_0753279 3300044694 Unclassified 687
373 Ga0466964_0007368 3300044706 Bacteria 4114
374 Ga0466971_0000868 3300044719 Bacteria 12384
375 Ga0466971_0009485 3300044719 Bacteria 4249
376 Ga0466968_0014483 3300044735 Bacteria 3117
377 Ga0466970_0044712 3300044765 Bacteria 2357
378 Ga0466970_0050452 3300044765 Bacteria 2219
379 Ga0466970_0058181 3300044765 Bacteria 2068
380 Ga0466970_0127624 3300044765 Bacteria 1395
381 Ga0466957_0012485 3300044842 Bacteria 4916
382 Ga0466957_0027616 3300044842 Bacteria 3374
383 Ga0466957_0102791 3300044842 Bacteria 1803
384 Ga0466960_0000662 3300044901 Bacteria 11973
385 Ga0466959_0000131 3300045049 Bacteria 48526
386 Ga0466959_0011100 3300045049 Bacteria 6464
387 Ga0466959_0028532 3300045049 Bacteria 4138
388 Ga0466959_0048446 3300045049 Bacteria 3122
389 Ga0466959_0721859 3300045049 Bacteria 667
390 Ga0466958_0008396 3300045836 Bacteria 5726
391 Ga0466958_0026487 3300045836 Bacteria 3427
392 Ga0466967_0340317 3300045976 Bacteria 1450
393 Ga0495617_000882 3300046452 Bacteria 14118
394 Ga0495617_001439 3300046452 Bacteria 10453
395 Ga0495638_0000007 3300046460 Bacteria 602783
396 Ga0495638_0001066 3300046460 Bacteria 26750
397 Ga0495638_0001368 3300046460 Bacteria 22358
398 Ga0495638_0001395 3300046460 Bacteria 22035
399 Ga0495638_0114140 3300046460 Bacteria 1602
400 Ga0495638_0297329 3300046460 Bacteria 871
401 Ga0495650_0000202 3300046471 Bacteria 129910
402 Ga0495650_0000637 3300046471 Bacteria 46877
403 Ga0495650_0004341 3300046471 Bacteria 9773
404 Ga0495650_0005105 3300046471 Bacteria 8680
405 Ga0495584_0000625 3300046491 Bacteria 23650
406 Ga0495585_0000938 3300046492 Bacteria 24597
407 Ga0495585_0010697 3300046492 Bacteria 5449
408 Ga0495607_0000098 3300046501 Bacteria 92012
409 Ga0495607_0000430 3300046501 Bacteria 42487
410 Ga0495607_0017253 3300046501 Bacteria 4639
411 Ga0495607_0062472 3300046501 Bacteria 2111
412 Ga0495583_0007068 3300046506 Bacteria 7173
413 Ga0495606_0001329 3300046507 Bacteria 33751
414 Ga0495606_0002701 3300046507 Bacteria 20033
415 Ga0495606_0003017 3300046507 Bacteria 18439
416 Ga0495606_0045238 3300046507 Bacteria 2919
417 Ga0495606_0098057 3300046507 Bacteria 1789
418 Ga0495610_0005146 3300046512 Bacteria 9384
419 Ga0495616_0001848 3300046513 Bacteria 14329
420 Ga0495616_0028122 3300046513 Bacteria 2978
421 Ga0495620_0004280 3300046515 Bacteria 8072
422 Ga0495631_0000460 3300046518 Bacteria 27635
423 Ga0495631_0001776 3300046518 Bacteria 12785
424 Ga0495632_0000262 3300046519 Bacteria 52466
425 Ga0495632_0033023 3300046519 Bacteria 2660
426 Ga0495632_0129622 3300046519 Bacteria 1174
427 Ga0495637_0032325 3300046520 Bacteria 2306
428 Ga0495648_0014149 3300046524 Bacteria 5855
429 Ga0495648_0014563 3300046524 Bacteria 5750
430 Ga0495609_0011236 3300046538 Bacteria 4270
431 Ga0495597_0053505 3300046542 Bacteria 1775
432 Ga0495622_0009667 3300046557 Bacteria 4460
433 Ga0495668_0026526 3300046616 Bacteria 3287
434 Ga0495611_0000001 3300046648 Bacteria 2628469
435 Ga0495611_0001038 3300046648 Bacteria 14701
436 Ga0495625_0000001 3300046660 Bacteria 1641829
437 Ga0495625_0014495 3300046660 Bacteria 6285
438 Ga0495625_0026367 3300046660 Bacteria 4393
439 Ga0495625_0034880 3300046660 Bacteria 3710
440 Ga0495625_0083047 3300046660 Bacteria 2227
441 Ga0495625_0248599 3300046660 Bacteria 1155
442 Ga0495625_0570859 3300046660 Bacteria 683
443 Ga0495661_0002187 3300046665 Bacteria 15271
444 Ga0495670_0004398 3300046691 Bacteria 6913
445 Ga0495670_0015489 3300046691 Bacteria 3745
446 Ga0495670_0018572 3300046691 Bacteria 3423
447 Ga0495671_0000272 3300046692 Bacteria 43513
448 Ga0495649_0000383 3300046694 Bacteria 38398
449 Ga0495589_0000458 3300046794 Bacteria 29894
450 Ga0495660_0000410 3300046810 Bacteria 36526
451 Ga0495660_0002140 3300046810 Bacteria 12744
452 Ga0495679_000001 3300047446 Bacteria 1607568
453 Ga0495673_0000001 3300047469 Bacteria 1630730
454 Ga0495673_0000099 3300047469 Bacteria 179978
455 Ga0495673_0002529 3300047469 Bacteria 12769
456 Ga0495686_0000276 3300047472 Bacteria 91066
457 Ga0495686_0000975 3300047472 Bacteria 35076
458 Ga0495686_0006028 3300047472 Bacteria 9410
459 Ga0495686_0125863 3300047472 Bacteria 1523
460 Ga0496100_0048118 3300048903 Bacteria 2751
461 Ga0496100_0130550 3300048903 Bacteria 1769
462 Ga0496101_0024338 3300048904 Bacteria 4190
463 Ga0496106_0001459 3300048909 Bacteria 17765
464 Ga0496106_0604332 3300048909 Bacteria 878
465 Ga0496107_0457078 3300048910 Bacteria 948
466 Ga0496115_0000567 3300048918 Bacteria 28695
467 Ga0496115_0006012 3300048918 Bacteria 8860
468 Ga0496115_0046638 3300048918 Bacteria 3464
469 Ga0496116_0228503 3300048919 Bacteria 946
470 Ga0496117_0017588 3300048920 Bacteria 5966
471 Ga0496117_0039775 3300048920 Bacteria 3466
472 Ga0496117_0044688 3300048920 Bacteria 3206
473 Ga0496118_0001687 3300048921 Bacteria 32276
474 Ga0496118_0005142 3300048921 Bacteria 15002
475 Ga0496118_0010934 3300048921 Bacteria 8924
476 Ga0496118_0277165 3300048921 Bacteria 936
477 Ga0496119_0047058 3300048922 Bacteria 2687
478 Ga0496121_0000210 3300048924 Bacteria 128287
479 Ga0496121_0007339 3300048924 Bacteria 13330
480 Ga0496121_0007902 3300048924 Bacteria 12728
481 Ga0496121_0020685 3300048924 Bacteria 6493
482 Ga0496121_0034035 3300048924 Bacteria 4594
483 Ga0496121_0044528 3300048924 Bacteria 3826
484 Ga0496121_0065774 3300048924 Bacteria 2947
485 Ga0496122_0028548 3300048925 Bacteria 4729
486 Ga0496122_0047981 3300048925 Bacteria 3290
487 Ga0496122_0100298 3300048925 Bacteria 1938
488 Ga0496122_0145659 3300048925 Bacteria 1472
489 Ga0496122_0203351 3300048925 Bacteria 1156
490 Ga0496123_0032467 3300048926 Bacteria 3779
491 Ga0496123_0050389 3300048926 Bacteria 2782
492 Ga0496123_0094303 3300048926 Bacteria 1764
