F465937

General Info

Members Datasets Scaffolds Average Seq Length
580 243 1160 242

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10239577|Ga0114129_102395772
Length 290
Sequence VRWQATGVPGAAATLGWSLRDTALDLIDSRDVLIQSSVAASLCRRTPRDHMNLKNKVAIVTGGTKGIGRGIAEALMREGVSVCISARHQSEIDEAVERLNQSGNGKAIGFRCDVRDYDEVKALIAYTVKELGGFDILINNAGIGIARTTVDETSPEDFRAVLETNLFGVFYCCHEAIPQMKKRGGGCIINISSLAGVNAHSRMAAYNASKFGLNGFSEALMQEVRYDNIKVSYIMPGSVNTEFGGDSPSDEKSWQLTPADIARVVIDLLHHDDRSLPSRVEIRPSKPPKK

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
170 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
171 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
172 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
173 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
174 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
175 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
176 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
177 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
178 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
191 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
192 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
193 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
194 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
195 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
196 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
204 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
226 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
227 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
228 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
229 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
230 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
234 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.59
Rhizosphere 95.34
Stem 0
Stem Tuber 0
Unclassified 9.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10239577 3300009147 Bacteria 2439
2 LJNas_1003526 3300000546 Bacteria 1790
3 JGI24034J14986_101972 3300001432 Bacteria 1105
4 JGI24748J21848_1000005 3300002074 Bacteria 228924
5 JGI24034J26672_10000003 3300002239 Bacteria 501747
6 JGI25406J46586_10119264 3300003203 Bacteria 777
7 Ga0065714_10064469 3300005288 Bacteria 61986
8 Ga0065704_10102020 3300005289 Bacteria 2218
9 Ga0065704_10116909 3300005289 Bacteria 1845
10 Ga0065712_10000127 3300005290 Bacteria 117106
11 Ga0065712_10081509 3300005290 Bacteria 3001
12 Ga0065712_10106940 3300005290 Bacteria 1906
13 Ga0065715_10094180 3300005293 Unclassified 4415
14 Ga0065715_10106485 3300005293 Bacteria 2827
15 Ga0065715_10119478 3300005293 Unclassified 2285
16 Ga0065707_10001347 3300005295 Bacteria 9462
17 Ga0065707_10176836 3300005295 Bacteria 1435
18 Ga0065707_10185616 3300005295 Bacteria 1385
19 Ga0070683_100309363 3300005329 Bacteria 1503
20 Ga0070690_100002909 3300005330 Bacteria 9237
21 Ga0070690_100003548 3300005330 Bacteria 8552
22 Ga0070690_100029330 3300005330 Bacteria 3411
23 Ga0070690_100092233 3300005330 Bacteria 1997
24 Ga0070690_100139636 3300005330 Bacteria 1644
25 Ga0070670_100053226 3300005331 Bacteria 3476
26 Ga0070670_100097076 3300005331 Bacteria 2535
27 Ga0070670_100149516 3300005331 Bacteria 2021
28 Ga0068869_100028133 3300005334 Bacteria 3925
29 Ga0068869_100311427 3300005334 Bacteria 1274
30 Ga0070666_10056183 3300005335 Bacteria 2658
31 Ga0070666_10072881 3300005335 Bacteria 2339
32 Ga0070680_100030369 3300005336 Bacteria 4341
33 Ga0070680_100216749 3300005336 Bacteria 1615
34 Ga0070682_100000214 3300005337 Bacteria 42673
35 Ga0070682_100010167 3300005337 Bacteria 5335
36 Ga0068868_100024103 3300005338 Unclassified 4612
37 Ga0068868_100216737 3300005338 Unclassified 1601
38 Ga0070660_100110316 3300005339 Bacteria 2188
39 Ga0070689_100164763 3300005340 Unclassified 1793
40 Ga0070689_100255942 3300005340 Bacteria 1446
41 Ga0070689_100514232 3300005340 Bacteria 1027
42 Ga0070687_100010488 3300005343 Bacteria 4010
43 Ga0070692_10001483 3300005345 Bacteria 8562
44 Ga0070668_100001808 3300005347 Bacteria 15558
45 Ga0070668_100255898 3300005347 Bacteria 1455
46 Ga0070669_100008535 3300005353 Bacteria 7315
47 Ga0070669_100053892 3300005353 Bacteria 2945
48 Ga0070669_100060864 3300005353 Unclassified 2774
49 Ga0070671_100029247 3300005355 Bacteria 4543
50 Ga0070671_100175669 3300005355 Unclassified 1812
51 Ga0070671_100227341 3300005355 Bacteria 1583
52 Ga0070671_100282083 3300005355 Bacteria 1413
53 Ga0070673_100051248 3300005364 Bacteria 3231
54 Ga0070673_100162676 3300005364 Unclassified 1899
55 Ga0070673_100312612 3300005364 Bacteria 1386
56 Ga0070673_100620226 3300005364 Bacteria 988
57 Ga0070688_100304573 3300005365 Bacteria 1153
58 Ga0070659_100002816 3300005366 Bacteria 12387
59 Ga0070659_100026805 3300005366 Bacteria 4436
60 Ga0070659_100194502 3300005366 Unclassified 1668
61 Ga0070659_100289402 3300005366 Bacteria 1364
62 Ga0070667_100049280 3300005367 Bacteria 3547
63 Ga0070667_100519898 3300005367 Bacteria 1092
64 Ga0070703_10000007 3300005406 Bacteria 98798
65 Ga0070703_10000986 3300005406 Bacteria 8969
66 Ga0070703_10144360 3300005406 Bacteria 888
67 Ga0070709_10115416 3300005434 Bacteria 1811
68 Ga0070701_10260087 3300005438 Bacteria 1051
69 Ga0070705_100005813 3300005440 Bacteria 6028
70 Ga0070705_100070382 3300005440 Bacteria 2113
71 Ga0070705_100251505 3300005440 Bacteria 1241
72 Ga0070705_100611349 3300005440 Bacteria 845
73 Ga0070700_100013536 3300005441 Bacteria 4583
74 Ga0070700_100174493 3300005441 Bacteria 1491
75 Ga0070700_100188660 3300005441 Bacteria 1440
76 Ga0070700_100353075 3300005441 Bacteria 1091
77 Ga0070694_100093686 3300005444 Bacteria 2112
78 Ga0070694_100113889 3300005444 Bacteria 1930
