F465933

General Info

Members Datasets Scaffolds Average Seq Length
580 327 1160 147

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10335537|Ga0105244_103355371
Length 159
Sequence MYISTPGRLPMTTVMSPLAGRAIGLAAVPDPVFSGAMVGPGTAIDPVREPSEAVAPVDGVIVSLHPHAFVVVDSEGHGVLTHLGIDTVQLNGEGFEVLVNKGDTVTRGQSIVRWNPDAVEKAGKSPVCPVVALEATADSLRELREDGDVKSGDVLFSWQ

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
27 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
28 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
29 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
30 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
31 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
32 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
34 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
35 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
40 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
42 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
43 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
44 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
45 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
46 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
47 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
48 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
49 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
50 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
51 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
52 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
53 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
54 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
60 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
61 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
62 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
63 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
64 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
65 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
66 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
67 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
68 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
69 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
70 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
71 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
72 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
73 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
74 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
75 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
76 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
77 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
78 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
101 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
102 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
139 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
146 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
166 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
174 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
175 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
213 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
214 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
215 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
216 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
217 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
218 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
219 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
220 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
221 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
222 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
223 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
224 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
225 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
226 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
227 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
230 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
231 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
237 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
238 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
239 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
240 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
241 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
242 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
243 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
244 2643221548 Streptomyces sp. Root55 Isolate Unclassified
245 2643221578 Streptomyces sp. Root63 Isolate Unclassified
246 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
247 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
248 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
249 2643221647 Streptomyces sp. Root369 Isolate Unclassified
250 2643221670 Streptomyces sp. Root431 Isolate Unclassified
251 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
252 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
253 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
254 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
255 2643221714 Streptomyces sp. Root264 Isolate Unclassified
256 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
257 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
258 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
259 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
260 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
261 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
262 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
263 2808606448 Streptomyces sp. 193411 Isolate Unclassified
264 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
265 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
266 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
