F465983

General Info

Members Datasets Scaffolds Average Seq Length
580 309 1160 291

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0004039|Ga0466969_0004039_5067_6029
Length 320
Sequence VDGAERVPEQERGEAERMAGAQPGAAEAAAFRLGAVVLTMGNRPAELTVLLESVAGQQGPAVEVVVVGNGAPLPPLPKGVRGIELEENLGIPGGRNVGIEAFGPHGQDVDAVLFLDDDGFLPQDDVAEKLRAAFTADPGLGIVSFRIADPETGTTQRRHVPRLRASDPLRSSRVTTFLGGACAVRSGVFAQAGELPAEFFYAHEETDLAWRALDAGWSIDYRADIVLHHPATAPSRHAVYHRNVARNRVWLARRNLPWPLVPVYLGTWTVLTVARRPSKAALRAWLGGFREGWRTPCGPRRPMRWRTVWRLTRLGRPPVI

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
15 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
16 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
18 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
19 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
20 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
21 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
22 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
24 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
33 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
34 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
35 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
36 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
37 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
38 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
39 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
40 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
41 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
42 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
43 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
44 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
45 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
46 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
47 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
48 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
49 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
50 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
51 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
52 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
53 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
54 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
55 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
56 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
57 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
58 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
59 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
60 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
61 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
62 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
63 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
64 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
65 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
66 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
67 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
91 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
92 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
121 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
143 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
146 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
147 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
197 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
198 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
199 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
200 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
201 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
202 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
203 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
208 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
209 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
210 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
211 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
212 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
213 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
214 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
215 2643221548 Streptomyces sp. Root55 Isolate Unclassified
216 2643221578 Streptomyces sp. Root63 Isolate Unclassified
217 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
218 2643221647 Streptomyces sp. Root369 Isolate Unclassified
219 2643221670 Streptomyces sp. Root431 Isolate Unclassified
220 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
221 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
222 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
223 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
224 2643221714 Streptomyces sp. Root264 Isolate Unclassified
225 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
226 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
227 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
228 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
229 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
230 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
231 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
232 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
233 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
234 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
235 2808606448 Streptomyces sp. 193411 Isolate Unclassified
236 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
237 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
238 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
239 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
240 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
241 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
242 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
243 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
244 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
245 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
246 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
247 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
248 2862574272 Streptomyces sp. AcE210 Isolate Nodule
249 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
250 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