79 Ga0070694_100153697 3300005444 Bacteria 1683
80 Ga0070694_100160426 3300005444 Bacteria 1649
81 Ga0070694_100161294 3300005444 Unclassified 1645
82 Ga0070694_100176925 3300005444 Bacteria 1575
83 Ga0070694_100232256 3300005444 Bacteria 1388
84 Ga0070694_100294502 3300005444 Bacteria 1241
85 Ga0070694_100439261 3300005444 Bacteria 1028
86 Ga0070708_100001325 3300005445 Bacteria 18942
87 Ga0070708_100016776 3300005445 Bacteria 6087
88 Ga0070708_100057475 3300005445 Bacteria 3464
89 Ga0070708_100218429 3300005445 Unclassified 1787
90 Ga0070708_100555636 3300005445 Unclassified 1083
91 Ga0070663_100006080 3300005455 Bacteria 7223
92 Ga0070662_100553095 3300005457 Unclassified 964
93 Ga0070662_100574703 3300005457 Bacteria 946
94 Ga0070681_10001229 3300005458 Bacteria 22285
95 Ga0070681_10014314 3300005458 Bacteria 7892
96 Ga0070681_10065921 3300005458 Bacteria 3590
97 Ga0070706_100014612 3300005467 Bacteria 7255
98 Ga0070706_100017338 3300005467 Bacteria 6645
99 Ga0070706_100048084 3300005467 Bacteria 3937
100 Ga0070706_100063863 3300005467 Bacteria 3403
101 Ga0070707_100000076 3300005468 Bacteria 86928
102 Ga0070707_100049838 3300005468 Bacteria 4014
103 Ga0070707_100090136 3300005468 Bacteria 2968
104 Ga0070707_100124060 3300005468 Bacteria 2508
105 Ga0070707_100338077 3300005468 Bacteria 1463
106 Ga0070707_100350824 3300005468 Unclassified 1433
107 Ga0070698_100000397 3300005471 Bacteria 45907
108 Ga0070698_100005914 3300005471 Bacteria 13342
109 Ga0070698_100022750 3300005471 Bacteria 6554
110 Ga0070698_100096994 3300005471 Bacteria 2924
111 Ga0070698_100120535 3300005471 Bacteria 2583
112 Ga0070698_100325177 3300005471 Unclassified 1469
113 Ga0070698_100463532 3300005471 Bacteria 1203
114 Ga0070699_100000284 3300005518 Bacteria 48451
115 Ga0070699_100008188 3300005518 Bacteria 9071
116 Ga0070699_100009912 3300005518 Bacteria 8252
117 Ga0070699_100199023 3300005518 Bacteria 1781
118 Ga0070699_100206268 3300005518 Bacteria 1749
119 Ga0070699_100337969 3300005518 Bacteria 1355
120 Ga0070699_100362316 3300005518 Unclassified 1307
121 Ga0070679_100000712 3300005530 Bacteria 28607
122 Ga0070679_100012900 3300005530 Bacteria 8001
123 Ga0070679_100159131 3300005530 Unclassified 2233
124 Ga0070697_100000408 3300005536 Bacteria 33197
125 Ga0070697_100003345 3300005536 Bacteria 12315
126 Ga0070697_100009173 3300005536 Bacteria 7729
127 Ga0070697_100009184 3300005536 Bacteria 7724
128 Ga0070697_100047811 3300005536 Bacteria 3469
129 Ga0070697_100250904 3300005536 Unclassified 1513
130 Ga0070697_100493849 3300005536 Bacteria 1070
131 Ga0070697_100564940 3300005536 Bacteria 998
132 Ga0068853_100010449 3300005539 Bacteria 7515
133 Ga0068853_100783799 3300005539 Bacteria 912
134 Ga0070686_100002672 3300005544 Bacteria 9819
135 Ga0070686_100005862 3300005544 Bacteria 6807
136 Ga0070686_100007459 3300005544 Bacteria 6105
137 Ga0070695_100303767 3300005545 Bacteria 1180
138 Ga0070695_100445807 3300005545 Bacteria 991
139 Ga0070696_100028015 3300005546 Unclassified 3842
140 Ga0070696_100060437 3300005546 Bacteria 2650
141 Ga0070696_100091332 3300005546 Bacteria 2168
142 Ga0070696_100125379 3300005546 Bacteria 1863
143 Ga0070696_100175759 3300005546 Bacteria 1586
144 Ga0070696_100525655 3300005546 Bacteria 945
145 Ga0070696_100542449 3300005546 Bacteria 931
146 Ga0070693_100072572 3300005547 Bacteria 2031
147 Ga0070665_100184098 3300005548 Bacteria 2089
148 Ga0070665_100332883 3300005548 Bacteria 1523
149 Ga0070704_100039415 3300005549 Bacteria 3244
150 Ga0070704_100089539 3300005549 Bacteria 2289
151 Ga0070704_100107398 3300005549 Bacteria 2117
152 Ga0070704_100159487 3300005549 Bacteria 1783
153 Ga0068855_100087928 3300005563 Bacteria 3590
154 Ga0068855_100121148 3300005563 Bacteria 2994
155 Ga0070664_100015387 3300005564 Bacteria 6256
156 Ga0070664_100265417 3300005564 Bacteria 1545
157 Ga0070664_100373255 3300005564 Bacteria 1301
158 Ga0070664_100407147 3300005564 Unclassified 1244
159 Ga0068857_100001531 3300005577 Bacteria 18478
160 Ga0068857_100093795 3300005577 Bacteria 2688
161 Ga0068854_100069703 3300005578 Bacteria 2568
162 Ga0068854_100101588 3300005578 Unclassified 2157
163 Ga0068854_100233821 3300005578 Bacteria 1460
164 Ga0068856_100002583 3300005614 Bacteria 18648
165 Ga0068856_100539307 3300005614 Unclassified 1188
166 Ga0070702_100134269 3300005615 Bacteria 1567
167 Ga0068859_100010577 3300005617 Bacteria 9289
168 Ga0068859_100012765 3300005617 Bacteria 8442
169 Ga0068859_100116877 3300005617 Bacteria 2732
170 Ga0068864_100004995 3300005618 Bacteria 10867
171 Ga0068864_100006828 3300005618 Bacteria 9349
172 Ga0068864_100022972 3300005618 Bacteria 5233
173 Ga0068864_100346735 3300005618 Bacteria 1400
174 Ga0068866_10195404 3300005718 Unclassified 1205
175 Ga0068861_100002667 3300005719 Bacteria 11679
176 Ga0068861_100013679 3300005719 Bacteria 5683
177 Ga0068861_100098713 3300005719 Bacteria 2318
178 Ga0068861_100165644 3300005719 Bacteria 1827
179 Ga0068851_10022117 3300005834 Bacteria 3094
180 Ga0068863_100796291 3300005841 Unclassified 943
181 Ga0068858_100000115 3300005842 Bacteria 84564
182 Ga0068858_100046816 3300005842 Bacteria 4009
183 Ga0068858_100064288 3300005842 Bacteria 3395
184 Ga0068858_100077756 3300005842 Bacteria 3083
185 Ga0068858_100085033 3300005842 Bacteria 2943
186 Ga0068858_100113564 3300005842 Bacteria 2530
187 Ga0068858_100269556 3300005842 Bacteria 1620
188 Ga0068858_100790241 3300005842 Bacteria 926
189 Ga0068860_100008128 3300005843 Bacteria 10447
190 Ga0068860_100020928 3300005843 Bacteria 6338
191 Ga0068860_100046097 3300005843 Bacteria 4157
192 Ga0068860_100063713 3300005843 Bacteria 3501