267 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
268 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
269 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
270 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
271 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
272 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
273 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
274 2862574272 Streptomyces sp. AcE210 Isolate Nodule
275 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
276 2867369537 Streptomyces sp. Z26 Isolate Unclassified
277 2867428634 Streptomyces sp. RP5T Isolate Unclassified
278 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
279 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
280 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
281 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
282 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
283 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
284 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
285 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
286 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
287 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
288 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
289 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
290 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
291 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
292 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
293 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
294 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
295 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
296 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
297 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
298 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
299 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
300 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
301 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
302 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
303 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
304 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
305 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
306 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
307 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
308 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
309 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
310 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
311 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
312 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
313 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
314 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
315 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
316 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
317 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
318 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
319 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
320 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
321 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
322 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
323 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
324 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
325 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
326 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
327 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.59
Metatranscriptomes 1.38
Isolates 16.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.9
Nodule 0.34
Rhizoplane 1.21
Rhizosphere 78.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10335537 3300009036 Bacteria 697
2 JGI24737J22298_10019328 3300001990 Bacteria 2179
3 JGI24735J21928_10105224 3300002067 Bacteria 811
4 rootH1_10019087 3300003316 Bacteria 1027
5 rootH2_10022202 3300003320 Bacteria 2472
6 rootH1_10001145 3300003323 Bacteria 1410
7 rootH1_10061145 3300003323 Bacteria 5223
8 JGI25160J50197_1033845 3300003354 Bacteria 1278
9 JGI25160J50197_1035017 3300003354 Bacteria 1238
10 JGI25160J50197_1064574 3300003354 Bacteria 718
11 Ga0070685_10384860 3300005466 Bacteria 967
12 Ga0070706_101334575 3300005467 Bacteria 657
13 Ga0070698_100098074 3300005471 Bacteria 2905
14 Ga0070699_100094902 3300005518 Bacteria 2611
15 Ga0068853_100698446 3300005539 Bacteria 967
16 Ga0070665_100226419 3300005548 Bacteria 1870
17 Ga0068854_101305160 3300005578 Bacteria 653
18 Ga0068856_100309128 3300005614 Bacteria 1598
19 Ga0081455_10431480 3300005937 Bacteria 906
20 Ga0075368_10025764 3300006042 Bacteria 2257
21 Ga0075363_100151456 3300006048 Bacteria 1309
22 Ga0075363_100736817 3300006048 Bacteria 597
23 Ga0075370_10372666 3300006353 Bacteria 855
24 Ga0105251_10038988 3300009011 Bacteria 2323
25 Ga0105245_11273438 3300009098 Bacteria 784
26 Ga0105239_10434823 3300010375 Bacteria 1487
27 Ga0105239_10912035 3300010375 Bacteria 1009
28 Ga0157369_10768243 3300013105 Bacteria 991
29 Ga0157378_11491644 3300013297 Bacteria 721
30 Ga0157372_10554441 3300013307 Bacteria 1340
31 Ga0182008_10003812 3300014497 Bacteria 8961
32 Ga0157376_11842975 3300014969 Bacteria 641
33 Ga0182006_1113317 3300015261 Bacteria 949
34 Ga0182007_10000589 3300015262 Bacteria 21312
35 Ga0182005_1074168 3300015265 Bacteria 936
36 Ga0183367_1017 3300015688 Bacteria 126691
37 Ga0224712_10133382 3300022467 Bacteria 1086
38 Ga0209758_1006643 3300025297 Bacteria 8185
39 Ga0207426_1023646 3300025302 Bacteria 2095
40 Ga0207426_1033835 3300025302 Bacteria 1644
41 Ga0207713_1031520 3300025735 Bacteria 2341
42 Ga0207640_10724938 3300025981 Bacteria 855
43 Ga0207639_10624985 3300026041 Bacteria 995
44 Ga0207702_10155065 3300026078 Bacteria 2087
45 Ga0209813_10011215 3300027866 Bacteria 2338
46 Ga0268266_10201174 3300028379 Bacteria 1823
47 Ga0307517_10014692 3300028786 Bacteria 10487