251 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
252 2867428634 Streptomyces sp. RP5T Isolate Unclassified
253 2867475112 Streptomyces sp. TM32 Isolate Unclassified
254 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
255 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
256 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
257 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
258 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
259 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
260 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
261 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
262 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
263 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
264 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
265 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
266 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
267 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
268 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
269 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
270 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
271 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
272 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
273 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
274 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
275 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
276 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
277 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
278 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
279 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
280 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
281 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
282 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
283 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
284 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
285 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
286 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
287 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
288 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
289 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
290 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
291 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
292 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
293 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
294 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
295 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
296 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
297 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
298 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
299 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
300 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
301 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
302 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
303 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
304 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
305 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
306 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
307 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
308 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
309 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.93
Metatranscriptomes 0.86
Isolates 21.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.62
Nodule 0.52
Rhizoplane 1.55
Rhizosphere 78.45
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0004039 3300044656 Bacteria 7778
2 rootH1_10018221 3300003316 Bacteria 9288
3 rootH2_10049598 3300003320 Bacteria 3209
4 rootL2_10032697 3300003322 Bacteria 2014
5 rootH1_10055552 3300003323 Bacteria 4675
6 JGI25160J50197_1011063 3300003354 Bacteria 3223
7 JGI25160J50197_1018475 3300003354 Bacteria 2173
8 JGI25160J50197_1030462 3300003354 Bacteria 1406
9 JGI25160J50197_1030645 3300003354 Bacteria 1398
10 Ga0006562J51391_1017815 3300003578 Bacteria 1299
11 Ga0006562J51391_1119490 3300003578 Bacteria 1714
12 Ga0006562J51391_1188389 3300003578 Bacteria 3240
13 Ga0006562J51391_1188391 3300003578 Bacteria 2080
14 Ga0070714_100046176 3300005435 Bacteria 3694
15 Ga0070713_100013821 3300005436 Bacteria 5973
16 Ga0068853_100035802 3300005539 Bacteria 4218
17 Ga0068856_100574673 3300005614 Bacteria 1148
18 Ga0081455_10114887 3300005937 Bacteria 2132
19 Ga0075363_100000602 3300006048 Bacteria 11878
20 Ga0105251_10016495 3300009011 Bacteria 3989
21 Ga0105250_10040949 3300009092 Bacteria 1858
22 Ga0111539_10323980 3300009094 Bacteria 1793
23 Ga0182008_10000665 3300014497 Bacteria 24929
24 Ga0182006_1067808 3300015261 Bacteria 1330
25 Ga0182007_10001425 3300015262 Bacteria 12838
26 Ga0183367_1001 3300015688 Bacteria 1225545
27 Ga0213875_10002501 3300021388 Bacteria 10987
28 Ga0213875_10002768 3300021388 Bacteria 10351
29 Ga0224712_10000656 3300022467 Bacteria 7086
30 Ga0207426_1001696 3300025302 Bacteria 17001
31 Ga0207426_1003839 3300025302 Bacteria 7761
32 Ga0207426_1012998 3300025302 Bacteria 3104
33 Ga0207426_1013436 3300025302 Bacteria 3034
34 Ga0207426_1040688 3300025302 Bacteria 1446
35 Ga0207713_1022195 3300025735 Bacteria 3020
36 Ga0207699_10028336 3300025906 Bacteria 3112
37 Ga0207663_10067329 3300025916 Bacteria 2296
38 Ga0207700_10045770 3300025928 Bacteria 3232
39 Ga0207664_10023803 3300025929 Bacteria 4595
40 Ga0207664_10062766 3300025929 Bacteria 2968
41 Ga0207658_10098940 3300025986 Bacteria 2280
42 Ga0207639_10056897 3300026041 Bacteria 2999
43 Ga0207702_10457095 3300026078 Bacteria 1240
44 Ga0307517_10006702 3300028786 Bacteria 16954
45 Ga0307515_10000163 3300028794 Bacteria 163159
46 Ga0307515_10137096 3300028794 Bacteria 2652
47 Ga0307511_10000150 3300030521 Bacteria 66178
48 Ga0307511_10043021 3300030521 Bacteria 3782
49 Ga0307511_10170217 3300030521 Bacteria 1199
50 Ga0307512_10002523 3300030522 Bacteria 22925
51 Ga0307512_10103208 3300030522 Bacteria 1920
52 Ga0265327_10031026 3300031251 Bacteria 3010
53 Ga0307513_10020326 3300031456 Bacteria 7879
54 Ga0307513_10345883 3300031456 Bacteria 1236
55 Ga0307509_10164206 3300031507 Bacteria 2112
56 Ga0307509_10322594 3300031507 Bacteria 1280
57 Ga0307509_10323526 3300031507 Bacteria 1277