493 Ga0496123_0112422 3300048926 Bacteria 1553
494 Ga0496124_0016665 3300048927 Bacteria 6971
495 Ga0496124_0324781 3300048927 Bacteria 1100
496 Ga0496125_0000379 3300048928 Bacteria 83187
497 Ga0496125_0006519 3300048928 Bacteria 12590
498 Ga0496125_0318015 3300048928 Bacteria 945
499 Ga0496126_0001924 3300048929 Bacteria 29736
500 Ga0496126_0008492 3300048929 Bacteria 11069
501 Ga0496126_0087043 3300048929 Bacteria 2753
502 Ga0496126_0123985 3300048929 Bacteria 2237
503 Ga0496126_0209796 3300048929 Bacteria 1640
504 Ga0496126_0371848 3300048929 Bacteria 1165
505 Ga0495678_000132 3300049459 Bacteria 88496
506 Ga0495678_037082 3300049459 Bacteria 1984
507 Ga0495682_0003591 3300049460 Bacteria 6840
508 Ga0495682_0033426 3300049460 Bacteria 1898
509 Ga0495682_0101897 3300049460 Bacteria 1029
510 Ga0501031_0010344 3300049568 Bacteria 6079
511 Ga0501031_0580640 3300049568 Bacteria 721
512 Ga0501032_0009136 3300049569 Bacteria 7193
513 Ga0501032_0562613 3300049569 Bacteria 726
514 Ga0501032_0857906 3300049569 Bacteria 572
515 Ga0501033_0002369 3300049570 Bacteria 16069
516 Ga0501033_0005146 3300049570 Bacteria 10397
517 Ga0501033_0269592 3300049570 Bacteria 1203
518 Ga0501034_0056650 3300049571 Bacteria 3943
519 Ga0501034_0184343 3300049571 Bacteria 2051
520 Ga0501034_0325178 3300049571 Bacteria 1470
521 Ga0501036_0414479 3300049572 Bacteria 1123
522 Ga0501037_0026448 3300049573 Bacteria 4290
523 Ga0501038_0110190 3300049574 Bacteria 2281
524 Ga0501038_0242850 3300049574 Bacteria 1429
525 Ga0501039_0353822 3300049575 Bacteria 1154
526 Ga0501043_0009237 3300049579 Bacteria 7748
527 Ga0501043_0010787 3300049579 Bacteria 7156
528 Ga0501046_0005419 3300049580 Bacteria 11404
529 Ga0501046_0187719 3300049580 Bacteria 1543
530 Ga0501046_0363906 3300049580 Bacteria 1048
531 Ga0501047_0002764 3300049581 Bacteria 16669
532 Ga0501047_0007561 3300049581 Bacteria 10225
533 Ga0501047_0076182 3300049581 Bacteria 3228
534 Ga0501047_0153690 3300049581 Bacteria 2176
535 Ga0501047_0193491 3300049581 Bacteria 1897
536 Ga0501048_0135318 3300049582 Bacteria 1741
537 Ga0501070_0423411 3300049586 Bacteria 1075
538 Ga0501073_0377552 3300049589 Bacteria 979
539 Ga0501035_0014502 3300049822 Bacteria 7273
540 Ga0501035_0051960 3300049822 Bacteria 3667
541 Ga0501035_0134535 3300049822 Bacteria 2153
542 Ga0501035_0224892 3300049822 Bacteria 1601
543 Ga0501035_0311656 3300049822 Bacteria 1324
544 Ga0501044_0009489 3300049823 Bacteria 10594
545 Ga0501044_0011731 3300049823 Bacteria 9492
546 Ga0501044_0015409 3300049823 Bacteria 8233
547 Ga0501044_0059512 3300049823 Bacteria 3913
548 Ga0501044_0171559 3300049823 Bacteria 2140
549 nmdc:mga0sz30_9535_c2 3300050516 Bacteria 2620
550 Ga0500643_000002 3300053087 Bacteria 1277657
551 Ga0500583_0322865 3300053092 Bacteria 752
552 Ga0500555_000611 3300053103 Bacteria 13888
553 Ga0500652_140511 3300053131 Bacteria 1005
554 Ga0500633_0003242 3300053160 Bacteria 3514
555 Ga0500645_004097 3300053730 Bacteria 5701
556 Ga0466962_0003750 3300061719 Bacteria 7255
557 Ga0466962_0029698 3300061719 Bacteria 2617
558 Ga0466962_0041531 3300061719 Bacteria 2200
559 Ga0466962_0170581 3300061719 Bacteria 1059

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0000007 Ga0495638_0000007_579717_580175 151
2 3300044656 Ga0466969_0002795 Ga0466969_0002795_1809_2324 155
3 3300044683 Ga0466965_0254167 Ga0466965_0254167_131_646 155
4 3300044684 Ga0466966_0042154 Ga0466966_0042154_410_925 155
5 3300044693 Ga0466961_0394083 Ga0466961_0394083_68_583 155
6 3300044693 Ga0466961_0533300 Ga0466961_0533300_125_640 155
7 3300044765 Ga0466970_0058181 Ga0466970_0058181_700_1215 155
8 3300044765 Ga0466970_0127624 Ga0466970_0127624_27_542 155
9 3300045049 Ga0466959_0000131 Ga0466959_0000131_28722_29237 155
10 3300061719 Ga0466962_0170581 Ga0466962_0170581_219_734 155
11 3300037418 Ga0395900_1009231 Ga0395900_1009231_31_525 161
12 iso_pu_bacteria 2928963466 2928964789 161
13 iso_pu_bacteria 2884411467 2884413762 162
14 3300003756 Ga0055533_1000283 Ga0055533_100028318 164
15 3300015687 Ga0183368_1002 Ga0183368_1002362 164
16 3300025226 Ga0209674_100043 Ga0209674_100043330 164
17 3300041452 Ga0451793_1564549 Ga0451793_1564549_1850_2347 164
18 3300041460 Ga0451802_0494732 Ga0451802_0494732_21_518 164
19 3300003762 Ga0055542_1000559 Ga0055542_100055919 165
20 3300048924 Ga0496121_0034035 Ga0496121_0034035_1502_1999 165
21 iso_pu_bacteria 2537561836 2538834099 165
22 iso_pu_bacteria 2643221562 2643829557 165
23 iso_pu_bacteria 2643221577 2643895191 165
24 iso_pu_bacteria 2643221685 2644477350 165
25 iso_pu_bacteria 2687453130 2687584008 165
26 iso_pu_bacteria 2739367700 2739732091 165
27 3300001979 JGI24740J21852_10014053 JGI24740J21852_100140533 166
28 3300001989 JGI24739J22299_10000118 JGI24739J22299_1000011833 166
29 3300001990 JGI24737J22298_10001221 JGI24737J22298_100012214 166
30 3300001990 JGI24737J22298_10065931 JGI24737J22298_100659312 166
31 3300002067 JGI24735J21928_10030492 JGI24735J21928_100304923 166
32 3300002067 JGI24735J21928_10048387 JGI24735J21928_100483872 166
33 3300002075 JGI24738J21930_10034924 JGI24738J21930_100349242 166
34 3300002705 JGI25156J39149_1001485 JGI25156J39149_10014855 166
35 3300002737 JGI25162J39368_1000434 JGI25162J39368_100043420 166
36 3300002738 JGI25154J39366_1010309 JGI25154J39366_10103092 166
37 3300002741 JGI25157J39369_1000527 JGI25157J39369_100052711 166
38 3300002741 JGI25157J39369_1000572 JGI25157J39369_100057210 166
39 3300002741 JGI25157J39369_1000944 JGI25157J39369_100094413 166
40 3300002771 JGI25163J39215_1000622 JGI25163J39215_10006225 166
41 3300002772 JGI25164J39214_1000143 JGI25164J39214_100014353 166
42 3300003214 JGI25165J46597_1000257 JGI25165J46597_100025713 166
43 3300003578 Ga0006562J51391_1018437 Ga0006562J51391_10184372 166