193 Ga0068860_100072253 3300005843 Bacteria 3279
194 Ga0068860_100248350 3300005843 Bacteria 1732
195 Ga0068860_100299275 3300005843 Bacteria 1576
196 Ga0068860_100439443 3300005843 Bacteria 1296
197 Ga0068862_100008728 3300005844 Bacteria 8390
198 Ga0068862_100157026 3300005844 Bacteria 2028
199 Ga0068862_100475975 3300005844 Bacteria 1181
200 Ga0081539_10000189 3300005985 Bacteria 143321
201 Ga0081539_10207350 3300005985 Bacteria 900
202 Ga0070715_10000005 3300006163 Bacteria 298716
203 Ga0070716_100000005 3300006173 Bacteria 273485
204 Ga0070716_100128565 3300006173 Bacteria 1598
205 Ga0097621_100006958 3300006237 Bacteria 8054
206 Ga0097621_100212649 3300006237 Bacteria 1682
207 Ga0068871_100007729 3300006358 Bacteria 7695
208 Ga0068871_100071448 3300006358 Bacteria 2855
209 Ga0068871_100149079 3300006358 Bacteria 1994
210 Ga0075428_100293026 3300006844 Bacteria 1750
211 Ga0075430_100015228 3300006846 Bacteria 6548
212 Ga0075430_100292950 3300006846 Bacteria 1346
213 Ga0075431_100031972 3300006847 Bacteria 5422
214 Ga0075431_100344845 3300006847 Unclassified 1498
215 Ga0075433_10008071 3300006852 Bacteria 8381
216 Ga0075433_10017478 3300006852 Bacteria 5941
217 Ga0075433_10018734 3300006852 Bacteria 5758
218 Ga0075433_10078306 3300006852 Bacteria 2913
219 Ga0075433_10111592 3300006852 Bacteria 2426
220 Ga0075433_10289610 3300006852 Bacteria 1451
221 Ga0075433_10387415 3300006852 Bacteria 1234
222 Ga0075433_10735528 3300006852 Bacteria 863
223 Ga0075434_100102394 3300006871 Bacteria 2871
224 Ga0075434_100277135 3300006871 Bacteria 1696
225 Ga0075429_100193087 3300006880 Bacteria 1783
226 Ga0075429_100202101 3300006880 Bacteria 1741
227 Ga0075429_100213783 3300006880 Bacteria 1689
228 Ga0075436_100000005 3300006914 Bacteria 360336
229 Ga0097620_100010577 3300006931 Bacteria 9289
230 Ga0097620_100012765 3300006931 Bacteria 8442
231 Ga0097620_100116875 3300006931 Bacteria 2732
232 Ga0075435_100000147 3300007076 Bacteria 39845
233 Ga0075435_100009387 3300007076 Bacteria 7078
234 Ga0075435_100037525 3300007076 Bacteria 3859
235 Ga0075435_100055727 3300007076 Bacteria 3193
236 Ga0075435_100195967 3300007076 Bacteria 1711
237 Ga0075435_100246258 3300007076 Bacteria 1521
238 Ga0075435_100632064 3300007076 Bacteria 929
239 Ga0105240_10067814 3300009093 Bacteria 4421
240 Ga0105240_10072053 3300009093 Bacteria 4271
241 Ga0105240_10435612 3300009093 Bacteria 1470
242 Ga0105240_10656265 3300009093 Bacteria 1149
243 Ga0111539_10013285 3300009094 Bacteria 10289
244 Ga0111539_10200876 3300009094 Bacteria 2325
245 Ga0111539_10768758 3300009094 Bacteria 1121
246 Ga0105245_10192583 3300009098 Bacteria 1954
247 Ga0105245_10940399 3300009098 Bacteria 907
248 Ga0105245_11033559 3300009098 Bacteria 867
249 Ga0105247_10000003 3300009101 Bacteria 694517
250 Ga0105247_10000299 3300009101 Bacteria 44672
251 Ga0114129_10062843 3300009147 Bacteria 5186
252 Ga0114129_10109803 3300009147 Bacteria 3807
253 Ga0114129_10139274 3300009147 Bacteria 3327
254 Ga0114129_10158806 3300009147 Bacteria 3091
255 Ga0114129_10833114 3300009147 Bacteria 1174
256 Ga0114129_11305388 3300009147 Bacteria 899
257 Ga0105243_10000111 3300009148 Bacteria 93590
258 Ga0105243_10002523 3300009148 Bacteria 15284
259 Ga0105243_10228217 3300009148 Bacteria 1650
260 Ga0105243_10306417 3300009148 Bacteria 1441
261 Ga0105243_10627122 3300009148 Bacteria 1039
262 Ga0105241_10044228 3300009174 Bacteria 3374
263 Ga0105241_10102642 3300009174 Bacteria 2276
264 Ga0105242_10000308 3300009176 Bacteria 39141
265 Ga0105242_10001307 3300009176 Bacteria 19716
266 Ga0105242_10002647 3300009176 Bacteria 14033
267 Ga0105242_10026672 3300009176 Unclassified 4580
268 Ga0105242_10102653 3300009176 Bacteria 2425
269 Ga0105242_10360864 3300009176 Bacteria 1345
270 Ga0105248_10008069 3300009177 Bacteria 11556
271 Ga0105248_10008383 3300009177 Bacteria 11347
272 Ga0105248_10010684 3300009177 Bacteria 10130
273 Ga0105248_10131072 3300009177 Bacteria 2829
274 Ga0105248_10209477 3300009177 Bacteria 2196
275 Ga0105248_10459301 3300009177 Bacteria 1435
276 Ga0105248_10714625 3300009177 Unclassified 1131
277 Ga0105237_10001044 3300009545 Bacteria 37212
278 Ga0105237_10022612 3300009545 Bacteria 6449
279 Ga0105238_10757724 3300009551 Bacteria 985
280 Ga0105249_10000216 3300009553 Bacteria 65660
281 Ga0105249_10058157 3300009553 Unclassified 3543
282 Ga0105249_10126181 3300009553 Bacteria 2437
283 Ga0105249_10131480 3300009553 Bacteria 2390
284 Ga0105249_10304804 3300009553 Unclassified 1599
285 Ga0105249_11183057 3300009553 Unclassified 835
286 Ga0105239_10049094 3300010375 Bacteria 4627
287 Ga0105239_10235598 3300010375 Bacteria 2054
288 Ga0105239_10293569 3300010375 Bacteria 1830
289 Ga0157373_10072433 3300013100 Bacteria 2432
290 Ga0157373_10110155 3300013100 Bacteria 1936
291 Ga0157369_10503901 3300013105 Unclassified 1252
292 Ga0157374_10214051 3300013296 Archaea 1890
293 Ga0157374_10265767 3300013296 Bacteria 1691
294 Ga0157374_10401186 3300013296 Unclassified 1368
295 Ga0157374_10433718 3300013296 Bacteria 1314
296 Ga0157374_10438687 3300013296 Bacteria 1306
297 Ga0157378_10000007 3300013297 Bacteria 177173
298 Ga0157378_10024147 3300013297 Bacteria 5348
299 Ga0157378_10072638 3300013297 Unclassified 3092
300 Ga0157378_10077837 3300013297 Bacteria 2990
301 Ga0157378_10110386 3300013297 Bacteria 2521
302 Ga0157378_10140468 3300013297 Bacteria 2243
303 Ga0157378_10666138 3300013297 Bacteria 1058
304 Ga0163162_10000045 3300013306 Bacteria 127819
305 Ga0163162_10000611 3300013306 Bacteria 33150
306 Ga0163162_10000664 3300013306 Bacteria 31849
307 Ga0163162_10011767 3300013306 Bacteria 8535
308 Ga0163162_10012729 3300013306 Bacteria 8216