58 Ga0307508_10011341 3300031616 Bacteria 8148
59 Ga0307508_10026758 3300031616 Bacteria 5227
60 Ga0307508_10029127 3300031616 Bacteria 4991
61 Ga0307508_10061713 3300031616 Bacteria 3311
62 Ga0307514_10056273 3300031649 Bacteria 3020
63 Ga0307514_10154060 3300031649 Bacteria 1536
64 Ga0307516_10002626 3300031730 Bacteria 23819
65 Ga0307516_10006868 3300031730 Bacteria 13257
66 Ga0307516_10013194 3300031730 Bacteria 8823
67 Ga0307516_10038271 3300031730 Bacteria 4788
68 Ga0307413_10154182 3300031824 Bacteria 1605
69 Ga0307518_10101216 3300031838 Bacteria 2062
70 Ga0307518_10109365 3300031838 Bacteria 1970
71 Ga0307510_10044446 3300033180 Bacteria 4811
72 Ga0307510_10053280 3300033180 Bacteria 4254
73 Ga0307510_10165022 3300033180 Bacteria 1804
74 Ga0395900_0031806 3300037418 Bacteria 5424
75 Ga0395898_0015938 3300037466 Bacteria 7702
76 Ga0395898_0023672 3300037466 Bacteria 6200
77 Ga0436364_0836110 3300037853 Bacteria 15390
78 Ga0436364_1179377 3300037853 Bacteria 13192
79 Ga0395901_0023825 3300038443 Bacteria 6278
80 Ga0439436_0002576 3300041404 Bacteria 5454
81 Ga0439436_0015629 3300041404 Bacteria 2281
82 Ga0439439_0038267 3300041406 Bacteria 1238
83 Ga0451797_0909223 3300041453 Bacteria 1313
84 Ga0451837_0485740 3300041494 Bacteria 2248
85 Ga0451853_0177550 3300041512 Bacteria 8101
86 Ga0439433_0006466 3300041999 Bacteria 2521
87 Ga0439442_012419 3300042002 Bacteria 1741
88 Ga0439449_0001600 3300042007 Bacteria 8878
89 Ga0439449_0003189 3300042007 Bacteria 6390
90 Ga0439455_0002844 3300042012 Bacteria 3218
91 Ga0439457_000007 3300042014 Bacteria 43988
92 Ga0439457_003719 3300042014 Bacteria 4104
93 Ga0439462_0028980 3300042015 Bacteria 1464
94 Ga0450897_000511 3300042128 Bacteria 2170
95 Ga0450894_001008 3300042131 Bacteria 4343
96 Ga0450898_003390 3300042134 Bacteria 2288
97 Ga0450899_000188 3300042135 Bacteria 6250
98 Ga0450903_000472 3300042138 Bacteria 8468
99 Ga0450906_000953 3300042145 Bacteria 6331
100 Ga0439458_0011785 3300042157 Bacteria 1958
101 Ga0450908_030723 3300042184 Bacteria 933
102 Ga0466969_0005593 3300044656 Bacteria 6679
103 Ga0466969_0017575 3300044656 Bacteria 3732
104 Ga0466969_0026882 3300044656 Bacteria 2949
105 Ga0466969_0073038 3300044656 Bacteria 1646
106 Ga0466972_0000509 3300044658 Bacteria 19328
107 Ga0466972_0025285 3300044658 Bacteria 2944
108 Ga0466972_0040286 3300044658 Bacteria 2276
109 Ga0466972_0097144 3300044658 Bacteria 1395
110 Ga0466965_0002882 3300044683 Bacteria 7422
111 Ga0466966_0001953 3300044684 Bacteria 13346
112 Ga0466966_0012740 3300044684 Bacteria 5574
113 Ga0466966_0015962 3300044684 Bacteria 4964
114 Ga0466966_0024399 3300044684 Bacteria 3955
115 Ga0466961_0002554 3300044693 Bacteria 11273
116 Ga0466961_0005919 3300044693 Bacteria 7751
117 Ga0466961_0005921 3300044693 Bacteria 7748
118 Ga0466961_0016881 3300044693 Bacteria 4691
119 Ga0466963_0001746 3300044694 Bacteria 11838
120 Ga0466963_0008025 3300044694 Bacteria 6319
121 Ga0466963_0035920 3300044694 Bacteria 3229
122 Ga0466963_0085102 3300044694 Bacteria 2146
123 Ga0466964_0000802 3300044706 Bacteria 10246
124 Ga0466971_0000288 3300044719 Bacteria 19218
125 Ga0466971_0004533 3300044719 Bacteria 6007
126 Ga0466971_0015111 3300044719 Bacteria 3396
127 Ga0466968_0108910 3300044735 Bacteria 1244
128 Ga0466970_0000573 3300044765 Bacteria 17967
129 Ga0466970_0006787 3300044765 Bacteria 5731
130 Ga0466957_0005800 3300044842 Bacteria 6945
131 Ga0466960_0001078 3300044901 Bacteria 9794
132 Ga0466959_0001737 3300045049 Bacteria 13550
133 Ga0466959_0013645 3300045049 Bacteria 5894
134 Ga0466959_0014841 3300045049 Bacteria 5673
135 Ga0466959_0044637 3300045049 Bacteria 3265
136 Ga0466958_0000978 3300045836 Bacteria 12915
137 Ga0466967_0001936 3300045976 Bacteria 12523
138 Ga0466967_0018954 3300045976 Bacteria 5520
139 Ga0466967_0059028 3300045976 Bacteria 3393
140 Ga0466967_0094987 3300045976 Bacteria 2716
141 Ga0466967_0350959 3300045976 Bacteria 1428
142 Ga0495617_062958 3300046452 Bacteria 1225
143 Ga0495592_0009074 3300046454 Bacteria 7480
144 Ga0495592_0015774 3300046454 Bacteria 5731
145 Ga0495592_0067820 3300046454 Bacteria 2605
146 Ga0495603_0001801 3300046455 Bacteria 12645
147 Ga0495603_0001820 3300046455 Bacteria 12588
148 Ga0495603_0010009 3300046455 Bacteria 5736
149 Ga0495603_0020712 3300046455 Bacteria 3983
150 Ga0495603_0031841 3300046455 Bacteria 3175
151 Ga0495603_0038978 3300046455 Bacteria 2848
152 Ga0495590_0060213 3300046457 Bacteria 1329
153 Ga0495629_0000446 3300046459 Bacteria 34452
154 Ga0495629_0005475 3300046459 Bacteria 9476
155 Ga0495629_0017287 3300046459 Bacteria 5171
156 Ga0495629_0022644 3300046459 Bacteria 4477
157 Ga0495629_0037943 3300046459 Bacteria 3395
158 Ga0495629_0099490 3300046459 Bacteria 2029
159 Ga0495629_0179324 3300046459 Bacteria 1468
160 Ga0495638_0019950 3300046460 Bacteria 4432
161 Ga0495638_0213974 3300046460 Bacteria 1081
162 Ga0495651_0001434 3300046462 Bacteria 18454
163 Ga0495651_0002046 3300046462 Bacteria 15585
164 Ga0495651_0004606 3300046462 Bacteria 10538
165 Ga0495653_0004140 3300046463 Bacteria 11731
166 Ga0495580_0044038 3300046472 Bacteria 3175
167 Ga0495605_0005625 3300046474 Bacteria 7284
168 Ga0495662_0000316 3300046476 Bacteria 21004
169 Ga0495662_0000320 3300046476 Bacteria 20955
170 Ga0495662_0004382 3300046476 Bacteria 7087
171 Ga0495662_0015459 3300046476 Bacteria 3704
172 Ga0495662_0023177 3300046476 Bacteria 2998
173 Ga0495664_0000381 3300046477 Bacteria 21601
174 Ga0495664_0062949 3300046477 Bacteria 2210
175 Ga0495664_0226118 3300046477 Bacteria 1132
176 Ga0495585_0009597 3300046492 Bacteria 5793
177 Ga0495585_0073354 3300046492 Bacteria 1863
178 Ga0495585_0086299 3300046492 Bacteria 1695
179 Ga0495594_0001106 3300046499 Bacteria 14069
180 Ga0495594_0012750 3300046499 Bacteria 4385
181 Ga0495594_0019570 3300046499 Bacteria 3598
182 Ga0495594_0035226 3300046499 Bacteria 2726
183 Ga0495594_0076056 3300046499 Bacteria 1872
184 Ga0495607_0025293 3300046501 Bacteria 3694
185 Ga0495606_0013139 3300046507 Bacteria 6572
186 Ga0495608_0001864 3300046511 Bacteria 15063
187 Ga0495616_0003832 3300046513 Bacteria 9587
188 Ga0495618_0033858 3300046514 Bacteria 3203
189 Ga0495618_0041773 3300046514 Bacteria 2889
190 Ga0495628_0004297 3300046516 Bacteria 12666
191 Ga0495628_0132143 3300046516 Bacteria 1908
192 Ga0495628_0193880 3300046516 Bacteria 1533