44 3300003578 Ga0006562J51391_1018441 Ga0006562J51391_10184413 166
45 3300003751 Ga0055538_1002632 Ga0055538_10026322 166
46 3300003760 Ga0055527_1000432 Ga0055527_100043214 166
47 3300003761 Ga0055535_1000430 Ga0055535_100043020 166
48 3300003761 Ga0055535_1001073 Ga0055535_10010733 166
49 3300003762 Ga0055542_1000540 Ga0055542_100054020 166
50 3300003762 Ga0055542_1001072 Ga0055542_10010723 166
51 3300003763 Ga0055529_1000211 Ga0055529_100021153 166
52 3300003763 Ga0055529_1000244 Ga0055529_100024414 166
53 3300005455 Ga0070663_100241523 Ga0070663_1002415233 166
54 3300005563 Ga0068855_100013790 Ga0068855_1000137905 166
55 3300005577 Ga0068857_100000998 Ga0068857_1000009982 166
56 3300005578 Ga0068854_100024671 Ga0068854_1000246713 166
57 3300005614 Ga0068856_100030736 Ga0068856_1000307362 166
58 3300005617 Ga0068859_100183748 Ga0068859_1001837483 166
59 3300005834 Ga0068851_10045776 Ga0068851_100457763 166
60 3300005842 Ga0068858_100003142 Ga0068858_10000314211 166
61 3300006931 Ga0097620_100183747 Ga0097620_1001837473 166
62 3300009093 Ga0105240_10023357 Ga0105240_100233575 166
63 3300009545 Ga0105237_10000352 Ga0105237_100003525 166
64 3300010375 Ga0105239_10051215 Ga0105239_100512153 166
65 3300012500 Ga0157314_1000067 Ga0157314_10000676 166
66 3300013105 Ga0157369_10077917 Ga0157369_100779174 166
67 3300025207 Ga0209760_100556 Ga0209760_1005563 166
68 3300025224 Ga0209784_100167 Ga0209784_10016729 166
69 3300025226 Ga0209674_100407 Ga0209674_10040717 166
70 3300025228 Ga0209672_100029 Ga0209672_10002937 166
71 3300025228 Ga0209672_110773 Ga0209672_1107732 166
72 3300025231 Ga0207427_100144 Ga0207427_10014436 166
73 3300025233 Ga0209437_100256 Ga0209437_10025653 166
74 3300025242 Ga0209258_100053 Ga0209258_100053293 166
75 3300025242 Ga0209258_100407 Ga0209258_10040737 166
76 3300025242 Ga0209258_102073 Ga0209258_1020734 166
77 3300025246 Ga0209646_1001715 Ga0209646_10017154 166
78 3300025250 Ga0209026_1000060 Ga0209026_100006038 166
79 3300025250 Ga0209026_1000293 Ga0209026_100029329 166
80 3300025253 Ga0209677_102308 Ga0209677_1023082 166
81 3300025254 Ga0209148_1000009 Ga0209148_100000937 166
82 3300025254 Ga0209148_1000010 Ga0209148_10000101133 166
83 3300025256 Ga0209759_1000668 Ga0209759_100066816 166
84 3300025256 Ga0209759_1001181 Ga0209759_100118112 166
85 3300025258 Ga0209129_1009423 Ga0209129_10094232 166
86 3300025261 Ga0209233_1000009 Ga0209233_100000936 166
87 3300025272 Ga0209455_1000060 Ga0209455_100006037 166
88 3300025272 Ga0209455_1000086 Ga0209455_100008636 166
89 3300025297 Ga0209758_1000812 Ga0209758_100081232 166
90 3300025904 Ga0207647_10002628 Ga0207647_100026285 166
91 3300025913 Ga0207695_10003135 Ga0207695_1000313515 166
92 3300025914 Ga0207671_10000021 Ga0207671_1000002135 166
93 3300025949 Ga0207667_10002458 Ga0207667_100024587 166
94 3300025981 Ga0207640_10003159 Ga0207640_100031599 166
95 3300026035 Ga0207703_10013607 Ga0207703_100136075 166
96 3300026067 Ga0207678_10111625 Ga0207678_101116253 166
97 3300026078 Ga0207702_10000718 Ga0207702_1000071824 166
98 3300026116 Ga0207674_10002447 Ga0207674_1000244714 166
99 3300037312 Ga0395899_0000068 Ga0395899_0000068_191788_192303 166
100 3300037466 Ga0395898_0000558 Ga0395898_0000558_26879_27394 166
101 3300042005 Ga0439448_0084631 Ga0439448_0084631_141_674 166
102 3300044693 Ga0466961_0007178 Ga0466961_0007178_5809_6324 166
103 3300044765 Ga0466970_0044712 Ga0466970_0044712_124_639 166
104 3300044842 Ga0466957_0027616 Ga0466957_0027616_1770_2285 166
105 3300045049 Ga0466959_0011100 Ga0466959_0011100_1160_1675 166
106 3300048924 Ga0496121_0044528 Ga0496121_0044528_2868_3401 166
107 3300048928 Ga0496125_0000379 Ga0496125_0000379_61865_62398 166
108 iso_pu_bacteria 2895395659 2895397504 166
109 iso_pu_bacteria 2939611941 2939612702 166
110 3300001979 JGI24740J21852_10075340 JGI24740J21852_100753401 167
111 3300005327 Ga0070658_10001084 Ga0070658_1000108423 167
112 3300005335 Ga0070666_10000018 Ga0070666_10000018133 167
113 3300005336 Ga0070680_100870768 Ga0070680_1008707681 167
114 3300005367 Ga0070667_100032024 Ga0070667_1000320244 167
115 3300005455 Ga0070663_100700258 Ga0070663_1007002582 167
116 3300005563 Ga0068855_100046572 Ga0068855_1000465723 167
117 3300005578 Ga0068854_100001113 Ga0068854_1000011134 167
118 3300005842 Ga0068858_100048183 Ga0068858_1000481834 167
119 3300009093 Ga0105240_10113171 Ga0105240_101131712 167
120 3300009551 Ga0105238_10000319 Ga0105238_1000031913 167
121 3300013306 Ga0163162_10001986 Ga0163162_1000198612 167
122 3300025903 Ga0207680_10000002 Ga0207680_10000002519 167
123 3300025909 Ga0207705_10002226 Ga0207705_100022262 167
124 3300025913 Ga0207695_10080322 Ga0207695_100803223 167
125 3300025924 Ga0207694_10000388 Ga0207694_1000038813 167
126 3300025949 Ga0207667_10000737 Ga0207667_1000073717 167
127 3300025972 Ga0207668_10227036 Ga0207668_102270362 167
128 3300025981 Ga0207640_10000095 Ga0207640_1000009514 167
129 3300025986 Ga0207658_10222345 Ga0207658_102223452 167
130 3300028379 Ga0268266_10000004 Ga0268266_10000004515 167
131 3300028786 Ga0307517_10106765 Ga0307517_101067653 167
132 3300033180 Ga0307510_10005448 Ga0307510_100054487 167
133 3300033180 Ga0307510_10036409 Ga0307510_100364093 167
134 3300037312 Ga0395899_0113194 Ga0395899_0113194_622_1131 167
135 3300044683 Ga0466965_0003379 Ga0466965_0003379_5446_5967 167
136 3300044719 Ga0466971_0000868 Ga0466971_0000868_2542_3063 167
137 3300044842 Ga0466957_0012485 Ga0466957_0012485_922_1443 167
138 3300045049 Ga0466959_0028532 Ga0466959_0028532_494_1015 167
139 3300045836 Ga0466958_0008396 Ga0466958_0008396_3823_4344 167
140 3300046471 Ga0495650_0000637 Ga0495650_0000637_1125_1634 167
141 3300046507 Ga0495606_0098057 Ga0495606_0098057_733_1242 167