309 Ga0163162_10074759 3300013306 Bacteria 3447
310 Ga0163162_10159928 3300013306 Bacteria 2374
311 Ga0163162_10418492 3300013306 Bacteria 1472
312 Ga0163162_10907392 3300013306 Bacteria 994
313 Ga0157372_10002400 3300013307 Bacteria 20287
314 Ga0157372_10023069 3300013307 Bacteria 6743
315 Ga0157372_10056802 3300013307 Bacteria 4373
316 Ga0157375_10017171 3300013308 Bacteria 6524
317 Ga0157375_10090346 3300013308 Bacteria 3121
318 Ga0157375_10178852 3300013308 Bacteria 2272
319 Ga0157375_10499098 3300013308 Bacteria 1381
320 Ga0157375_10825513 3300013308 Bacteria 1075
321 Ga0163163_10001672 3300014325 Bacteria 18710
322 Ga0163163_10005144 3300014325 Bacteria 11275
323 Ga0163163_10048037 3300014325 Bacteria 4195
324 Ga0163163_10089838 3300014325 Bacteria 3084
325 Ga0163163_10186844 3300014325 Bacteria 2120
326 Ga0157380_10000563 3300014326 Bacteria 22799
327 Ga0157380_10029653 3300014326 Bacteria 4183
328 Ga0157380_10029992 3300014326 Bacteria 4162
329 Ga0157380_10031155 3300014326 Bacteria 4092
330 Ga0157380_10044927 3300014326 Unclassified 3464
331 Ga0157379_10032806 3300014968 Bacteria 4630
332 Ga0157376_10100108 3300014969 Bacteria 2530
333 Ga0157376_10309337 3300014969 Bacteria 1499
334 Ga0157376_10890931 3300014969 Unclassified 907
335 Ga0163161_10107006 3300017792 Bacteria 2087
336 Ga0213873_10028686 3300021358 Unclassified 1366
337 Ga0213876_10000022 3300021384 Bacteria 259520
338 Ga0213876_10000599 3300021384 Bacteria 26722
339 Ga0213875_10000057 3300021388 Bacteria 136082
340 Ga0213875_10005449 3300021388 Bacteria 6829
341 Ga0207672_1000396 3300025223 Bacteria 5649
342 Ga0207656_10022615 3300025321 Bacteria 2524
343 Ga0207653_10000050 3300025885 Bacteria 90383
344 Ga0207653_10002188 3300025885 Bacteria 6227
345 Ga0207710_10000001 3300025900 Bacteria 1797433
346 Ga0207710_10003601 3300025900 Bacteria 6867
347 Ga0207680_10066327 3300025903 Bacteria 2219
348 Ga0207680_10212693 3300025903 Bacteria 1322
349 Ga0207647_10181216 3300025904 Bacteria 1223
350 Ga0207685_10000020 3300025905 Bacteria 138584
351 Ga0207705_10221631 3300025909 Bacteria 1437
352 Ga0207684_10004757 3300025910 Bacteria 12716
353 Ga0207684_10005385 3300025910 Bacteria 11823
354 Ga0207684_10009216 3300025910 Bacteria 8723
355 Ga0207684_10865309 3300025910 Unclassified 761
356 Ga0207707_10000080 3300025912 Bacteria 96693
357 Ga0207707_10060263 3300025912 Bacteria 3302
358 Ga0207695_10090348 3300025913 Bacteria 3078
359 Ga0207671_10003000 3300025914 Bacteria 17302
360 Ga0207660_10005840 3300025917 Bacteria 7986
361 Ga0207662_10007671 3300025918 Bacteria 5879
362 Ga0207662_10173067 3300025918 Bacteria 1385
363 Ga0207657_10204136 3300025919 Bacteria 1589
364 Ga0207649_10117930 3300025920 Bacteria 1785
365 Ga0207652_10000234 3300025921 Bacteria 58103
366 Ga0207652_10054537 3300025921 Unclassified 3437
367 Ga0207646_10002837 3300025922 Bacteria 20147
368 Ga0207646_10017794 3300025922 Bacteria 6640
369 Ga0207646_10067046 3300025922 Bacteria 3204
370 Ga0207646_10082497 3300025922 Bacteria 2875
371 Ga0207646_10310824 3300025922 Unclassified 1424
372 Ga0207681_10001415 3300025923 Bacteria 15492
373 Ga0207681_10016129 3300025923 Bacteria 4667
374 Ga0207681_10046254 3300025923 Bacteria 2927
375 Ga0207681_10085030 3300025923 Bacteria 2244
376 Ga0207681_10419637 3300025923 Bacteria 1084
377 Ga0207650_10006423 3300025925 Bacteria 8010
378 Ga0207659_10145137 3300025926 Bacteria 1847
379 Ga0207644_10000101 3300025931 Bacteria 62525
380 Ga0207644_10161860 3300025931 Bacteria 1740
381 Ga0207644_10232554 3300025931 Bacteria 1465
382 Ga0207690_10003301 3300025932 Bacteria 9652
383 Ga0207706_10204172 3300025933 Bacteria 1733
384 Ga0207706_10533067 3300025933 Unclassified 1012
385 Ga0207686_10000070 3300025934 Bacteria 93682
386 Ga0207686_10001788 3300025934 Bacteria 11961
387 Ga0207686_10003969 3300025934 Bacteria 7941
388 Ga0207686_10083867 3300025934 Bacteria 2087
389 Ga0207709_10000153 3300025935 Bacteria 93682
390 Ga0207709_10002166 3300025935 Bacteria 12574
391 Ga0207709_10216553 3300025935 Bacteria 1378
392 Ga0207709_10221990 3300025935 Bacteria 1363
393 Ga0207709_10222979 3300025935 Bacteria 1361
394 Ga0207670_10127483 3300025936 Bacteria 1859
395 Ga0207665_10000012 3300025939 Bacteria 143062
396 Ga0207665_10151004 3300025939 Bacteria 1664
397 Ga0207691_10037678 3300025940 Bacteria 4476
398 Ga0207711_10140146 3300025941 Bacteria 2175
399 Ga0207711_10212805 3300025941 Bacteria 1766
400 Ga0207711_10384110 3300025941 Unclassified 1303
401 Ga0207711_10400956 3300025941 Bacteria 1274
402 Ga0207711_10479511 3300025941 Bacteria 1159
403 Ga0207689_10005859 3300025942 Bacteria 10892
404 Ga0207689_10035691 3300025942 Bacteria 4129
405 Ga0207689_10035897 3300025942 Bacteria 4115
406 Ga0207689_10145311 3300025942 Bacteria 1954
407 Ga0207661_10591900 3300025944 Unclassified 1018
408 Ga0207679_10031683 3300025945 Bacteria 3703
409 Ga0207679_10090941 3300025945 Bacteria 2361
410 Ga0207667_10500018 3300025949 Bacteria 1233
411 Ga0207651_10010642 3300025960 Bacteria 5108
412 Ga0207651_10138657 3300025960 Unclassified 1875
413 Ga0207712_10000418 3300025961 Bacteria 36399
414 Ga0207712_10088648 3300025961 Bacteria 2272
415 Ga0207668_10001047 3300025972 Bacteria 16496
416 Ga0207668_10402135 3300025972 Bacteria 1158
417 Ga0207640_10029275 3300025981 Bacteria 3379
418 Ga0207640_10036150 3300025981 Bacteria 3098
419 Ga0207640_10043654 3300025981 Unclassified 2867
420 Ga0207640_10150501 3300025981 Bacteria 1709
421 Ga0207677_10502600 3300026023 Bacteria 1048
422 Ga0207703_10000581 3300026035 Bacteria 37276
423 Ga0207703_10094401 3300026035 Unclassified 2522
424 Ga0207703_10105111 3300026035 Bacteria 2400
425 Ga0207639_10299603 3300026041 Bacteria 1421