193 Ga0495630_0045757 3300046517 Bacteria 3270
194 Ga0495630_0219030 3300046517 Bacteria 1453
195 Ga0495631_0029552 3300046518 Bacteria 2491
196 Ga0495643_0007065 3300046522 Bacteria 7286
197 Ga0495666_0009851 3300046526 Bacteria 4772
198 Ga0495666_0036139 3300046526 Bacteria 2406
199 Ga0495642_0097898 3300046528 Bacteria 1246
200 Ga0495652_0008783 3300046529 Bacteria 9198
201 Ga0495652_0040438 3300046529 Bacteria 4030
202 Ga0495665_0000346 3300046531 Bacteria 23339
203 Ga0495640_0003231 3300046533 Bacteria 13123
204 Ga0495640_0015791 3300046533 Bacteria 5667
205 Ga0495640_0020491 3300046533 Bacteria 4866
206 Ga0495640_0034862 3300046533 Bacteria 3563
207 Ga0495640_0046948 3300046533 Bacteria 2990
208 Ga0495586_0012076 3300046535 Bacteria 4587
209 Ga0495587_0002014 3300046536 Bacteria 13538
210 Ga0495587_0017369 3300046536 Bacteria 4469
211 Ga0495645_0002377 3300046543 Bacteria 12768
212 Ga0495645_0006649 3300046543 Bacteria 8033
213 Ga0495645_0083475 3300046543 Bacteria 2290
214 Ga0495645_0109108 3300046543 Bacteria 1959
215 Ga0495622_0012254 3300046557 Bacteria 3965
216 Ga0495622_0089964 3300046557 Bacteria 1410
217 Ga0495622_0128248 3300046557 Bacteria 1156
218 Ga0495667_0007151 3300046559 Bacteria 7572
219 Ga0495667_0067979 3300046559 Bacteria 2327
220 Ga0495667_0270758 3300046559 Bacteria 1079
221 Ga0495668_0005061 3300046616 Bacteria 9084
222 Ga0495634_0003019 3300046642 Bacteria 13695
223 Ga0495634_0006539 3300046642 Bacteria 8845
224 Ga0495611_0084458 3300046648 Bacteria 1463
225 Ga0495611_0101915 3300046648 Bacteria 1334
226 Ga0495611_0145352 3300046648 Bacteria 1107
227 Ga0495625_0010025 3300046660 Bacteria 7878
228 Ga0495625_0058832 3300046660 Bacteria 2728
229 Ga0495625_0067613 3300046660 Bacteria 2514
230 Ga0495625_0141691 3300046660 Bacteria 1621
231 Ga0495635_0167527 3300046663 Bacteria 1494
232 Ga0495661_0029451 3300046665 Bacteria 3504
233 Ga0495588_0007232 3300046674 Bacteria 5039
234 Ga0495588_0024855 3300046674 Bacteria 2979
235 Ga0495588_0040614 3300046674 Bacteria 2373
236 Ga0495657_0003287 3300046675 Bacteria 13263
237 Ga0495657_0005383 3300046675 Bacteria 10123
238 Ga0495657_0006967 3300046675 Bacteria 8775
239 Ga0495657_0015808 3300046675 Bacteria 5512
240 Ga0495657_0049898 3300046675 Bacteria 2816
241 Ga0495657_0110149 3300046675 Bacteria 1745
242 Ga0495599_0197595 3300046678 Bacteria 1236
243 Ga0495599_0232006 3300046678 Bacteria 1127
244 Ga0495623_0021726 3300046679 Bacteria 4145
245 Ga0495623_0025493 3300046679 Bacteria 3809
246 Ga0495646_0000678 3300046680 Bacteria 18683
247 Ga0495658_0120051 3300046683 Bacteria 1589
248 Ga0495613_0001527 3300046689 Bacteria 17619
249 Ga0495613_0001528 3300046689 Bacteria 17617
250 Ga0495613_0004842 3300046689 Bacteria 10099
251 Ga0495613_0006255 3300046689 Bacteria 8900
252 Ga0495613_0013444 3300046689 Bacteria 6080
253 Ga0495613_0014389 3300046689 Bacteria 5872
254 Ga0495613_0120530 3300046689 Bacteria 1884
255 Ga0495613_0123299 3300046689 Bacteria 1859
256 Ga0495624_0032500 3300046690 Bacteria 3383
257 Ga0495670_0002744 3300046691 Bacteria 8701
258 Ga0495670_0139906 3300046691 Bacteria 1265
259 Ga0495671_0025001 3300046692 Bacteria 3106
260 Ga0495649_0077659 3300046694 Bacteria 1777
261 Ga0495589_0009491 3300046794 Bacteria 5059
262 Ga0495600_0003334 3300046809 Bacteria 9432
263 Ga0495600_0010394 3300046809 Bacteria 5778
264 Ga0495600_0118626 3300046809 Bacteria 1721
265 Ga0495660_0111718 3300046810 Bacteria 1393
266 Ga0495581_0028321 3300047315 Bacteria 3247
267 Ga0495581_0051733 3300047315 Bacteria 2372
268 Ga0495604_0000243 3300047317 Bacteria 48550
269 Ga0495604_0001376 3300047317 Bacteria 19927
270 Ga0495604_0002783 3300047317 Bacteria 14023
271 Ga0495604_0017876 3300047317 Bacteria 5672
272 Ga0495604_0025574 3300047317 Bacteria 4703
273 Ga0495604_0033343 3300047317 Bacteria 4077
274 Ga0495604_0121949 3300047317 Bacteria 1886
275 Ga0495636_0004369 3300047318 Bacteria 5545
276 Ga0495636_0008909 3300047318 Bacteria 3952
277 Ga0495674_0018435 3300047319 Bacteria 6496
278 Ga0495674_0097178 3300047319 Bacteria 2509
279 Ga0495672_0077091 3300047320 Bacteria 1870
280 Ga0495676_0002573 3300047321 Bacteria 16160
281 Ga0495676_0004614 3300047321 Bacteria 12619
282 Ga0495676_0010185 3300047321 Bacteria 8538
283 Ga0495676_0017899 3300047321 Bacteria 6254
284 Ga0495676_0029126 3300047321 Bacteria 4704
285 Ga0495680_0238040 3300047322 Bacteria 1294
286 Ga0495683_0016474 3300047323 Bacteria 3838
287 Ga0495683_0023711 3300047323 Bacteria 3153
288 Ga0495683_0113548 3300047323 Bacteria 1291
289 Ga0495687_036113 3300047443 Bacteria 2214
290 Ga0495687_055505 3300047443 Bacteria 1655
291 Ga0495675_0002940 3300047444 Bacteria 10236
292 Ga0495675_0019920 3300047444 Bacteria 4263
293 Ga0495675_0021503 3300047444 Bacteria 4109
294 Ga0495675_0049879 3300047444 Bacteria 2660
295 Ga0495675_0057992 3300047444 Bacteria 2455
296 Ga0495677_0003412 3300047445 Bacteria 6168
297 Ga0495685_000874 3300047447 Bacteria 9186
298 Ga0495685_004520 3300047447 Bacteria 4503
299 Ga0495685_010723 3300047447 Bacteria 3079
300 Ga0495681_0000311 3300047470 Bacteria 38913
301 Ga0495681_0001598 3300047470 Bacteria 16840
302 Ga0495681_0022352 3300047470 Bacteria 3387
303 Ga0495684_0228503 3300047471 Bacteria 1361
304 Ga0495686_0013776 3300047472 Bacteria 5602
305 Ga0495686_0087284 3300047472 Bacteria 1897
306 Ga0495593_0000841 3300047673 Bacteria 17847
307 Ga0495593_0005857 3300047673 Bacteria 7243
308 Ga0495593_0108263 3300047673 Bacteria 1420
309 Ga0495593_0232328 3300047673 Bacteria 925
310 Ga0495602_0082823 3300048088 Bacteria 2690
311 Ga0495602_0267485 3300048088 Bacteria 1265
312 Ga0495614_0001085 3300048089 Bacteria 11639
313 Ga0495614_0044293 3300048089 Bacteria 1908
314 Ga0495614_0176296 3300048089 Bacteria 960
315 Ga0496102_0071627 3300048905 Bacteria 3183
316 Ga0496106_0175611 3300048909 Bacteria 1699
317 Ga0496107_0088137 3300048910 Bacteria 2266
318 Ga0496109_0015548 3300048912 Bacteria 6635
319 Ga0496113_0183278 3300048916 Bacteria 1660
320 Ga0496114_0296634 3300048917 Bacteria 1427
321 Ga0496121_0316789 3300048924 Bacteria 1052
322 Ga0496126_0021786 3300048929 Bacteria 6252
323 Ga0495682_0007760 3300049460 Bacteria 4252
324 Ga0501031_0004264 3300049568 Bacteria 9239
325 Ga0501031_0025030 3300049568 Bacteria 3893
326 Ga0501031_0049340 3300049568 Bacteria 2743