142 3300046660 Ga0495625_0083047 Ga0495625_0083047_806_1315 167
143 3300046660 Ga0495625_0570859 Ga0495625_0570859_119_628 167
144 3300048903 Ga0496100_0130550 Ga0496100_0130550_1002_1520 167
145 3300048904 Ga0496101_0024338 Ga0496101_0024338_2505_3023 167
146 3300048910 Ga0496107_0457078 Ga0496107_0457078_330_848 167
147 3300048918 Ga0496115_0006012 Ga0496115_0006012_2564_3082 167
148 3300048920 Ga0496117_0039775 Ga0496117_0039775_2151_2669 167
149 3300048921 Ga0496118_0005142 Ga0496118_0005142_7270_7788 167
150 3300048921 Ga0496118_0277165 Ga0496118_0277165_207_716 167
151 3300048924 Ga0496121_0020685 Ga0496121_0020685_4160_4678 167
152 3300048928 Ga0496125_0318015 Ga0496125_0318015_348_857 167
153 3300048929 Ga0496126_0001924 Ga0496126_0001924_19305_19823 167
154 3300061719 Ga0466962_0041531 Ga0466962_0041531_1259_1780 167
155 3300002737 JGI25162J39368_1001914 JGI25162J39368_10019149 168
156 3300002737 JGI25162J39368_1002093 JGI25162J39368_10020935 168
157 3300002772 JGI25164J39214_1000535 JGI25164J39214_10005356 168
158 3300002772 JGI25164J39214_1011449 JGI25164J39214_10114491 168
159 3300005337 Ga0070682_100337552 Ga0070682_1003375522 168
160 3300005340 Ga0070689_100006031 Ga0070689_1000060314 168
161 3300005435 Ga0070714_100012139 Ga0070714_1000121395 168
162 3300005435 Ga0070714_100085598 Ga0070714_1000855983 168
163 3300005436 Ga0070713_100008958 Ga0070713_1000089581 168
164 3300005437 Ga0070710_10032219 Ga0070710_100322193 168
165 3300005455 Ga0070663_100053108 Ga0070663_1000531084 168
166 3300005455 Ga0070663_100563614 Ga0070663_1005636142 168
167 3300005578 Ga0068854_100003601 Ga0068854_1000036018 168
168 3300005843 Ga0068860_100431504 Ga0068860_1004315042 168
169 3300005844 Ga0068862_100033999 Ga0068862_1000339992 168
170 3300009551 Ga0105238_10158449 Ga0105238_101584492 168
171 3300009551 Ga0105238_10242673 Ga0105238_102426732 168
172 3300009551 Ga0105238_10434374 Ga0105238_104343742 168
173 3300009551 Ga0105238_10794666 Ga0105238_107946661 168
174 3300013100 Ga0157373_10175488 Ga0157373_101754882 168
175 3300013104 Ga0157370_10005510 Ga0157370_100055108 168
176 3300013104 Ga0157370_10020890 Ga0157370_100208903 168
177 3300013306 Ga0163162_10044158 Ga0163162_100441583 168
178 3300013307 Ga0157372_10579649 Ga0157372_105796491 168
179 3300014497 Ga0182008_10117096 Ga0182008_101170962 168
180 3300014497 Ga0182008_10128417 Ga0182008_101284172 168
181 3300015261 Ga0182006_1030240 Ga0182006_10302402 168
182 3300015261 Ga0182006_1041204 Ga0182006_10412042 168
183 3300015262 Ga0182007_10017898 Ga0182007_100178982 168
184 3300015262 Ga0182007_10070933 Ga0182007_100709332 168
185 3300015685 Ga0183369_1007 Ga0183369_1007184 168
186 3300025226 Ga0209674_102072 Ga0209674_1020724 168
187 3300025228 Ga0209672_100738 Ga0209672_1007383 168
188 3300025231 Ga0207427_100209 Ga0207427_10020935 168
189 3300025231 Ga0207427_105019 Ga0207427_1050191 168
190 3300025233 Ga0209437_100020 Ga0209437_100020591 168
191 3300025233 Ga0209437_100193 Ga0209437_10019375 168
192 3300025242 Ga0209258_101049 Ga0209258_1010493 168
193 3300025254 Ga0209148_1000002 Ga0209148_10000021314 168
194 3300025261 Ga0209233_1000020 Ga0209233_100002035 168
195 3300025261 Ga0209233_1007475 Ga0209233_10074753 168
196 3300025272 Ga0209455_1014179 Ga0209455_10141792 168
197 3300025898 Ga0207692_10027067 Ga0207692_100270672 168
198 3300025920 Ga0207649_10017391 Ga0207649_100173912 168
199 3300025924 Ga0207694_10077903 Ga0207694_100779033 168
200 3300025924 Ga0207694_10079355 Ga0207694_100793553 168
201 3300025924 Ga0207694_10130122 Ga0207694_101301222 168
202 3300025928 Ga0207700_10144494 Ga0207700_101444943 168
203 3300025929 Ga0207664_10001329 Ga0207664_100013299 168
204 3300025929 Ga0207664_10152943 Ga0207664_101529431 168
205 3300025936 Ga0207670_10003893 Ga0207670_100038934 168
206 3300025949 Ga0207667_10993606 Ga0207667_109936062 168
207 3300025981 Ga0207640_10014885 Ga0207640_100148853 168
208 3300026067 Ga0207678_10043258 Ga0207678_100432582 168
209 3300028380 Ga0268265_10019013 Ga0268265_100190135 168
210 3300028381 Ga0268264_10460845 Ga0268264_104608452 168
211 3300037312 Ga0395899_0037111 Ga0395899_0037111_3026_3538 168
212 3300037466 Ga0395898_0007440 Ga0395898_0007440_9790_10320 168
213 3300037466 Ga0395898_0415275 Ga0395898_0415275_527_1039 168
214 3300038443 Ga0395901_0059771 Ga0395901_0059771_3404_3916 168
215 3300038443 Ga0395901_0206482 Ga0395901_0206482_1278_1790 168
216 3300046460 Ga0495638_0001066 Ga0495638_0001066_8761_9270 168
217 3300046460 Ga0495638_0001368 Ga0495638_0001368_17434_17943 168
218 3300046471 Ga0495650_0000202 Ga0495650_0000202_33755_34264 168
219 3300046507 Ga0495606_0001329 Ga0495606_0001329_10228_10737 168
220 3300046542 Ga0495597_0053505 Ga0495597_0053505_508_1017 168
221 3300046557 Ga0495622_0009667 Ga0495622_0009667_2401_2910 168
222 3300046660 Ga0495625_0014495 Ga0495625_0014495_1751_2260 168
223 3300046660 Ga0495625_0248599 Ga0495625_0248599_325_834 168
224 3300046694 Ga0495649_0000383 Ga0495649_0000383_23213_23722 168
225 3300048918 Ga0496115_0000567 Ga0496115_0000567_20545_21054 168
226 3300048918 Ga0496115_0046638 Ga0496115_0046638_2741_3250 168
227 3300048927 Ga0496124_0324781 Ga0496124_0324781_384_893 168
228 3300048929 Ga0496126_0008492 Ga0496126_0008492_2517_3026 168
229 3300048929 Ga0496126_0123985 Ga0496126_0123985_785_1294 168
230 3300048929 Ga0496126_0209796 Ga0496126_0209796_338_847 168
231 3300049459 Ga0495678_037082 Ga0495678_037082_710_1219 168
232 3300049460 Ga0495682_0033426 Ga0495682_0033426_1208_1717 168
233 3300049569 Ga0501032_0009136 Ga0501032_0009136_5732_6247 168
234 3300049570 Ga0501033_0005146 Ga0501033_0005146_9401_9916 168
235 3300049571 Ga0501034_0056650 Ga0501034_0056650_2571_3086 168
236 3300049571 Ga0501034_0184343 Ga0501034_0184343_1430_1945 168