426 Ga0207678_10077757 3300026067 Unclassified 2842
427 Ga0207708_10021372 3300026075 Bacteria 4880
428 Ga0207708_10196339 3300026075 Bacteria 1608
429 Ga0207708_10209762 3300026075 Bacteria 1557
430 Ga0207708_10360060 3300026075 Bacteria 1195
431 Ga0207708_10521974 3300026075 Unclassified 998
432 Ga0207702_10600320 3300026078 Bacteria 1080
433 Ga0207702_10797915 3300026078 Bacteria 933
434 Ga0207641_10479118 3300026088 Bacteria 1206
435 Ga0207641_10784423 3300026088 Bacteria 942
436 Ga0207648_10980238 3300026089 Bacteria 791
437 Ga0207676_10068339 3300026095 Bacteria 2841
438 Ga0207676_10244221 3300026095 Bacteria 1613
439 Ga0207676_10309358 3300026095 Bacteria 1446
440 Ga0207676_10384716 3300026095 Bacteria 1307
441 Ga0207674_10000098 3300026116 Bacteria 98523
442 Ga0207674_10113717 3300026116 Bacteria 2679
443 Ga0207675_100003953 3300026118 Bacteria 14387
444 Ga0207675_100019507 3300026118 Bacteria 6328
445 Ga0207675_100052636 3300026118 Bacteria 3799
446 Ga0207675_100061104 3300026118 Bacteria 3517
447 Ga0207675_100210306 3300026118 Bacteria 1870
448 Ga0207675_100392448 3300026118 Bacteria 1366
449 Ga0207698_10267347 3300026142 Bacteria 1574
450 Ga0207428_10018252 3300027907 Bacteria 5996
451 Ga0268266_10025823 3300028379 Bacteria 4998
452 Ga0268266_10131249 3300028379 Bacteria 2241
453 Ga0268266_10431253 3300028379 Bacteria 1251
454 Ga0268265_10143902 3300028380 Bacteria 2000
455 Ga0268265_10153918 3300028380 Bacteria 1943
456 Ga0268265_10239667 3300028380 Bacteria 1599
457 Ga0268264_10017094 3300028381 Bacteria 5939
458 Ga0268264_10089951 3300028381 Bacteria 2644
459 Ga0268264_10287453 3300028381 Bacteria 1543
460 Ga0268264_10997970 3300028381 Bacteria 844
461 Ga0307410_10449318 3300031852 Bacteria 1051
462 Ga0307406_10675878 3300031901 Bacteria 860
463 Ga0307416_100425813 3300032002 Bacteria 1373
464 Ga0307414_10338370 3300032004 Bacteria 1287
465 Ga0307414_10838719 3300032004 Bacteria 840
466 Ga0307411_10595119 3300032005 Bacteria 950
467 Ga0373948_0002730 3300034817 Bacteria 2642
468 Ga0373958_0011434 3300034819 Bacteria 1500
469 Ga0373959_0011124 3300034820 Bacteria 1584
470 Ga0373938_0012616 3300034957 Bacteria 1589
471 Ga0373929_0023622 3300035085 Bacteria 1264
472 Ga0373934_0096664 3300035086 Bacteria 1193
473 Ga0373949_0004437 3300035090 Bacteria 3219
474 Ga0373951_0008026 3300035091 Bacteria 2392
475 Ga0373951_0030767 3300035091 Bacteria 1264
476 Ga0373939_0000857 3300035114 Bacteria 7528
477 Ga0373941_0014609 3300035115 Bacteria 2101
478 Ga0373960_0039195 3300035121 Bacteria 1361
479 Ga0373942_0002582 3300035207 Bacteria 4367
480 Ga0373961_0007661 3300035241 Bacteria 2616
481 Ga0373935_0016372 3300035692 Bacteria 4486
482 Ga0373937_0187074 3300036401 Bacteria 1945
483 Ga0373937_0206434 3300036401 Unclassified 1848
484 Ga0373925_0387898 3300037068 Bacteria 1138
485 Ga0395900_0417670 3300037418 Bacteria 1303
486 Ga0395905_0008060 3300037471 Bacteria 10405
487 Ga0436364_0952179 3300037853 Bacteria 2164
488 Ga0436364_1102754 3300037853 Bacteria 136103
489 Ga0436364_1200027 3300037853 Bacteria 5913
490 Ga0436365_0407503 3300039437 Bacteria 219857
491 Ga0436365_0807082 3300039437 Unclassified 3533
492 Ga0436365_1165922 3300039437 Bacteria 6877
493 Ga0436365_1438887 3300039437 Bacteria 84801
494 Ga0436363_0414766 3300039450 Bacteria 1448
495 Ga0436362_0537088 3300039453 Unclassified 1366
496 Ga0439453_0015164 3300041408 Bacteria 1330
497 Ga0439433_0056329 3300041999 Bacteria 932
498 Ga0439446_0092140 3300042156 Bacteria 950
499 Ga0439434_0039454 3300042435 Bacteria 1449
500 Ga0439435_0033374 3300042436 Bacteria 1409
501 Ga0439464_0029407 3300042439 Bacteria 1535
502 Ga0451577_0193477 3300042876 Bacteria 1835
503 Ga0453683_0030737 3300044673 Bacteria 3394
504 Ga0453683_0175728 3300044673 Bacteria 1357
505 Ga0451576_0086105 3300045051 Bacteria 3268
506 Ga0451576_0428575 3300045051 Bacteria 1388
507 Ga0466967_1044701 3300045976 Bacteria 814
508 Ga0495651_0267128 3300046462 Bacteria 1162
509 Ga0495662_0084061 3300046476 Bacteria 1549
510 Ga0495663_0005462 3300046525 Bacteria 3527
511 Ga0495598_0000167 3300046537 Bacteria 11296
512 Ga0495621_0000148 3300046539 Bacteria 15226
513 Ga0495635_0057393 3300046663 Bacteria 2679
514 Ga0495636_0010756 3300047318 Bacteria 3618
515 Ga0495636_0165101 3300047318 Bacteria 999
516 Ga0495680_0300685 3300047322 Bacteria 1127
517 Ga0496102_0004432 3300048905 Bacteria 11859
518 Ga0496102_0172393 3300048905 Bacteria 2037
519 Ga0496103_0135425 3300048906 Bacteria 1574
520 Ga0496104_0055890 3300048907 Bacteria 3732
521 Ga0496106_0090579 3300048909 Bacteria 2360
522 Ga0496106_0479634 3300048909 Bacteria 999
523 Ga0496107_0283971 3300048910 Bacteria 1232
524 Ga0496108_0061681 3300048911 Bacteria 3156
525 Ga0496109_0051205 3300048912 Bacteria 3761
526 Ga0496109_0914855 3300048912 Bacteria 815
527 Ga0496110_0011594 3300048913 Bacteria 7225
528 Ga0496111_0069128 3300048914 Bacteria 2568
529 Ga0496112_0030239 3300048915 Bacteria 5240
530 Ga0496112_0159915 3300048915 Bacteria 2219
531 Ga0496113_0103251 3300048916 Bacteria 2211
532 Ga0501296_014547 3300049519 Bacteria 966
533 Ga0501036_0159991 3300049572 Bacteria 1899
534 Ga0501042_0330815 3300049578 Bacteria 1101
535 Ga0501075_0243063 3300049591 Bacteria 1372
536 Ga0501075_0403453 3300049591 Unclassified 1042
537 Ga0501077_0074754 3300049593 Bacteria 2146
538 Ga0501202_009411 3300049652 Unclassified 1796
539 Ga0501228_015042 3300049666 Bacteria 822
540 Ga0501230_027889 3300049667 Bacteria 1034
541 Ga0501233_088170 3300049668 Bacteria 807
542 Ga0501235_013004 3300049669 Bacteria 1831
543 Ga0501249_006714 3300049679 Unclassified 2370