327 Ga0501031_0086434 3300049568 Bacteria 2045
328 Ga0501032_0009200 3300049569 Bacteria 7162
329 Ga0501032_0011444 3300049569 Bacteria 6373
330 Ga0501032_0019074 3300049569 Bacteria 4799
331 Ga0501032_0028237 3300049569 Bacteria 3855
332 Ga0501032_0114837 3300049569 Bacteria 1780
333 Ga0501032_0141042 3300049569 Bacteria 1587
334 Ga0501033_0002003 3300049570 Bacteria 17735
335 Ga0501033_0003695 3300049570 Bacteria 12443
336 Ga0501033_0013108 3300049570 Bacteria 6316
337 Ga0501033_0025689 3300049570 Bacteria 4437
338 Ga0501033_0043911 3300049570 Bacteria 3327
339 Ga0501033_0082865 3300049570 Bacteria 2351
340 Ga0501033_0184078 3300049570 Bacteria 1496
341 Ga0501034_0006554 3300049571 Bacteria 12503
342 Ga0501034_0012461 3300049571 Bacteria 8781
343 Ga0501034_0018958 3300049571 Bacteria 7049
344 Ga0501034_0059928 3300049571 Bacteria 3823
345 Ga0501034_0071877 3300049571 Bacteria 3468
346 Ga0501034_0076724 3300049571 Bacteria 3348
347 Ga0501034_0079153 3300049571 Bacteria 3290
348 Ga0501036_0000912 3300049572 Bacteria 22166
349 Ga0501036_0010185 3300049572 Bacteria 7746
350 Ga0501036_0012423 3300049572 Bacteria 7055
351 Ga0501036_0017293 3300049572 Bacteria 6026
352 Ga0501036_0046307 3300049572 Bacteria 3682
353 Ga0501036_0206041 3300049572 Bacteria 1653
354 Ga0501037_0000908 3300049573 Bacteria 22108
355 Ga0501037_0025205 3300049573 Bacteria 4394
356 Ga0501037_0033695 3300049573 Bacteria 3782
357 Ga0501037_0300153 3300049573 Bacteria 1116
358 Ga0501038_0005031 3300049574 Bacteria 12278
359 Ga0501038_0018579 3300049574 Bacteria 6278
360 Ga0501038_0021147 3300049574 Bacteria 5845
361 Ga0501038_0078891 3300049574 Bacteria 2777
362 Ga0501038_0108198 3300049574 Bacteria 2305
363 Ga0501038_0146557 3300049574 Bacteria 1927
364 Ga0501038_0194981 3300049574 Bacteria 1628
365 Ga0501039_0017773 3300049575 Bacteria 5455
366 Ga0501039_0018119 3300049575 Bacteria 5404
367 Ga0501039_0029944 3300049575 Bacteria 4194
368 Ga0501039_0061448 3300049575 Bacteria 2910
369 Ga0501039_0091740 3300049575 Bacteria 2367
370 Ga0501039_0169299 3300049575 Bacteria 1718
371 Ga0501039_0418953 3300049575 Archaea 1052
372 Ga0501040_0003180 3300049576 Bacteria 10634
373 Ga0501041_0001638 3300049577 Bacteria 12511
374 Ga0501042_0026837 3300049578 Bacteria 4046
375 Ga0501042_0189010 3300049578 Bacteria 1486
376 Ga0501043_0000935 3300049579 Bacteria 25870
377 Ga0501043_0004583 3300049579 Bacteria 11213
378 Ga0501043_0050822 3300049579 Bacteria 3258
379 Ga0501043_0086601 3300049579 Bacteria 2461
380 Ga0501043_0100268 3300049579 Bacteria 2276
381 Ga0501046_0012494 3300049580 Bacteria 7226
382 Ga0501046_0039365 3300049580 Bacteria 3786
383 Ga0501046_0039856 3300049580 Bacteria 3757
384 Ga0501047_0000118 3300049581 Bacteria 96347
385 Ga0501047_0003839 3300049581 Bacteria 14128
386 Ga0501047_0008378 3300049581 Bacteria 9760
387 Ga0501047_0015115 3300049581 Bacteria 7348
388 Ga0501047_0035848 3300049581 Bacteria 4792
389 Ga0501047_0036330 3300049581 Bacteria 4762
390 Ga0501047_0112383 3300049581 Bacteria 2606
391 Ga0501047_0118567 3300049581 Bacteria 2528
392 Ga0501047_0159779 3300049581 Bacteria 2125
393 Ga0501048_0001218 3300049582 Bacteria 19474
394 Ga0501048_0050041 3300049582 Bacteria 2976
395 Ga0501048_0072428 3300049582 Bacteria 2432
396 Ga0501048_0292116 3300049582 Bacteria 1159
397 Ga0501068_0003116 3300049584 Bacteria 8864
398 Ga0501069_0142891 3300049585 Bacteria 1373
399 Ga0501070_0004111 3300049586 Bacteria 12512
400 Ga0501070_0030531 3300049586 Bacteria 4516
401 Ga0501071_0007384 3300049587 Bacteria 7211
402 Ga0501072_0000627 3300049588 Bacteria 25332
403 Ga0501072_0052911 3300049588 Bacteria 3197
404 Ga0501073_0074263 3300049589 Bacteria 2367
405 Ga0501074_0009573 3300049590 Bacteria 7034
406 Ga0501074_0016230 3300049590 Bacteria 5409
407 Ga0501074_0144428 3300049590 Bacteria 1702
408 Ga0501076_0004062 3300049592 Bacteria 10349
409 Ga0501077_0028737 3300049593 Bacteria 3534
410 Ga0501235_013928 3300049669 Bacteria 1772
411 Ga0501079_0003778 3300049741 Bacteria 11186
412 Ga0501080_0010852 3300049742 Bacteria 8337
413 Ga0501080_0027991 3300049742 Bacteria 5241
414 Ga0501080_0262443 3300049742 Bacteria 1573
415 Ga0501083_0000556 3300049744 Bacteria 23900
416 Ga0501035_0000900 3300049822 Bacteria 31404
417 Ga0501035_0002053 3300049822 Bacteria 20069
418 Ga0501035_0027507 3300049822 Bacteria 5197
419 Ga0501035_0039857 3300049822 Bacteria 4248
420 Ga0501035_0097595 3300049822 Bacteria 2580
421 Ga0501035_0135529 3300049822 Bacteria 2144
422 Ga0501035_0136820 3300049822 Bacteria 2132
423 Ga0501035_0140233 3300049822 Bacteria 2102
424 Ga0501035_0208413 3300049822 Bacteria 1673
425 Ga0501035_0249275 3300049822 Bacteria 1508
426 Ga0501035_0291000 3300049822 Bacteria 1378
427 Ga0501044_0004846 3300049823 Bacteria 15044
428 Ga0501044_0016438 3300049823 Bacteria 7941
429 Ga0501044_0036426 3300049823 Bacteria 5148
430 Ga0501044_0042523 3300049823 Bacteria 4725
431 Ga0501044_0056047 3300049823 Bacteria 4047
432 Ga0501044_0111761 3300049823 Bacteria 2739
433 Ga0501044_0165642 3300049823 Bacteria 2185
434 Ga0501044_0174929 3300049823 Bacteria 2116
435 Ga0501044_0263520 3300049823 Bacteria 1661
436 Ga0501044_0457807 3300049823 Bacteria 1181
437 Ga0501045_0002964 3300049824 Bacteria 11611
438 Ga0501045_0024360 3300049824 Bacteria 4345
439 Ga0501045_0158971 3300049824 Bacteria 1682
440 Ga0501045_0216807 3300049824 Bacteria 1425
441 nmdc:mga08y16_160276_c1 3300050511 Unclassified 2337
442 Ga0495601_0007820 3300053077 Bacteria 6290
443 Ga0495619_0022510 3300053085 Bacteria 4033
444 Ga0500640_019286 3300053095 Bacteria 2918
445 Ga0500660_068866 3300053100 Bacteria 1668
446 Ga0500560_010445 3300053107 Bacteria 2325
447 Ga0500658_0004659 3300053134 Bacteria 5117
448 Ga0500561_0023432 3300053137 Bacteria 1479
449 Ga0500573_0005895 3300053140 Bacteria 6588
450 Ga0500573_0016711 3300053140 Bacteria 4169
451 Ga0500579_075974 3300053143 Bacteria 1909
452 Ga0500600_0094928 3300053149 Bacteria 1585
453 Ga0500616_0010872 3300053153 Bacteria 5423
454 Ga0500634_0119175 3300053161 Bacteria 1288
455 Ga0466962_0000514 3300061719 Bacteria 16895
456 Ga0466962_0005267 3300061719 Bacteria 6211
457 Ga0466962_0017659 3300061719 Bacteria 3435
458 2515855209 2515154155 Bacteria 7985436
459 2547412169 2547132111 Bacteria 8013147