237 3300049573 Ga0501037_0026448 Ga0501037_0026448_3185_3700 168
238 3300049574 Ga0501038_0242850 Ga0501038_0242850_848_1363 168
239 3300049579 Ga0501043_0009237 Ga0501043_0009237_7128_7643 168
240 3300049580 Ga0501046_0005419 Ga0501046_0005419_9371_9886 168
241 3300049580 Ga0501046_0187719 Ga0501046_0187719_289_804 168
242 3300049581 Ga0501047_0076182 Ga0501047_0076182_2614_3129 168
243 3300049822 Ga0501035_0051960 Ga0501035_0051960_895_1410 168
244 3300049822 Ga0501035_0134535 Ga0501035_0134535_1067_1579 168
245 3300049823 Ga0501044_0015409 Ga0501044_0015409_6134_6649 168
246 3300061719 Ga0466962_0029698 Ga0466962_0029698_1869_2393 168
247 iso_pu_bacteria 2718218334 2721027895 168
248 iso_pu_bacteria 2734482264 2735836533 168
249 iso_pu_bacteria 2738543009 2739228447 168
250 3300002705 JGI25156J39149_1005444 JGI25156J39149_10054442 169
251 3300002705 JGI25156J39149_1021623 JGI25156J39149_10216232 169
252 3300002741 JGI25157J39369_1000860 JGI25157J39369_10008601 169
253 3300002741 JGI25157J39369_1003026 JGI25157J39369_10030262 169
254 3300002741 JGI25157J39369_1012002 JGI25157J39369_10120022 169
255 3300003316 rootH1_10093510 rootH1_100935102 169
256 3300003763 Ga0055529_1013331 Ga0055529_10133311 169
257 3300005337 Ga0070682_100116495 Ga0070682_1001164952 169
258 3300005339 Ga0070660_100015354 Ga0070660_1000153543 169
259 3300005339 Ga0070660_100220485 Ga0070660_1002204852 169
260 3300005345 Ga0070692_10016178 Ga0070692_100161782 169
261 3300005366 Ga0070659_100074507 Ga0070659_1000745072 169
262 3300005366 Ga0070659_100363358 Ga0070659_1003633582 169
263 3300005366 Ga0070659_101142372 Ga0070659_1011423721 169
264 3300005435 Ga0070714_100003062 Ga0070714_1000030624 169
265 3300005457 Ga0070662_100075947 Ga0070662_1000759472 169
266 3300005457 Ga0070662_100852720 Ga0070662_1008527201 169
267 3300005458 Ga0070681_10011680 Ga0070681_100116804 169
268 3300005458 Ga0070681_10030069 Ga0070681_100300693 169
269 3300005458 Ga0070681_10967567 Ga0070681_109675672 169
270 3300005530 Ga0070679_100039017 Ga0070679_1000390172 169
271 3300005539 Ga0068853_100387278 Ga0068853_1003872782 169
272 3300005539 Ga0068853_100638702 Ga0068853_1006387022 169
273 3300005546 Ga0070696_100001026 Ga0070696_1000010268 169
274 3300005546 Ga0070696_100107773 Ga0070696_1001077733 169
275 3300005563 Ga0068855_100243506 Ga0068855_1002435062 169
276 3300005577 Ga0068857_100036672 Ga0068857_1000366724 169
277 3300005578 Ga0068854_100061134 Ga0068854_1000611342 169
278 3300005614 Ga0068856_100000582 Ga0068856_10000058228 169
279 3300009093 Ga0105240_10046303 Ga0105240_100463035 169
280 3300009545 Ga0105237_10000675 Ga0105237_100006753 169
281 3300009545 Ga0105237_10104805 Ga0105237_101048052 169
282 3300009551 Ga0105238_10139480 Ga0105238_101394803 169
283 3300010375 Ga0105239_10565946 Ga0105239_105659462 169
284 3300013100 Ga0157373_10220809 Ga0157373_102208092 169
285 3300013100 Ga0157373_10244559 Ga0157373_102445592 169
286 3300013100 Ga0157373_10350706 Ga0157373_103507062 169
287 3300013102 Ga0157371_10020571 Ga0157371_100205714 169
288 3300013102 Ga0157371_11044648 Ga0157371_110446481 169
289 3300013104 Ga0157370_10385467 Ga0157370_103854672 169
290 3300013105 Ga0157369_10017478 Ga0157369_100174783 169
291 3300013307 Ga0157372_10078548 Ga0157372_100785483 169
292 3300013307 Ga0157372_10187634 Ga0157372_101876343 169
293 3300013307 Ga0157372_11580578 Ga0157372_115805781 169
294 3300014497 Ga0182008_10104256 Ga0182008_101042562 169
295 3300014497 Ga0182008_10175347 Ga0182008_101753472 169
296 3300015262 Ga0182007_10020699 Ga0182007_100206991 169
297 3300015262 Ga0182007_10094659 Ga0182007_100946592 169
298 3300015262 Ga0182007_10100133 Ga0182007_101001332 169
299 3300020069 Ga0197907_10972301 Ga0197907_109723012 169
300 3300020070 Ga0206356_11478499 Ga0206356_114784992 169
301 3300020082 Ga0206353_11923352 Ga0206353_119233523 169
302 3300025225 Ga0209566_108076 Ga0209566_1080761 169
303 3300025246 Ga0209646_1004407 Ga0209646_10044072 169
304 3300025246 Ga0209646_1007805 Ga0209646_10078052 169
305 3300025250 Ga0209026_1000098 Ga0209026_1000098138 169
306 3300025250 Ga0209026_1000274 Ga0209026_100027418 169
307 3300025250 Ga0209026_1005183 Ga0209026_10051832 169
308 3300025256 Ga0209759_1005375 Ga0209759_10053756 169
309 3300025256 Ga0209759_1008242 Ga0209759_10082423 169
310 3300025256 Ga0209759_1034101 Ga0209759_10341011 169
311 3300025272 Ga0209455_1000095 Ga0209455_1000095101 169
312 3300025297 Ga0209758_1120924 Ga0209758_11209242 169
313 3300025904 Ga0207647_10021560 Ga0207647_100215604 169
314 3300025904 Ga0207647_10049605 Ga0207647_100496053 169
315 3300025909 Ga0207705_10016407 Ga0207705_100164072 169
316 3300025912 Ga0207707_10013804 Ga0207707_100138044 169
317 3300025913 Ga0207695_10009256 Ga0207695_1000925617 169
318 3300025914 Ga0207671_10001518 Ga0207671_100015188 169
319 3300025919 Ga0207657_10111058 Ga0207657_101110583 169
320 3300025919 Ga0207657_10141324 Ga0207657_101413242 169
321 3300025919 Ga0207657_10312938 Ga0207657_103129382 169
322 3300025919 Ga0207657_10342392 Ga0207657_103423922 169
323 3300025920 Ga0207649_10134976 Ga0207649_101349762 169
324 3300025929 Ga0207664_10001322 Ga0207664_100013228 169
325 3300025932 Ga0207690_10002706 Ga0207690_100027062 169
326 3300025932 Ga0207690_10011239 Ga0207690_100112394 169
327 3300025932 Ga0207690_10012135 Ga0207690_100121354 169
328 3300025932 Ga0207690_10245677 Ga0207690_102456772 169
329 3300025933 Ga0207706_10044623 Ga0207706_100446233 169
330 3300025933 Ga0207706_10282740 Ga0207706_102827402 169
331 3300025933 Ga0207706_10576527 Ga0207706_105765272 169
332 3300025933 Ga0207706_10852087 Ga0207706_108520872 169
333 3300025949 Ga0207667_10193917 Ga0207667_101939173 169