544 Ga0501081_0332385 3300049743 Bacteria 1118
545 Ga0501083_0047301 3300049744 Bacteria 2907
546 Ga0501268_011706 3300049765 Bacteria 1390
547 Ga0501273_021552 3300049770 Bacteria 875
548 Ga0501045_0472617 3300049824 Bacteria 931
549 nmdc:mga05p37_133603_c1 3300050507 Bacteria 3044
550 nmdc:mga05p37_205811_c1 3300050507 Bacteria 2380
551 nmdc:mga05p37_365549_c1 3300050507 Bacteria 1695
552 nmdc:mga05p37_397970_c1 3300050507 Bacteria 1609
553 nmdc:mga05p37_41380_c1 3300050507 Bacteria 5657
554 nmdc:mga05p37_540817_c1 3300050507 Bacteria 1328
555 nmdc:mga05p37_636243_c1 3300050507 Bacteria 1197
556 nmdc:mga09592_263065_c1 3300050508 Bacteria 1496
557 nmdc:mga09592_518197_c1 3300050508 Bacteria 1026
558 nmdc:mga09592_78315_c1 3300050508 Bacteria 2813
559 nmdc:mga06r32_423158_c1 3300050510 Bacteria 1313
560 nmdc:mga06r32_748019_c1 3300050510 Bacteria 941
561 nmdc:mga08y16_287890_c1 3300050511 Unclassified 1694
562 nmdc:mga08y16_91298_c1 3300050511 Bacteria 3174
563 nmdc:mga0n895_11878_c1 3300050512 Bacteria 7790
564 nmdc:mga0n895_193631_c1 3300050512 Bacteria 2064
565 nmdc:mga0n895_527182_c1 3300050512 Bacteria 1188
566 nmdc:mga0n895_94069_c1 3300050512 Bacteria 3000
567 nmdc:mga0n895_97_c2 3300050512 Bacteria 37428
568 nmdc:mga0rr50_183096_c1 3300050513 Bacteria 1713
569 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
570 nmdc:mga0rr50_45895_c1 3300050513 Bacteria 3214
571 nmdc:mga0rr50_5817_c1 3300050513 Bacteria 7409
572 nmdc:mga0rr50_79_c1 3300050513 Bacteria 53907
573 nmdc:mga08x19_152_c1 3300050514 Bacteria 57153
574 nmdc:mga08x19_178_c1 3300050514 Bacteria 51286
575 nmdc:mga0a205_127896_c1 3300050515 Bacteria 2440
576 nmdc:mga0a205_191868_c1 3300050515 Bacteria 1935
577 nmdc:mga0a205_27245_c1 3300050515 Bacteria 5457
578 nmdc:mga0a205_370123_c1 3300050515 Bacteria 1299
579 nmdc:mga0a205_38657_c1 3300050515 Bacteria 4591
580 nmdc:mga0a205_50248_c1 3300050515 Bacteria 4025
581 Ga0114129_10239577
582 LJNas_1003526
583 JGI24034J14986_101972
584 JGI24748J21848_1000005
585 JGI24034J26672_10000003
586 JGI25406J46586_10119264
587 Ga0065714_10064469
588 Ga0065704_10102020
589 Ga0065704_10116909
590 Ga0065712_10000127
591 Ga0065712_10081509
592 Ga0065712_10106940
593 Ga0065715_10094180
594 Ga0065715_10106485
595 Ga0065715_10119478
596 Ga0065707_10001347
597 Ga0065707_10176836
598 Ga0065707_10185616
599 Ga0070683_100309363
600 Ga0070690_100002909
601 Ga0070690_100003548
602 Ga0070690_100029330
603 Ga0070690_100092233
604 Ga0070690_100139636
605 Ga0070670_100053226
606 Ga0070670_100097076
607 Ga0070670_100149516
608 Ga0068869_100028133
609 Ga0068869_100311427
610 Ga0070666_10056183
611 Ga0070666_10072881
612 Ga0070680_100030369
613 Ga0070680_100216749
614 Ga0070682_100000214
615 Ga0070682_100010167
616 Ga0068868_100024103
617 Ga0068868_100216737
618 Ga0070660_100110316
619 Ga0070689_100164763
620 Ga0070689_100255942
621 Ga0070689_100514232
622 Ga0070687_100010488
623 Ga0070692_10001483
624 Ga0070668_100001808
625 Ga0070668_100255898
626 Ga0070669_100008535
627 Ga0070669_100053892
628 Ga0070669_100060864
629 Ga0070671_100029247
630 Ga0070671_100175669
631 Ga0070671_100227341
632 Ga0070671_100282083
633 Ga0070673_100051248
634 Ga0070673_100162676
635 Ga0070673_100312612
636 Ga0070673_100620226
637 Ga0070688_100304573
638 Ga0070659_100002816
639 Ga0070659_100026805
640 Ga0070659_100194502
641 Ga0070659_100289402
642 Ga0070667_100049280
643 Ga0070667_100519898
644 Ga0070703_10000007
645 Ga0070703_10000986
646 Ga0070703_10144360
647 Ga0070709_10115416
648 Ga0070701_10260087
649 Ga0070705_100005813
650 Ga0070705_100070382
651 Ga0070705_100251505
652 Ga0070705_100611349
653 Ga0070700_100013536
654 Ga0070700_100174493
655 Ga0070700_100188660
656 Ga0070700_100353075
657 Ga0070694_100093686
658 Ga0070694_100113889
659 Ga0070694_100153697
660 Ga0070694_100160426
661 Ga0070694_100161294
662 Ga0070694_100176925
663 Ga0070694_100232256
664 Ga0070694_100294502
665 Ga0070694_100439261
666 Ga0070708_100001325
667 Ga0070708_100016776
668 Ga0070708_100057475
669 Ga0070708_100218429
670 Ga0070708_100555636
671 Ga0070663_100006080
672 Ga0070662_100553095
673 Ga0070662_100574703
674 Ga0070681_10001229
675 Ga0070681_10014314
676 Ga0070681_10065921
677 Ga0070706_100014612
678 Ga0070706_100017338
679 Ga0070706_100048084
680 Ga0070706_100063863
681 Ga0070707_100000076
682 Ga0070707_100049838
683 Ga0070707_100090136
684 Ga0070707_100124060
685 Ga0070707_100338077
686 Ga0070707_100350824
687 Ga0070698_100000397
688 Ga0070698_100005914
689 Ga0070698_100022750
690 Ga0070698_100096994
691 Ga0070698_100120535
692 Ga0070698_100325177
693 Ga0070698_100463532
694 Ga0070699_100000284
695 Ga0070699_100008188
696 Ga0070699_100009912
697 Ga0070699_100199023
698 Ga0070699_100206268
699 Ga0070699_100337969
700 Ga0070699_100362316
701 Ga0070679_100000712
702 Ga0070679_100012900
703 Ga0070679_100159131
704 Ga0070697_100000408
705 Ga0070697_100003345
706 Ga0070697_100009173
707 Ga0070697_100009184
708 Ga0070697_100047811
709 Ga0070697_100250904
710 Ga0070697_100493849
711 Ga0070697_100564940
712 Ga0068853_100010449
713 Ga0068853_100783799
714 Ga0070686_100002672
715 Ga0070686_100005862
716 Ga0070686_100007459
717 Ga0070695_100303767
718 Ga0070695_100445807
719 Ga0070696_100028015
720 Ga0070696_100060437
721 Ga0070696_100091332
722 Ga0070696_100125379
723 Ga0070696_100175759
724 Ga0070696_100525655
725 Ga0070696_100542449
726 Ga0070693_100072572
727 Ga0070665_100184098
728 Ga0070665_100332883
729 Ga0070704_100039415
730 Ga0070704_100089539
731 Ga0070704_100107398
732 Ga0070704_100159487
733 Ga0068855_100087928
734 Ga0068855_100121148
735 Ga0070664_100015387
736 Ga0070664_100265417
737 Ga0070664_100373255
738 Ga0070664_100407147