460 2554260846 2554235005 Bacteria 6457341
461 2585301942 2582581312 Bacteria 7308206
462 2585304069 2582581313 Bacteria 10042643
463 2585312057 2582581314 Bacteria 11452267
464 2616698973 2616644814 Bacteria 11555299
465 2616899589 2616644941 Bacteria 8510691
466 2616901261 2616644941 Bacteria 8510691
467 2643762364 2643221548 Bacteria 8053412
468 2643901708 2643221578 Bacteria 9213798
469 2643946097 2643221587 Bacteria 7586415
470 2644263832 2643221647 Bacteria 10741251
471 2644387871 2643221670 Bacteria 6497041
472 2644390336 2643221670 Bacteria 6497041
473 2644407854 2643221673 Bacteria 9196637
474 2644432886 2643221677 Bacteria 7584031
475 2644438158 2643221678 Bacteria 9540101
476 2644458857 2643221682 Bacteria 6743283
477 2644631850 2643221714 Bacteria 9015452
478 2676473479 2675903058 Bacteria 6822861
479 2768644241 2767802112 Bacteria 6465194
480 2768645349 2767802112 Bacteria 6465194
481 2784591926 2784132148 Bacteria 8627943
482 2785339789 2784746763 Bacteria 9783172
483 2785373154 2784746768 Bacteria 10036182
484 2786674884 2786546132 Bacteria 10419719
485 2793979759 2791355406 Bacteria 11364898
486 2793985303 2791355406 Bacteria 11364898
487 2804849127 2802429296 Bacteria 7227771
488 2808845292 2808606359 Bacteria 9866990
489 2808914992 2808606375 Bacteria 9466072
490 2809235536 2808606448 Bacteria 8656184
491 2811844477 2808606982 Bacteria 7791042
492 2812354415 2811994879 Bacteria 9313447
493 2812477394 2811994917 Bacteria 7761064
494 2819696226 2818991463 Bacteria 7948711
495 2819698452 2818991463 Bacteria 7948711
496 2819743838 2818991472 Bacteria 10089953
497 2827631990 2827628540 Bacteria 6858585
498 2852636039 2852635781 Bacteria 8251373
499 2862184302 2862178590 Bacteria 8583590
500 2862283079 2862281513 Bacteria 9621493
501 2862290945 2862290372 Bacteria 7471434
502 2862393002 2862382967 Bacteria 10317375
503 2862512115 2862507626 Bacteria 9425308
504 2862576228 2862574272 Bacteria 10567477
505 2862707799 2862705112 Bacteria 6563286
506 2863410231 2863404153 Bacteria 9672205
507 2867348380 2867346516 Bacteria 7608576
508 2867434277 2867428634 Bacteria 9590268
509 2867476055 2867475112 Bacteria 6909112
510 2867476121 2867475112 Bacteria 6909112
511 2873152654 2873151551 Bacteria 8625867
512 2875397898 2875391855 Bacteria 7600475
513 2877677747 2877676314 Bacteria 9512378
514 2912716035 2912715099 Bacteria 9460473
515 2912728988 2912723979 Bacteria 8557534
516 2912764081 2912757875 Bacteria 7940295
517 2918504772 2918501144 Bacteria 8668083
518 2918507671 2918501144 Bacteria 8668083
519 2919470918 2919468124 Bacteria 9133025
520 2935392944 2935390628 Bacteria 7043367
521 2946046595 2946045630 Bacteria 8527308
522 2946071287 2946064051 Bacteria 8957905
523 2946079120 2946072368 Bacteria 8999607
524 2947225460 2947224130 Bacteria 9938529
525 2954005967 2954002825 Bacteria 9173742
526 2954009674 2954002825 Bacteria 9173742
527 2954382529 2954380949 Bacteria 10050426
528 2954680517 2954673503 Bacteria 9685905
529 2954683636 2954682443 Bacteria 9862841
530 2954693329 2954691527 Bacteria 10720516
531 2954708422 2954701450 Bacteria 10834262
532 2954713036 2954711539 Bacteria 10867210
533 2954722995 2954721474 Bacteria 10456478
534 2954738834 2954731030 Bacteria 10243860
535 2954741905 2954740390 Bacteria 10229294
536 2954757692 2954749733 Bacteria 10366972
537 2954760882 2954759201 Bacteria 9358192
538 2966599572 2966598605 Bacteria 7676064
539 2966603569 2966598605 Bacteria 7676064
540 2990046821 2990044586 Bacteria 6603797
541 2990063409 2990059506 Bacteria 9321252
542 2990089077 2990088156 Bacteria 6657676
543 2995470496 2995463766 Bacteria 8577691
544 2997455219 2997451912 Bacteria 8492419
545 2997456402 2997451912 Bacteria 8492419
546 2997603685 2997600082 Bacteria 9896405
547 2997604905 2997600082 Bacteria 9896405
548 3006328233 3006321560 Bacteria 8247479
549 3006395571 3006393351 Bacteria 6615579
550 3006426765 3006425503 Bacteria 6491253
551 3006429082 3006425503 Bacteria 6491253
552 3006486722 3006486233 Bacteria 8157040
553 3006500070 3006493962 Bacteria 8825450
554 8008490872 8008485437 Bacteria 7198341
555 8008564227 8008558824 Bacteria 10610750
556 8008575902 8008574985 Bacteria 7815457
557 8023629734 8023623736 Bacteria 8593882
558 8023631421 8023623736 Bacteria 8593882
559 8025416379 8025413630 Bacteria 7014048
560 8025479979 8025478263 Bacteria 8209203
561 8025527781 8025524527 Bacteria 7197316
562 8025533401 8025530807 Bacteria 8495698
563 8033687329 8033684223 Bacteria 6906479
564 8033691788 8033684223 Bacteria 6906479
565 8047895047 8047893842 Bacteria 11723082
566 8047899443 8047893842 Bacteria 11723082
567 8048136267 8048127548 Bacteria 11053136
568 8048359487 8048356638 Bacteria 11044339
569 8048364001 8048356638 Bacteria 11044339
570 8048372074 8048369669 Bacteria 11666822
571 8048376391 8048369669 Bacteria 11666822
572 8048381008 8048379754 Bacteria 11877923
573 8048385446 8048379754 Bacteria 11877923
574 8048409648 8048406513 Bacteria 8936924
575 8054165769 8054160619 Bacteria 7783213
576 8054166200 8054160619 Bacteria 7783213
577 8056450245 8056447290 Bacteria 7680491
578 8056668274 8056667051 Bacteria 6953971
579 8056669496 8056667051 Bacteria 6953971
580 8056836077 8056829672 Bacteria 9045328
581 Ga0466969_0004039
582 rootH1_10018221
583 rootH2_10049598
584 rootL2_10032697
585 rootH1_10055552
586 JGI25160J50197_1011063
587 JGI25160J50197_1018475
588 JGI25160J50197_1030462
589 JGI25160J50197_1030645
590 Ga0006562J51391_1017815
591 Ga0006562J51391_1119490
592 Ga0006562J51391_1188389
593 Ga0006562J51391_1188391
594 Ga0070714_100046176
595 Ga0070713_100013821
596 Ga0068853_100035802
597 Ga0068856_100574673
598 Ga0081455_10114887
599 Ga0075363_100000602
600 Ga0105251_10016495
601 Ga0105250_10040949
602 Ga0111539_10323980
603 Ga0182008_10000665
604 Ga0182006_1067808
605 Ga0182007_10001425
606 Ga0183367_1001
607 Ga0213875_10002501
608 Ga0213875_10002768
609 Ga0224712_10000656
610 Ga0207426_1001696
611 Ga0207426_1003839
612 Ga0207426_1012998
613 Ga0207426_1013436
614 Ga0207426_1040688
615 Ga0207713_1022195
616 Ga0207699_10028336
617 Ga0207663_10067329
618 Ga0207700_10045770
619 Ga0207664_10023803
620 Ga0207664_10062766
621 Ga0207658_10098940
622 Ga0207639_10056897
623 Ga0207702_10457095
624 Ga0307517_10006702
625 Ga0307515_10000163
626 Ga0307515_10137096
627 Ga0307511_10000150