334 3300025949 Ga0207667_11323550 Ga0207667_113235502 169
335 3300025981 Ga0207640_10335726 Ga0207640_103357262 169
336 3300026041 Ga0207639_10143187 Ga0207639_101431872 169
337 3300026078 Ga0207702_10000132 Ga0207702_100001323 169
338 3300026116 Ga0207674_10041964 Ga0207674_100419642 169
339 3300026116 Ga0207674_10313573 Ga0207674_103135732 169
340 3300037418 Ga0395900_0537975 Ga0395900_0537975_482_1003 169
341 3300038443 Ga0395901_0001533 Ga0395901_0001533_3485_4006 169
342 3300038443 Ga0395901_0607444 Ga0395901_0607444_16_579 169
343 3300042006 Ga0439432_056434 Ga0439432_056434_19_540 169
344 3300044656 Ga0466969_0024665 Ga0466969_0024665_2482_3027 169
345 3300044658 Ga0466972_0318676 Ga0466972_0318676_161_706 169
346 3300044672 Ga0466982_0000005 Ga0466982_0000005_80454_80999 169
347 3300044684 Ga0466966_0002888 Ga0466966_0002888_5373_5918 169
348 3300044706 Ga0466964_0007368 Ga0466964_0007368_1474_2019 169
349 3300044719 Ga0466971_0009485 Ga0466971_0009485_1536_2081 169
350 3300044735 Ga0466968_0014483 Ga0466968_0014483_2543_3088 169
351 3300044901 Ga0466960_0000662 Ga0466960_0000662_4240_4785 169
352 3300045836 Ga0466958_0026487 Ga0466958_0026487_167_712 169
353 3300049568 Ga0501031_0010344 Ga0501031_0010344_2559_3095 169
354 3300049568 Ga0501031_0580640 Ga0501031_0580640_53_580 169
355 3300049569 Ga0501032_0562613 Ga0501032_0562613_127_654 169
356 3300049569 Ga0501032_0857906 Ga0501032_0857906_43_561 169
357 3300049570 Ga0501033_0002369 Ga0501033_0002369_3140_3667 169
358 3300049570 Ga0501033_0269592 Ga0501033_0269592_646_1173 169
359 3300049571 Ga0501034_0325178 Ga0501034_0325178_106_633 169
360 3300049572 Ga0501036_0414479 Ga0501036_0414479_88_615 169
361 3300049574 Ga0501038_0110190 Ga0501038_0110190_241_768 169
362 3300049575 Ga0501039_0353822 Ga0501039_0353822_49_576 169
363 3300049579 Ga0501043_0010787 Ga0501043_0010787_2648_3184 169
364 3300049580 Ga0501046_0363906 Ga0501046_0363906_328_855 169
365 3300049581 Ga0501047_0002764 Ga0501047_0002764_1902_2420 169
366 3300049581 Ga0501047_0007561 Ga0501047_0007561_6355_6891 169
367 3300049581 Ga0501047_0153690 Ga0501047_0153690_793_1317 169
368 3300049582 Ga0501048_0135318 Ga0501048_0135318_1175_1711 169
369 3300049586 Ga0501070_0423411 Ga0501070_0423411_50_562 169
370 3300049589 Ga0501073_0377552 Ga0501073_0377552_187_714 169
371 3300049822 Ga0501035_0014502 Ga0501035_0014502_6354_6890 169
372 3300049822 Ga0501035_0224892 Ga0501035_0224892_988_1515 169
373 3300049822 Ga0501035_0311656 Ga0501035_0311656_292_810 169
374 3300049823 Ga0501044_0009489 Ga0501044_0009489_6459_6995 169
375 3300049823 Ga0501044_0011731 Ga0501044_0011731_6352_6876 169
376 3300049823 Ga0501044_0059512 Ga0501044_0059512_1819_2346 169
377 3300061719 Ga0466962_0003750 Ga0466962_0003750_2630_3175 169
378 3300002705 JGI25156J39149_1001202 JGI25156J39149_10012024 170
379 3300002737 JGI25162J39368_1002729 JGI25162J39368_10027291 170
380 3300002741 JGI25157J39369_1001150 JGI25157J39369_10011503 170
381 3300002772 JGI25164J39214_1000312 JGI25164J39214_10003123 170
382 3300003214 JGI25165J46597_1000586 JGI25165J46597_10005863 170
383 3300003759 Ga0055525_1000111 Ga0055525_10001114 170
384 3300003760 Ga0055527_1000363 Ga0055527_10003635 170
385 3300003760 Ga0055527_1001741 Ga0055527_10017413 170
386 3300003761 Ga0055535_1000869 Ga0055535_10008695 170
387 3300003761 Ga0055535_1000923 Ga0055535_10009234 170
388 3300003762 Ga0055542_1000629 Ga0055542_100062910 170
389 3300003762 Ga0055542_1000865 Ga0055542_10008655 170
390 3300003763 Ga0055529_1000280 Ga0055529_100028038 170
391 3300003763 Ga0055529_1000737 Ga0055529_10007375 170
392 3300025228 Ga0209672_100004 Ga0209672_1000041329 170
393 3300025228 Ga0209672_100143 Ga0209672_10014343 170
394 3300025230 Ga0209563_100103 Ga0209563_1001034 170
395 3300025231 Ga0207427_100327 Ga0207427_10032737 170
396 3300025233 Ga0209437_100465 Ga0209437_1004653 170
397 3300025242 Ga0209258_100003 Ga0209258_1000031329 170
398 3300025242 Ga0209258_100329 Ga0209258_10032937 170
399 3300025246 Ga0209646_1002822 Ga0209646_10028222 170
400 3300025250 Ga0209026_1000516 Ga0209026_100051637 170
401 3300025254 Ga0209148_1000025 Ga0209148_1000025633 170
402 3300025254 Ga0209148_1000039 Ga0209148_100003936 170
403 3300025256 Ga0209759_1000658 Ga0209759_10006583 170
404 3300025261 Ga0209233_1000151 Ga0209233_1000151135 170
405 3300025272 Ga0209455_1000004 Ga0209455_10000041329 170
406 3300025272 Ga0209455_1000034 Ga0209455_100003437 170
407 3300037312 Ga0395899_0060697 Ga0395899_0060697_576_1094 170
408 3300037466 Ga0395898_0068334 Ga0395898_0068334_1017_1556 170
409 3300038443 Ga0395901_0015703 Ga0395901_0015703_2670_3209 170
410 3300044656 Ga0466969_0016222 Ga0466969_0016222_1357_1887 170
411 3300044684 Ga0466966_0006724 Ga0466966_0006724_1532_2062 170
412 3300044693 Ga0466961_0049701 Ga0466961_0049701_1940_2470 170
413 3300044694 Ga0466963_0065789 Ga0466963_0065789_1730_2260 170
414 3300044694 Ga0466963_0753279 Ga0466963_0753279_122_652 170
415 3300044765 Ga0466970_0050452 Ga0466970_0050452_841_1371 170
416 3300045049 Ga0466959_0048446 Ga0466959_0048446_360_890 170
417 3300045976 Ga0466967_0340317 Ga0466967_0340317_431_961 170
418 3300003322 rootL2_10212903 rootL2_102129032 171
419 3300003761 Ga0055535_1000390 Ga0055535_100039025 171
420 3300003762 Ga0055542_1000409 Ga0055542_100040925 171
421 3300005262 Ga0065165_1005347 Ga0065165_10053471 171
422 3300005344 Ga0070661_100363780 Ga0070661_1003637802 171
423 3300005455 Ga0070663_100053003 Ga0070663_1000530032 171
424 3300009093 Ga0105240_10038461 Ga0105240_100384613 171
425 3300015265 Ga0182005_1014663 Ga0182005_10146632 171
426 3300017792 Ga0163161_10016902 Ga0163161_100169024 171
427 3300025228 Ga0209672_101903 Ga0209672_1019031 171