739 Ga0068857_100001531
740 Ga0068857_100093795
741 Ga0068854_100069703
742 Ga0068854_100101588
743 Ga0068854_100233821
744 Ga0068856_100002583
745 Ga0068856_100539307
746 Ga0070702_100134269
747 Ga0068859_100010577
748 Ga0068859_100012765
749 Ga0068859_100116877
750 Ga0068864_100004995
751 Ga0068864_100006828
752 Ga0068864_100022972
753 Ga0068864_100346735
754 Ga0068866_10195404
755 Ga0068861_100002667
756 Ga0068861_100013679
757 Ga0068861_100098713
758 Ga0068861_100165644
759 Ga0068851_10022117
760 Ga0068863_100796291
761 Ga0068858_100000115
762 Ga0068858_100046816
763 Ga0068858_100064288
764 Ga0068858_100077756
765 Ga0068858_100085033
766 Ga0068858_100113564
767 Ga0068858_100269556
768 Ga0068858_100790241
769 Ga0068860_100008128
770 Ga0068860_100020928
771 Ga0068860_100046097
772 Ga0068860_100063713
773 Ga0068860_100072253
774 Ga0068860_100248350
775 Ga0068860_100299275
776 Ga0068860_100439443
777 Ga0068862_100008728
778 Ga0068862_100157026
779 Ga0068862_100475975
780 Ga0081539_10000189
781 Ga0081539_10207350
782 Ga0070715_10000005
783 Ga0070716_100000005
784 Ga0070716_100128565
785 Ga0097621_100006958
786 Ga0097621_100212649
787 Ga0068871_100007729
788 Ga0068871_100071448
789 Ga0068871_100149079
790 Ga0075428_100293026
791 Ga0075430_100015228
792 Ga0075430_100292950
793 Ga0075431_100031972
794 Ga0075431_100344845
795 Ga0075433_10008071
796 Ga0075433_10017478
797 Ga0075433_10018734
798 Ga0075433_10078306
799 Ga0075433_10111592
800 Ga0075433_10289610
801 Ga0075433_10387415
802 Ga0075433_10735528
803 Ga0075434_100102394
804 Ga0075434_100277135
805 Ga0075429_100193087
806 Ga0075429_100202101
807 Ga0075429_100213783
808 Ga0075436_100000005
809 Ga0097620_100010577
810 Ga0097620_100012765
811 Ga0097620_100116875
812 Ga0075435_100000147
813 Ga0075435_100009387
814 Ga0075435_100037525
815 Ga0075435_100055727
816 Ga0075435_100195967
817 Ga0075435_100246258
818 Ga0075435_100632064
819 Ga0105240_10067814
820 Ga0105240_10072053
821 Ga0105240_10435612
822 Ga0105240_10656265
823 Ga0111539_10013285
824 Ga0111539_10200876
825 Ga0111539_10768758
826 Ga0105245_10192583
827 Ga0105245_10940399
828 Ga0105245_11033559
829 Ga0105247_10000003
830 Ga0105247_10000299
831 Ga0114129_10062843
832 Ga0114129_10109803
833 Ga0114129_10139274
834 Ga0114129_10158806
835 Ga0114129_10833114
836 Ga0114129_11305388
837 Ga0105243_10000111
838 Ga0105243_10002523
839 Ga0105243_10228217
840 Ga0105243_10306417
841 Ga0105243_10627122
842 Ga0105241_10044228
843 Ga0105241_10102642
844 Ga0105242_10000308
845 Ga0105242_10001307
846 Ga0105242_10002647
847 Ga0105242_10026672
848 Ga0105242_10102653
849 Ga0105242_10360864
850 Ga0105248_10008069
851 Ga0105248_10008383
852 Ga0105248_10010684
853 Ga0105248_10131072
854 Ga0105248_10209477
855 Ga0105248_10459301
856 Ga0105248_10714625
857 Ga0105237_10001044
858 Ga0105237_10022612
859 Ga0105238_10757724
860 Ga0105249_10000216
861 Ga0105249_10058157
862 Ga0105249_10126181
863 Ga0105249_10131480
864 Ga0105249_10304804
865 Ga0105249_11183057
866 Ga0105239_10049094
867 Ga0105239_10235598
868 Ga0105239_10293569
869 Ga0157373_10072433
870 Ga0157373_10110155
871 Ga0157369_10503901
872 Ga0157374_10214051
873 Ga0157374_10265767
874 Ga0157374_10401186
875 Ga0157374_10433718
876 Ga0157374_10438687
877 Ga0157378_10000007
878 Ga0157378_10024147
879 Ga0157378_10072638
880 Ga0157378_10077837
881 Ga0157378_10110386
882 Ga0157378_10140468
883 Ga0157378_10666138
884 Ga0163162_10000045
885 Ga0163162_10000611
886 Ga0163162_10000664
887 Ga0163162_10011767
888 Ga0163162_10012729
889 Ga0163162_10074759
890 Ga0163162_10159928
891 Ga0163162_10418492
892 Ga0163162_10907392
893 Ga0157372_10002400
894 Ga0157372_10023069
895 Ga0157372_10056802
896 Ga0157375_10017171
897 Ga0157375_10090346
898 Ga0157375_10178852
899 Ga0157375_10499098
900 Ga0157375_10825513
901 Ga0163163_10001672
902 Ga0163163_10005144
903 Ga0163163_10048037
904 Ga0163163_10089838
905 Ga0163163_10186844
906 Ga0157380_10000563
907 Ga0157380_10029653
908 Ga0157380_10029992
909 Ga0157380_10031155
910 Ga0157380_10044927
911 Ga0157379_10032806
912 Ga0157376_10100108
913 Ga0157376_10309337
914 Ga0157376_10890931
915 Ga0163161_10107006
916 Ga0213873_10028686
917 Ga0213876_10000022
918 Ga0213876_10000599
919 Ga0213875_10000057
920 Ga0213875_10005449
921 Ga0207672_1000396
922 Ga0207656_10022615
923 Ga0207653_10000050
924 Ga0207653_10002188
925 Ga0207710_10000001
926 Ga0207710_10003601
927 Ga0207680_10066327
928 Ga0207680_10212693
929 Ga0207647_10181216
930 Ga0207685_10000020
931 Ga0207705_10221631
932 Ga0207684_10004757
933 Ga0207684_10005385
934 Ga0207684_10009216
935 Ga0207684_10865309
936 Ga0207707_10000080
937 Ga0207707_10060263
938 Ga0207695_10090348
939 Ga0207671_10003000
940 Ga0207660_10005840
941 Ga0207662_10007671
942 Ga0207662_10173067
943 Ga0207657_10204136
944 Ga0207649_10117930
945 Ga0207652_10000234
946 Ga0207652_10054537
947 Ga0207646_10002837
948 Ga0207646_10017794
949 Ga0207646_10067046
950 Ga0207646_10082497
951 Ga0207646_10310824
952 Ga0207681_10001415
953 Ga0207681_10016129
954 Ga0207681_10046254
955 Ga0207681_10085030
956 Ga0207681_10419637
957 Ga0207650_10006423
958 Ga0207659_10145137
959 Ga0207644_10000101
960 Ga0207644_10161860
961 Ga0207644_10232554
962 Ga0207690_10003301
963 Ga0207706_10204172
964 Ga0207706_10533067
965 Ga0207686_10000070
966 Ga0207686_10001788
967 Ga0207686_10003969
968 Ga0207686_10083867
969 Ga0207709_10000153
970 Ga0207709_10002166
971 Ga0207709_10216553
972 Ga0207709_10221990
973 Ga0207709_10222979
974 Ga0207670_10127483
975 Ga0207665_10000012
976 Ga0207665_10151004
977 Ga0207691_10037678
978 Ga0207711_10140146
979 Ga0207711_10212805
980 Ga0207711_10384110
981 Ga0207711_10400956