628 Ga0307511_10043021
629 Ga0307511_10170217
630 Ga0307512_10002523
631 Ga0307512_10103208
632 Ga0265327_10031026
633 Ga0307513_10020326
634 Ga0307513_10345883
635 Ga0307509_10164206
636 Ga0307509_10322594
637 Ga0307509_10323526
638 Ga0307508_10011341
639 Ga0307508_10026758
640 Ga0307508_10029127
641 Ga0307508_10061713
642 Ga0307514_10056273
643 Ga0307514_10154060
644 Ga0307516_10002626
645 Ga0307516_10006868
646 Ga0307516_10013194
647 Ga0307516_10038271
648 Ga0307413_10154182
649 Ga0307518_10101216
650 Ga0307518_10109365
651 Ga0307510_10044446
652 Ga0307510_10053280
653 Ga0307510_10165022
654 Ga0395900_0031806
655 Ga0395898_0015938
656 Ga0395898_0023672
657 Ga0436364_0836110
658 Ga0436364_1179377
659 Ga0395901_0023825
660 Ga0439436_0002576
661 Ga0439436_0015629
662 Ga0439439_0038267
663 Ga0451797_0909223
664 Ga0451837_0485740
665 Ga0451853_0177550
666 Ga0439433_0006466
667 Ga0439442_012419
668 Ga0439449_0001600
669 Ga0439449_0003189
670 Ga0439455_0002844
671 Ga0439457_000007
672 Ga0439457_003719
673 Ga0439462_0028980
674 Ga0450897_000511
675 Ga0450894_001008
676 Ga0450898_003390
677 Ga0450899_000188
678 Ga0450903_000472
679 Ga0450906_000953
680 Ga0439458_0011785
681 Ga0450908_030723
682 Ga0466969_0005593
683 Ga0466969_0017575
684 Ga0466969_0026882
685 Ga0466969_0073038
686 Ga0466972_0000509
687 Ga0466972_0025285
688 Ga0466972_0040286
689 Ga0466972_0097144
690 Ga0466965_0002882
691 Ga0466966_0001953
692 Ga0466966_0012740
693 Ga0466966_0015962
694 Ga0466966_0024399
695 Ga0466961_0002554
696 Ga0466961_0005919
697 Ga0466961_0005921
698 Ga0466961_0016881
699 Ga0466963_0001746
700 Ga0466963_0008025
701 Ga0466963_0035920
702 Ga0466963_0085102
703 Ga0466964_0000802
704 Ga0466971_0000288
705 Ga0466971_0004533
706 Ga0466971_0015111
707 Ga0466968_0108910
708 Ga0466970_0000573
709 Ga0466970_0006787
710 Ga0466957_0005800
711 Ga0466960_0001078
712 Ga0466959_0001737
713 Ga0466959_0013645
714 Ga0466959_0014841
715 Ga0466959_0044637
716 Ga0466958_0000978
717 Ga0466967_0001936
718 Ga0466967_0018954
719 Ga0466967_0059028
720 Ga0466967_0094987
721 Ga0466967_0350959
722 Ga0495617_062958
723 Ga0495592_0009074
724 Ga0495592_0015774
725 Ga0495592_0067820
726 Ga0495603_0001801
727 Ga0495603_0001820
728 Ga0495603_0010009
729 Ga0495603_0020712
730 Ga0495603_0031841
731 Ga0495603_0038978
732 Ga0495590_0060213
733 Ga0495629_0000446
734 Ga0495629_0005475
735 Ga0495629_0017287
736 Ga0495629_0022644
737 Ga0495629_0037943
738 Ga0495629_0099490
739 Ga0495629_0179324
740 Ga0495638_0019950
741 Ga0495638_0213974
742 Ga0495651_0001434
743 Ga0495651_0002046
744 Ga0495651_0004606
745 Ga0495653_0004140
746 Ga0495580_0044038
747 Ga0495605_0005625
748 Ga0495662_0000316
749 Ga0495662_0000320
750 Ga0495662_0004382
751 Ga0495662_0015459
752 Ga0495662_0023177
753 Ga0495664_0000381
754 Ga0495664_0062949
755 Ga0495664_0226118
756 Ga0495585_0009597
757 Ga0495585_0073354
758 Ga0495585_0086299
759 Ga0495594_0001106
760 Ga0495594_0012750
761 Ga0495594_0019570
762 Ga0495594_0035226
763 Ga0495594_0076056
764 Ga0495607_0025293
765 Ga0495606_0013139
766 Ga0495608_0001864
767 Ga0495616_0003832
768 Ga0495618_0033858
769 Ga0495618_0041773
770 Ga0495628_0004297
771 Ga0495628_0132143
772 Ga0495628_0193880
773 Ga0495630_0045757
774 Ga0495630_0219030
775 Ga0495631_0029552
776 Ga0495643_0007065
777 Ga0495666_0009851
778 Ga0495666_0036139
779 Ga0495642_0097898
780 Ga0495652_0008783
781 Ga0495652_0040438
782 Ga0495665_0000346
783 Ga0495640_0003231
784 Ga0495640_0015791
785 Ga0495640_0020491
786 Ga0495640_0034862
787 Ga0495640_0046948
788 Ga0495586_0012076
789 Ga0495587_0002014
790 Ga0495587_0017369
791 Ga0495645_0002377
792 Ga0495645_0006649
793 Ga0495645_0083475
794 Ga0495645_0109108
795 Ga0495622_0012254
796 Ga0495622_0089964
797 Ga0495622_0128248
798 Ga0495667_0007151
799 Ga0495667_0067979
800 Ga0495667_0270758
801 Ga0495668_0005061
802 Ga0495634_0003019
803 Ga0495634_0006539
804 Ga0495611_0084458
805 Ga0495611_0101915
806 Ga0495611_0145352
807 Ga0495625_0010025
808 Ga0495625_0058832
809 Ga0495625_0067613
810 Ga0495625_0141691
811 Ga0495635_0167527
812 Ga0495661_0029451
813 Ga0495588_0007232
814 Ga0495588_0024855
815 Ga0495588_0040614
816 Ga0495657_0003287
817 Ga0495657_0005383
818 Ga0495657_0006967
819 Ga0495657_0015808
820 Ga0495657_0049898
821 Ga0495657_0110149
822 Ga0495599_0197595
823 Ga0495599_0232006
824 Ga0495623_0021726
825 Ga0495623_0025493
826 Ga0495646_0000678
827 Ga0495658_0120051
828 Ga0495613_0001527
829 Ga0495613_0001528
830 Ga0495613_0004842
831 Ga0495613_0006255
832 Ga0495613_0013444
833 Ga0495613_0014389
834 Ga0495613_0120530
835 Ga0495613_0123299
836 Ga0495624_0032500
837 Ga0495670_0002744
838 Ga0495670_0139906
839 Ga0495671_0025001
840 Ga0495649_0077659
841 Ga0495589_0009491
842 Ga0495600_0003334
843 Ga0495600_0010394
844 Ga0495600_0118626
845 Ga0495660_0111718
846 Ga0495581_0028321
847 Ga0495581_0051733
848 Ga0495604_0000243
849 Ga0495604_0001376
850 Ga0495604_0002783
851 Ga0495604_0017876
852 Ga0495604_0025574
853 Ga0495604_0033343
854 Ga0495604_0121949
855 Ga0495636_0004369
856 Ga0495636_0008909
857 Ga0495674_0018435
858 Ga0495674_0097178
859 Ga0495672_0077091
860 Ga0495676_0002573
861 Ga0495676_0004614
862 Ga0495676_0010185
863 Ga0495676_0017899
864 Ga0495676_0029126
865 Ga0495680_0238040
866 Ga0495683_0016474
867 Ga0495683_0023711
868 Ga0495683_0113548
869 Ga0495687_036113
870 Ga0495687_055505
871 Ga0495675_0002940
872 Ga0495675_0019920
873 Ga0495675_0021503
874 Ga0495675_0049879
875 Ga0495675_0057992
876 Ga0495677_0003412
877 Ga0495685_000874
878 Ga0495685_004520
879 Ga0495685_010723
880 Ga0495681_0000311
881 Ga0495681_0001598
882 Ga0495681_0022352
883 Ga0495684_0228503
884 Ga0495686_0013776
885 Ga0495686_0087284
886 Ga0495593_0000841
887 Ga0495593_0005857
888 Ga0495593_0108263
889 Ga0495593_0232328
890 Ga0495602_0082823
891 Ga0495602_0267485
892 Ga0495614_0001085
893 Ga0495614_0044293
894 Ga0495614_0176296
895 Ga0496102_0071627
896 Ga0496106_0175611
897 Ga0496107_0088137
898 Ga0496109_0015548
899 Ga0496113_0183278
900 Ga0496114_0296634
901 Ga0496121_0316789
902 Ga0496126_0021786
903 Ga0495682_0007760
904 Ga0501031_0004264
905 Ga0501031_0025030
906 Ga0501031_0049340
907 Ga0501031_0086434
908 Ga0501032_0009200
909 Ga0501032_0011444
910 Ga0501032_0019074
911 Ga0501032_0028237
912 Ga0501032_0114837
913 Ga0501032_0141042