428 3300025242 Ga0209258_100149 Ga0209258_100149125 171
429 3300025254 Ga0209148_1000143 Ga0209148_1000143125 171
430 3300025272 Ga0209455_1010803 Ga0209455_10108031 171
431 3300025913 Ga0207695_10042600 Ga0207695_100426003 171
432 3300025920 Ga0207649_10439231 Ga0207649_104392312 171
433 3300026067 Ga0207678_10053142 Ga0207678_100531422 171
434 3300044672 Ga0466982_0000059 Ga0466982_0000059_4196_4753 171
435 3300045049 Ga0466959_0721859 Ga0466959_0721859_106_642 171
436 3300046460 Ga0495638_0297329 Ga0495638_0297329_268_783 171
437 3300046507 Ga0495606_0002701 Ga0495606_0002701_9397_9912 171
438 3300046660 Ga0495625_0026367 Ga0495625_0026367_2190_2705 171
439 3300048924 Ga0496121_0065774 Ga0496121_0065774_2332_2847 171
440 3300003320 rootH2_10137045 rootH2_101370452 172
441 3300005344 Ga0070661_100013038 Ga0070661_1000130384 172
442 3300005344 Ga0070661_100393602 Ga0070661_1003936021 172
443 3300005455 Ga0070663_100583513 Ga0070663_1005835131 172
444 3300009101 Ga0105247_10013285 Ga0105247_100132853 172
445 3300015261 Ga0182006_1000223 Ga0182006_100022318 172
446 3300015262 Ga0182007_10056977 Ga0182007_100569772 172
447 3300025900 Ga0207710_10003795 Ga0207710_100037952 172
448 3300025920 Ga0207649_10340022 Ga0207649_103400222 172
449 3300026067 Ga0207678_10681408 Ga0207678_106814082 172
450 3300037312 Ga0395899_0003136 Ga0395899_0003136_9333_9875 172
451 3300037418 Ga0395900_0382753 Ga0395900_0382753_620_1165 172
452 3300037466 Ga0395898_0000600 Ga0395898_0000600_25842_26384 172
453 3300038443 Ga0395901_0009999 Ga0395901_0009999_7792_8337 172
454 3300046452 Ga0495617_000882 Ga0495617_000882_10404_10922 172
455 3300046452 Ga0495617_001439 Ga0495617_001439_750_1268 172
456 3300046460 Ga0495638_0001395 Ga0495638_0001395_10160_10678 172
457 3300046460 Ga0495638_0114140 Ga0495638_0114140_743_1261 172
458 3300046471 Ga0495650_0004341 Ga0495650_0004341_2742_3260 172
459 3300046471 Ga0495650_0005105 Ga0495650_0005105_7705_8223 172
460 3300046491 Ga0495584_0000625 Ga0495584_0000625_19669_20187 172
461 3300046492 Ga0495585_0000938 Ga0495585_0000938_12592_13110 172
462 3300046492 Ga0495585_0010697 Ga0495585_0010697_517_1035 172
463 3300046501 Ga0495607_0000430 Ga0495607_0000430_2418_2936 172
464 3300046501 Ga0495607_0062472 Ga0495607_0062472_307_825 172
465 3300046506 Ga0495583_0007068 Ga0495583_0007068_4229_4747 172
466 3300046507 Ga0495606_0003017 Ga0495606_0003017_6619_7137 172
467 3300046507 Ga0495606_0045238 Ga0495606_0045238_1773_2291 172
468 3300046513 Ga0495616_0001848 Ga0495616_0001848_10343_10861 172
469 3300046513 Ga0495616_0028122 Ga0495616_0028122_2209_2727 172
470 3300046515 Ga0495620_0004280 Ga0495620_0004280_3096_3614 172
471 3300046518 Ga0495631_0000460 Ga0495631_0000460_26067_26585 172
472 3300046518 Ga0495631_0001776 Ga0495631_0001776_10058_10576 172
473 3300046519 Ga0495632_0000262 Ga0495632_0000262_30375_30893 172
474 3300046519 Ga0495632_0033023 Ga0495632_0033023_1987_2505 172
475 3300046519 Ga0495632_0129622 Ga0495632_0129622_178_696 172
476 3300046520 Ga0495637_0032325 Ga0495637_0032325_989_1507 172
477 3300046524 Ga0495648_0014149 Ga0495648_0014149_1515_2033 172
478 3300046524 Ga0495648_0014563 Ga0495648_0014563_1979_2497 172
479 3300046538 Ga0495609_0011236 Ga0495609_0011236_2237_2755 172
480 3300046616 Ga0495668_0026526 Ga0495668_0026526_1760_2278 172
481 3300046648 Ga0495611_0000001 Ga0495611_0000001_668568_669086 172
482 3300046648 Ga0495611_0001038 Ga0495611_0001038_10877_11395 172
483 3300046660 Ga0495625_0000001 Ga0495625_0000001_1246961_1247479 172
484 3300046660 Ga0495625_0034880 Ga0495625_0034880_588_1106 172
485 3300046665 Ga0495661_0002187 Ga0495661_0002187_3885_4403 172
486 3300046691 Ga0495670_0015489 Ga0495670_0015489_2350_2868 172
487 3300046691 Ga0495670_0018572 Ga0495670_0018572_1106_1624 172
488 3300046692 Ga0495671_0000272 Ga0495671_0000272_2699_3217 172
489 3300046794 Ga0495589_0000458 Ga0495589_0000458_3972_4490 172
490 3300046810 Ga0495660_0000410 Ga0495660_0000410_25456_25974 172
491 3300046810 Ga0495660_0002140 Ga0495660_0002140_10015_10533 172
492 3300047446 Ga0495679_000001 Ga0495679_000001_919510_920028 172
493 3300047469 Ga0495673_0000001 Ga0495673_0000001_1320722_1321240 172
494 3300047469 Ga0495673_0000099 Ga0495673_0000099_68000_68518 172
495 3300047469 Ga0495673_0002529 Ga0495673_0002529_9859_10377 172
496 3300047472 Ga0495686_0000975 Ga0495686_0000975_3807_4325 172
497 3300047472 Ga0495686_0006028 Ga0495686_0006028_6619_7137 172
498 3300047472 Ga0495686_0125863 Ga0495686_0125863_82_600 172
499 3300048903 Ga0496100_0048118 Ga0496100_0048118_480_998 172
500 3300048909 Ga0496106_0001459 Ga0496106_0001459_13303_13821 172
501 3300048924 Ga0496121_0007339 Ga0496121_0007339_9530_10048 172
502 3300048924 Ga0496121_0007902 Ga0496121_0007902_2444_2962 172
503 3300048925 Ga0496122_0100298 Ga0496122_0100298_589_1107 172
504 3300048925 Ga0496122_0203351 Ga0496122_0203351_528_1046 172
505 3300048926 Ga0496123_0094303 Ga0496123_0094303_1188_1706 172
506 3300048929 Ga0496126_0371848 Ga0496126_0371848_12_530 172
507 3300049459 Ga0495678_000132 Ga0495678_000132_71621_72139 172
508 3300049460 Ga0495682_0003591 Ga0495682_0003591_2092_2610 172
509 3300049460 Ga0495682_0101897 Ga0495682_0101897_77_595 172
510 3300049581 Ga0501047_0193491 Ga0501047_0193491_865_1461 172
511 3300049823 Ga0501044_0171559 Ga0501044_0171559_1329_1925 172
512 3300053087 Ga0500643_000002 Ga0500643_000002_1156360_1156878 172
513 3300053092 Ga0500583_0322865 Ga0500583_0322865_116_634 172
514 3300053103 Ga0500555_000611 Ga0500555_000611_995_1513 172
515 3300053131 Ga0500652_140511 Ga0500652_140511_365_883 172
516 3300053160 Ga0500633_0003242 Ga0500633_0003242_1231_1749 172
517 3300053730 Ga0500645_004097 Ga0500645_004097_3869_4387 172