982 Ga0207711_10479511
983 Ga0207689_10005859
984 Ga0207689_10035691
985 Ga0207689_10035897
986 Ga0207689_10145311
987 Ga0207661_10591900
988 Ga0207679_10031683
989 Ga0207679_10090941
990 Ga0207667_10500018
991 Ga0207651_10010642
992 Ga0207651_10138657
993 Ga0207712_10000418
994 Ga0207712_10088648
995 Ga0207668_10001047
996 Ga0207668_10402135
997 Ga0207640_10029275
998 Ga0207640_10036150
999 Ga0207640_10043654
1000 Ga0207640_10150501
1001 Ga0207677_10502600
1002 Ga0207703_10000581
1003 Ga0207703_10094401
1004 Ga0207703_10105111
1005 Ga0207639_10299603
1006 Ga0207678_10077757
1007 Ga0207708_10021372
1008 Ga0207708_10196339
1009 Ga0207708_10209762
1010 Ga0207708_10360060
1011 Ga0207708_10521974
1012 Ga0207702_10600320
1013 Ga0207702_10797915
1014 Ga0207641_10479118
1015 Ga0207641_10784423
1016 Ga0207648_10980238
1017 Ga0207676_10068339
1018 Ga0207676_10244221
1019 Ga0207676_10309358
1020 Ga0207676_10384716
1021 Ga0207674_10000098
1022 Ga0207674_10113717
1023 Ga0207675_100003953
1024 Ga0207675_100019507
1025 Ga0207675_100052636
1026 Ga0207675_100061104
1027 Ga0207675_100210306
1028 Ga0207675_100392448
1029 Ga0207698_10267347
1030 Ga0207428_10018252
1031 Ga0268266_10025823
1032 Ga0268266_10131249
1033 Ga0268266_10431253
1034 Ga0268265_10143902
1035 Ga0268265_10153918
1036 Ga0268265_10239667
1037 Ga0268264_10017094
1038 Ga0268264_10089951
1039 Ga0268264_10287453
1040 Ga0268264_10997970
1041 Ga0307410_10449318
1042 Ga0307406_10675878
1043 Ga0307416_100425813
1044 Ga0307414_10338370
1045 Ga0307414_10838719
1046 Ga0307411_10595119
1047 Ga0373948_0002730
1048 Ga0373958_0011434
1049 Ga0373959_0011124
1050 Ga0373938_0012616
1051 Ga0373929_0023622
1052 Ga0373934_0096664
1053 Ga0373949_0004437
1054 Ga0373951_0008026
1055 Ga0373951_0030767
1056 Ga0373939_0000857
1057 Ga0373941_0014609
1058 Ga0373960_0039195
1059 Ga0373942_0002582
1060 Ga0373961_0007661
1061 Ga0373935_0016372
1062 Ga0373937_0187074
1063 Ga0373937_0206434
1064 Ga0373925_0387898
1065 Ga0395900_0417670
1066 Ga0395905_0008060
1067 Ga0436364_0952179
1068 Ga0436364_1102754
1069 Ga0436364_1200027
1070 Ga0436365_0407503
1071 Ga0436365_0807082
1072 Ga0436365_1165922
1073 Ga0436365_1438887
1074 Ga0436363_0414766
1075 Ga0436362_0537088
1076 Ga0439453_0015164
1077 Ga0439433_0056329
1078 Ga0439446_0092140
1079 Ga0439434_0039454
1080 Ga0439435_0033374
1081 Ga0439464_0029407
1082 Ga0451577_0193477
1083 Ga0453683_0030737
1084 Ga0453683_0175728
1085 Ga0451576_0086105
1086 Ga0451576_0428575
1087 Ga0466967_1044701
1088 Ga0495651_0267128
1089 Ga0495662_0084061
1090 Ga0495663_0005462
1091 Ga0495598_0000167
1092 Ga0495621_0000148
1093 Ga0495635_0057393
1094 Ga0495636_0010756
1095 Ga0495636_0165101
1096 Ga0495680_0300685
1097 Ga0496102_0004432
1098 Ga0496102_0172393
1099 Ga0496103_0135425
1100 Ga0496104_0055890
1101 Ga0496106_0090579
1102 Ga0496106_0479634
1103 Ga0496107_0283971
1104 Ga0496108_0061681
1105 Ga0496109_0051205
1106 Ga0496109_0914855
1107 Ga0496110_0011594
1108 Ga0496111_0069128
1109 Ga0496112_0030239
1110 Ga0496112_0159915
1111 Ga0496113_0103251
1112 Ga0501296_014547
1113 Ga0501036_0159991
1114 Ga0501042_0330815
1115 Ga0501075_0243063
1116 Ga0501075_0403453
1117 Ga0501077_0074754
1118 Ga0501202_009411
1119 Ga0501228_015042
1120 Ga0501230_027889
1121 Ga0501233_088170
1122 Ga0501235_013004
1123 Ga0501249_006714
1124 Ga0501081_0332385
1125 Ga0501083_0047301
1126 Ga0501268_011706
1127 Ga0501273_021552
1128 Ga0501045_0472617
1129 nmdc:mga05p37_133603_c1
1130 nmdc:mga05p37_205811_c1
1131 nmdc:mga05p37_365549_c1
1132 nmdc:mga05p37_397970_c1
1133 nmdc:mga05p37_41380_c1
1134 nmdc:mga05p37_540817_c1
1135 nmdc:mga05p37_636243_c1
1136 nmdc:mga09592_263065_c1
1137 nmdc:mga09592_518197_c1
1138 nmdc:mga09592_78315_c1
1139 nmdc:mga06r32_423158_c1
1140 nmdc:mga06r32_748019_c1
1141 nmdc:mga08y16_287890_c1
1142 nmdc:mga08y16_91298_c1
1143 nmdc:mga0n895_11878_c1
1144 nmdc:mga0n895_193631_c1
1145 nmdc:mga0n895_527182_c1
1146 nmdc:mga0n895_94069_c1
1147 nmdc:mga0n895_97_c2
1148 nmdc:mga0rr50_183096_c1
1149 nmdc:mga0rr50_20_c1
1150 nmdc:mga0rr50_45895_c1
1151 nmdc:mga0rr50_5817_c1
1152 nmdc:mga0rr50_79_c1
1153 nmdc:mga08x19_152_c1
1154 nmdc:mga08x19_178_c1
1155 nmdc:mga0a205_127896_c1
1156 nmdc:mga0a205_191868_c1
1157 nmdc:mga0a205_27245_c1
1158 nmdc:mga0a205_370123_c1
1159 nmdc:mga0a205_38657_c1
1160 nmdc:mga0a205_50248_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

56

252

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

62

273

0.93

PF08659

KR

KR domain

57

240

0.85

PF23441

50

258

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9638 1 235
3tfo-assembly1.cif.gz_C crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9598 6 234
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9595 1 235
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9566 5 233
2ehd-assembly1.cif.gz_B crystal structure analysis of oxidoreductase 0.9563 6 234
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9793 6 51 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9723 3 82 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9638 1 235 3.40.50.720
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9596 63 179 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9595 1 235 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3B9LPY5-F1-model_v4 Short-chain dehydrogenase 0.9852 1 239 GO:0016020
GO:0016491
AF-A0A7W0XCT9-F1-model_v4 SDR family oxidoreductase 0.9827 1 239 GO:0016020
GO:0016491
AF-A0A4Q3Q7C0-F1-model_v4 deleted 0.9806 2 186
AF-A0A518H4K7-F1-model_v4 Oxidoreductase SadH (EC 1.-.-.-) 0.9798 1 192 GO:0016020
GO:0016491
AF-A0A1F8Q545-F1-model_v4 Short-chain dehydrogenase 0.9788 4 185 GO:0016491

Map