914 Ga0501033_0002003
915 Ga0501033_0003695
916 Ga0501033_0013108
917 Ga0501033_0025689
918 Ga0501033_0043911
919 Ga0501033_0082865
920 Ga0501033_0184078
921 Ga0501034_0006554
922 Ga0501034_0012461
923 Ga0501034_0018958
924 Ga0501034_0059928
925 Ga0501034_0071877
926 Ga0501034_0076724
927 Ga0501034_0079153
928 Ga0501036_0000912
929 Ga0501036_0010185
930 Ga0501036_0012423
931 Ga0501036_0017293
932 Ga0501036_0046307
933 Ga0501036_0206041
934 Ga0501037_0000908
935 Ga0501037_0025205
936 Ga0501037_0033695
937 Ga0501037_0300153
938 Ga0501038_0005031
939 Ga0501038_0018579
940 Ga0501038_0021147
941 Ga0501038_0078891
942 Ga0501038_0108198
943 Ga0501038_0146557
944 Ga0501038_0194981
945 Ga0501039_0017773
946 Ga0501039_0018119
947 Ga0501039_0029944
948 Ga0501039_0061448
949 Ga0501039_0091740
950 Ga0501039_0169299
951 Ga0501039_0418953
952 Ga0501040_0003180
953 Ga0501041_0001638
954 Ga0501042_0026837
955 Ga0501042_0189010
956 Ga0501043_0000935
957 Ga0501043_0004583
958 Ga0501043_0050822
959 Ga0501043_0086601
960 Ga0501043_0100268
961 Ga0501046_0012494
962 Ga0501046_0039365
963 Ga0501046_0039856
964 Ga0501047_0000118
965 Ga0501047_0003839
966 Ga0501047_0008378
967 Ga0501047_0015115
968 Ga0501047_0035848
969 Ga0501047_0036330
970 Ga0501047_0112383
971 Ga0501047_0118567
972 Ga0501047_0159779
973 Ga0501048_0001218
974 Ga0501048_0050041
975 Ga0501048_0072428
976 Ga0501048_0292116
977 Ga0501068_0003116
978 Ga0501069_0142891
979 Ga0501070_0004111
980 Ga0501070_0030531
981 Ga0501071_0007384
982 Ga0501072_0000627
983 Ga0501072_0052911
984 Ga0501073_0074263
985 Ga0501074_0009573
986 Ga0501074_0016230
987 Ga0501074_0144428
988 Ga0501076_0004062
989 Ga0501077_0028737
990 Ga0501235_013928
991 Ga0501079_0003778
992 Ga0501080_0010852
993 Ga0501080_0027991
994 Ga0501080_0262443
995 Ga0501083_0000556
996 Ga0501035_0000900
997 Ga0501035_0002053
998 Ga0501035_0027507
999 Ga0501035_0039857
1000 Ga0501035_0097595
1001 Ga0501035_0135529
1002 Ga0501035_0136820
1003 Ga0501035_0140233
1004 Ga0501035_0208413
1005 Ga0501035_0249275
1006 Ga0501035_0291000
1007 Ga0501044_0004846
1008 Ga0501044_0016438
1009 Ga0501044_0036426
1010 Ga0501044_0042523
1011 Ga0501044_0056047
1012 Ga0501044_0111761
1013 Ga0501044_0165642
1014 Ga0501044_0174929
1015 Ga0501044_0263520
1016 Ga0501044_0457807
1017 Ga0501045_0002964
1018 Ga0501045_0024360
1019 Ga0501045_0158971
1020 Ga0501045_0216807
1021 nmdc:mga08y16_160276_c1
1022 Ga0495601_0007820
1023 Ga0495619_0022510
1024 Ga0500640_019286
1025 Ga0500660_068866
1026 Ga0500560_010445
1027 Ga0500658_0004659
1028 Ga0500561_0023432
1029 Ga0500573_0005895
1030 Ga0500573_0016711
1031 Ga0500579_075974
1032 Ga0500600_0094928
1033 Ga0500616_0010872
1034 Ga0500634_0119175
1035 Ga0466962_0000514
1036 Ga0466962_0005267
1037 Ga0466962_0017659
1038 2515855209
1039 2547412169
1040 2554260846
1041 2585301942
1042 2585304069
1043 2585312057
1044 2616698973
1045 2616899589
1046 2616901261
1047 2643762364
1048 2643901708
1049 2643946097
1050 2644263832
1051 2644387871
1052 2644390336
1053 2644407854
1054 2644432886
1055 2644438158
1056 2644458857
1057 2644631850
1058 2676473479
1059 2768644241
1060 2768645349
1061 2784591926
1062 2785339789
1063 2785373154
1064 2786674884
1065 2793979759
1066 2793985303
1067 2804849127
1068 2808845292
1069 2808914992
1070 2809235536
1071 2811844477
1072 2812354415
1073 2812477394
1074 2819696226
1075 2819698452
1076 2819743838
1077 2827631990
1078 2852636039
1079 2862184302
1080 2862283079
1081 2862290945
1082 2862393002
1083 2862512115
1084 2862576228
1085 2862707799
1086 2863410231
1087 2867348380
1088 2867434277
1089 2867476055
1090 2867476121
1091 2873152654
1092 2875397898
1093 2877677747
1094 2912716035
1095 2912728988
1096 2912764081
1097 2918504772
1098 2918507671
1099 2919470918
1100 2935392944
1101 2946046595
1102 2946071287
1103 2946079120
1104 2947225460
1105 2954005967
1106 2954009674
1107 2954382529
1108 2954680517
1109 2954683636
1110 2954693329
1111 2954708422
1112 2954713036
1113 2954722995
1114 2954738834
1115 2954741905
1116 2954757692
1117 2954760882
1118 2966599572
1119 2966603569
1120 2990046821
1121 2990063409
1122 2990089077
1123 2995470496
1124 2997455219
1125 2997456402
1126 2997603685
1127 2997604905
1128 3006328233
1129 3006395571
1130 3006426765
1131 3006429082
1132 3006486722
1133 3006500070
1134 8008490872
1135 8008564227
1136 8008575902
1137 8023629734
1138 8023631421
1139 8025416379
1140 8025479979
1141 8025527781
1142 8025533401
1143 8033687329
1144 8033691788
1145 8047895047
1146 8047899443
1147 8048136267
1148 8048359487
1149 8048364001
1150 8048372074
1151 8048376391
1152 8048381008
1153 8048385446
1154 8048409648
1155 8054165769
1156 8054166200
1157 8056450245
1158 8056668274
1159 8056669496
1160 8056836077

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

35

191

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e4q-assembly1.cif.gz_A crystal structure of the drosophila melanogaster polypeptide n-acetylgalactosaminyl transferase pgant9a in complex with udp and mn2+ 0.7794 1 231
6e4r-assembly1.cif.gz_A crystal structure of the drosophila melanogaster polypeptide n-acetylgalactosaminyl transferase pgant9b 0.7745 1 234
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7689 2 205
6nqt-assembly3.cif.gz_F galnac-t2 soaked with udp-sugar 0.7683 1 240
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7653 2 205
ID Description Score Start End Superfamily
af_P36667_1_231_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8132 6 211 3.90.550.10
af_P9WMY3_4_248_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8054 6 210 3.90.550.10
af_A0A096MIV6_83_419_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8004 2 225 3.90.550.10
af_P9WLV3_5_208_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7902 4 211 3.90.550.10
af_P9WLV3_5_208_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.776 4 211 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A6G3WJZ9-F1-model_v4 Glycosyltransferase 1.002 4 114 GO:0016740
AF-A0A7K2N2W8-F1-model_v4 Glycosyltransferase 1.001 4 135 GO:0016740
AF-A0A7J0D1N8-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9957 1 209
AF-A0A6B3IJ81-F1-model_v4 Glycosyltransferase family 2 protein 0.995 4 190 GO:0016740
AF-A0A7Y6GLK2-F1-model_v4 Glycosyltransferase family 2 protein 0.9935 13 214 GO:0016740

Map