518 iso_pu_bacteria 2842914999 2842916143 172
519 iso_pu_bacteria 2884338543 2884340179 172
520 iso_pu_bacteria 2919085039 2919085736 172
521 iso_pu_bacteria 2941471342 2941474659 172
522 iso_pu_bacteria 2593339238 2595445801 173
523 iso_pu_bacteria 2593339239 2595449352 173
524 iso_pu_bacteria 2919404418 2919405865 173
525 iso_pu_bacteria 2953994433 2953994962 173
526 3300005262 Ga0065165_1000113 Ga0065165_100011358 174
527 3300044842 Ga0466957_0102791 Ga0466957_0102791_427_969 174
528 3300025303 Ga0209051_1022835 Ga0209051_10228353 175
529 3300001904 JGI24736J21556_1009175 JGI24736J21556_10091752 176
530 3300002075 JGI24738J21930_10049666 JGI24738J21930_100496662 176
531 3300003323 rootH1_10375640 rootH1_103756402 176
532 3300003578 Ga0006562J51391_1075948 Ga0006562J51391_10759483 176
533 3300003578 Ga0006562J51391_1075949 Ga0006562J51391_10759492 176
534 3300003762 Ga0055542_1010914 Ga0055542_10109141 176
535 3300005434 Ga0070709_10130967 Ga0070709_101309672 176
536 3300009551 Ga0105238_10134894 Ga0105238_101348943 176
537 3300010375 Ga0105239_10034580 Ga0105239_100345804 176
538 3300013104 Ga0157370_10005522 Ga0157370_100055224 176
539 3300013104 Ga0157370_10225550 Ga0157370_102255502 176
540 3300013104 Ga0157370_10555975 Ga0157370_105559752 176
541 3300013105 Ga0157369_10013431 Ga0157369_100134314 176
542 3300014497 Ga0182008_10024600 Ga0182008_100246002 176
543 3300015265 Ga0182005_1000228 Ga0182005_100022819 176
544 3300015265 Ga0182005_1004950 Ga0182005_10049503 176
545 3300015265 Ga0182005_1047758 Ga0182005_10477581 176
546 3300025226 Ga0209674_100902 Ga0209674_1009027 176
547 3300025233 Ga0209437_108993 Ga0209437_1089932 176
548 3300025254 Ga0209148_1001049 Ga0209148_100104912 176
549 3300025258 Ga0209129_1000766 Ga0209129_100076614 176
550 3300025904 Ga0207647_10000228 Ga0207647_100002283 176
551 3300025906 Ga0207699_10117469 Ga0207699_101174692 176
552 3300025924 Ga0207694_10100095 Ga0207694_101000952 176
553 3300031731 Ga0307405_10271708 Ga0307405_102717082 176
554 3300031824 Ga0307413_10317349 Ga0307413_103173492 176
555 3300031911 Ga0307412_10008842 Ga0307412_100088424 176
556 3300041404 Ga0439436_0000010 Ga0439436_0000010_3759_4292 176
557 3300041413 Ga0439465_0001623 Ga0439465_0001623_3278_3811 176
558 3300046501 Ga0495607_0000098 Ga0495607_0000098_81344_81874 176
559 3300046501 Ga0495607_0017253 Ga0495607_0017253_3148_3678 176
560 3300046512 Ga0495610_0005146 Ga0495610_0005146_2122_2655 176
561 3300046691 Ga0495670_0004398 Ga0495670_0004398_3964_4497 176
562 3300047472 Ga0495686_0000276 Ga0495686_0000276_3331_3861 176
563 3300048909 Ga0496106_0604332 Ga0496106_0604332_17_547 176
564 3300048919 Ga0496116_0228503 Ga0496116_0228503_203_736 176
565 3300048920 Ga0496117_0017588 Ga0496117_0017588_3030_3593 176
566 3300048920 Ga0496117_0044688 Ga0496117_0044688_658_1188 176
567 3300048921 Ga0496118_0001687 Ga0496118_0001687_4828_5391 176
568 3300048921 Ga0496118_0010934 Ga0496118_0010934_2418_2948 176
569 3300048922 Ga0496119_0047058 Ga0496119_0047058_1060_1593 176
570 3300048924 Ga0496121_0000210 Ga0496121_0000210_118026_118556 176
571 3300048925 Ga0496122_0028548 Ga0496122_0028548_4093_4623 176
572 3300048925 Ga0496122_0047981 Ga0496122_0047981_1322_1852 176
573 3300048925 Ga0496122_0145659 Ga0496122_0145659_470_1000 176
574 3300048926 Ga0496123_0032467 Ga0496123_0032467_1243_1773 176
575 3300048926 Ga0496123_0050389 Ga0496123_0050389_923_1453 176
576 3300048926 Ga0496123_0112422 Ga0496123_0112422_160_690 176
577 3300048927 Ga0496124_0016665 Ga0496124_0016665_5231_5761 176
578 3300048928 Ga0496125_0006519 Ga0496125_0006519_1990_2520 176
579 3300048929 Ga0496126_0087043 Ga0496126_0087043_1498_2028 176
580 3300050516 nmdc:mga0sz30_9535_c2 nmdc:mga0sz30_9535_c2_1463_1993 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

28

185

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c2q-assembly1.cif.gz_A the crystal structure of mismatch specific uracil-dna glycosylase (mug) from deinococcus radiodurans. inactive mutant asp93ala. 0.9447 6 169
2c2p-assembly1.cif.gz_A the crystal structure of mismatch specific uracil-dna glycosylase (mug) from deinococcus radiodurans 0.9442 6 169
3uo7-assembly1.cif.gz_A crystal structure of human thymine dna glycosylase bound to substrate 5-carboxylcytosine 0.9032 11 169
2c2q-assembly1.cif.gz_A the crystal structure of mismatch specific uracil-dna glycosylase (mug) from deinococcus radiodurans. inactive mutant asp93ala. 0.8774 6 169
2c2p-assembly1.cif.gz_A the crystal structure of mismatch specific uracil-dna glycosylase (mug) from deinococcus radiodurans 0.8769 6 169
ID Description Score Start End Superfamily
2c2qA01 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9475 13 169 3.40.470.10
3uobA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8986 11 169 3.40.470.10
2c2qA01 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.872 13 169 3.40.470.10
1mtlA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.86 11 170 3.40.470.10
af_O59825_127_324_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8577 1 169 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A1G3FL43-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9824 6 126 GO:0004844
GO:0006285
GO:0008263
AF-A6GLD3-F1-model_v4 G/U mismatch-specific DNA glycosylase 0.9637 8 165 GO:0004844
GO:0006285
GO:0008263
AF-A0A418VB33-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9636 9 169 GO:0004844
GO:0006285
GO:0008263
AF-A0A318SAP7-F1-model_v4 G/U mismatch-specific uracil-DNA glycosylase 0.9633 15 169 GO:0004844
GO:0006285
GO:0008263
AF-A0A538C750-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9632 10 167 GO:0004844
GO:0006285
GO:0008263

Feature Viewer

pLDDT pTM Quality
87.09 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map