48 Ga0307515_10001750 3300028794 Bacteria 48343
49 Ga0268256_1043259 3300030500 Bacteria 995
50 Ga0307511_10001518 3300030521 Bacteria 24541
51 Ga0307512_10007510 3300030522 Bacteria 10792
52 Ga0307513_10016324 3300031456 Bacteria 8963
53 Ga0307513_10132987 3300031456 Bacteria 2429
54 Ga0307509_10021531 3300031507 Bacteria 7284
55 Ga0307509_10445207 3300031507 Bacteria 990
56 Ga0307509_10465424 3300031507 Bacteria 955
57 Ga0307508_10020993 3300031616 Bacteria 5935
58 Ga0307508_10111339 3300031616 Bacteria 2337
59 Ga0307508_10188038 3300031616 Bacteria 1666
60 Ga0307508_10494021 3300031616 Bacteria 818
61 Ga0307514_10130255 3300031649 Bacteria 1733
62 Ga0307514_10183921 3300031649 Bacteria 1342
63 Ga0307514_10307221 3300031649 Bacteria 883
64 Ga0307516_10003631 3300031730 Bacteria 19617
65 Ga0307516_10058774 3300031730 Bacteria 3741
66 Ga0307516_10347582 3300031730 Bacteria 1149
67 Ga0307516_10415725 3300031730 Bacteria 1003
68 Ga0307518_10379114 3300031838 Bacteria 803
69 Ga0307507_10177065 3300033179 Bacteria 1534
70 Ga0307510_10224480 3300033180 Bacteria 1386
71 Ga0307510_10285448 3300033180 Bacteria 1119
72 Ga0307510_10292951 3300033180 Bacteria 1092
73 Ga0395899_0835837 3300037312 Bacteria 566
74 Ga0395900_0193747 3300037418 Bacteria 2060
75 Ga0395900_0911875 3300037418 Bacteria 802
76 Ga0395898_0006327 3300037466 Bacteria 12651
77 Ga0395898_0025127 3300037466 Bacteria 6006
78 Ga0395898_0599307 3300037466 Bacteria 1044
79 Ga0395905_0474261 3300037471 Bacteria 1150
80 Ga0395901_0250262 3300038443 Bacteria 1846
81 Ga0395901_0952285 3300038443 Bacteria 837
82 Ga0439436_0006065 3300041404 Bacteria 3706
83 Ga0439436_0011993 3300041404 Bacteria 2631
84 Ga0439439_0063285 3300041406 Bacteria 984
85 Ga0439439_0103032 3300041406 Bacteria 786
86 Ga0451800_1490878 3300041459 Bacteria 963
87 Ga0451802_1670684 3300041460 Bacteria 1078
88 Ga0451841_0072486 3300041498 Bacteria 1098
89 Ga0451849_0389586 3300041505 Bacteria 682
90 Ga0451843_0412225 3300041509 Bacteria 1079
91 Ga0451853_0823836 3300041512 Bacteria 1606
92 Ga0451853_0979725 3300041512 Bacteria 1625
93 Ga0451853_1127343 3300041512 Bacteria 1676
94 Ga0451853_1456412 3300041512 Bacteria 1869
95 Ga0439433_0005228 3300041999 Bacteria 2788
96 Ga0439433_0125079 3300041999 Bacteria 650
97 Ga0439448_0029030 3300042005 Bacteria 1749
98 Ga0439449_0010902 3300042007 Bacteria 3429
99 Ga0439449_0022524 3300042007 Bacteria 2359
100 Ga0439449_0351485 3300042007 Bacteria 558
101 Ga0439454_009102 3300042011 Bacteria 1284
102 Ga0439455_0009322 3300042012 Bacteria 2126
103 Ga0439457_001029 3300042014 Bacteria 8414
104 Ga0439457_007870 3300042014 Bacteria 2537
105 Ga0439462_0013666 3300042015 Bacteria 2082
106 Ga0450903_000849 3300042138 Bacteria 5935
107 Ga0439458_0005581 3300042157 Bacteria 2827
108 Ga0439458_0053204 3300042157 Bacteria 1001
109 Ga0450901_029484 3300042533 Bacteria 603
110 Ga0466969_0032120 3300044656 Bacteria 2669
111 Ga0466972_0014725 3300044658 Bacteria 3913
112 Ga0466972_0185142 3300044658 Bacteria 976
113 Ga0466965_0273835 3300044683 Bacteria 910
114 Ga0466965_0286712 3300044683 Bacteria 890
115 Ga0466966_0027584 3300044684 Bacteria 3702
116 Ga0466966_0236094 3300044684 Bacteria 1102
117 Ga0466966_0236943 3300044684 Bacteria 1100
118 Ga0466961_0004936 3300044693 Bacteria 8385
119 Ga0466961_0222452 3300044693 Bacteria 1163
120 Ga0466963_0002522 3300044694 Bacteria 10252
121 Ga0466963_0005806 3300044694 Bacteria 7262
122 Ga0466964_0026468 3300044706 Bacteria 2270
123 Ga0466964_0286669 3300044706 Bacteria 825
124 Ga0466971_0211839 3300044719 Bacteria 916
125 Ga0466971_0417522 3300044719 Bacteria 655
126 Ga0466970_0003215 3300044765 Bacteria 7938
127 Ga0466970_0004312 3300044765 Bacteria 6996
128 Ga0466970_0115766 3300044765 Bacteria 1466
129 Ga0466970_0629689 3300044765 Bacteria 623
130 Ga0466957_0004830 3300044842 Bacteria 7541
131 Ga0466960_0098540 3300044901 Bacteria 1501
132 Ga0466959_0005110 3300045049 Bacteria 8930
133 Ga0466959_0105360 3300045049 Bacteria 2016
134 Ga0466958_0003164 3300045836 Bacteria 8476
135 Ga0466958_0265300 3300045836 Bacteria 1099
136 Ga0466958_0588620 3300045836 Bacteria 723
137 Ga0466967_0006426 3300045976 Bacteria 8313
138 Ga0466967_0044884 3300045976 Bacteria 3837
139 Ga0466967_0476145 3300045976 Bacteria 1223
140 Ga0495627_116680 3300046453 Bacteria 755
141 Ga0495592_0009218 3300046454 Bacteria 7424
142 Ga0495592_0023370 3300046454 Bacteria 4700
143 Ga0495603_0047254 3300046455 Bacteria 2564
144 Ga0495603_0054449 3300046455 Bacteria 2371
145 Ga0495603_0081529 3300046455 Bacteria 1895
146 Ga0495603_0310578 3300046455 Bacteria 905
147 Ga0495629_0030214 3300046459 Bacteria 3842
148 Ga0495629_0051479 3300046459 Bacteria 2882
149 Ga0495629_0057811 3300046459 Bacteria 2711
150 Ga0495629_0348752 3300046459 Bacteria 1010
151 Ga0495629_0440217 3300046459 Bacteria 883
152 Ga0495638_0133054 3300046460 Bacteria 1459
153 Ga0495638_0349936 3300046460 Bacteria 781
154 Ga0495651_0067037 3300046462 Bacteria 2738
155 Ga0495651_0079729 3300046462 Bacteria 2474
156 Ga0495653_0035872 3300046463 Bacteria 3910
157 Ga0495653_0098422 3300046463 Bacteria 2124
158 Ga0495580_0652552 3300046472 Bacteria 692
159 Ga0495582_0227578 3300046473 Bacteria 1067
160 Ga0495582_0356678 3300046473 Bacteria 842
161 Ga0495605_0021977 3300046474 Bacteria 3373
162 Ga0495605_0099570 3300046474 Bacteria 1338
163 Ga0495662_0002095 3300046476 Bacteria 9997
164 Ga0495662_0020224 3300046476 Bacteria 3219
165 Ga0495662_0026399 3300046476 Bacteria 2804
166 Ga0495662_0057375 3300046476 Bacteria 1880
167 Ga0495662_0274192 3300046476 Bacteria 830
168 Ga0495664_0070796 3300046477 Bacteria 2082
169 Ga0495664_0371693 3300046477 Bacteria 860
170 Ga0495664_0472996 3300046477 Bacteria 749
171 Ga0495585_0023385 3300046492 Bacteria 3546
172 Ga0495585_0125602 3300046492 Bacteria 1354
173 Ga0495585_0292535 3300046492 Bacteria 802
174 Ga0495594_0008747 3300046499 Bacteria 5219
175 Ga0495594_0014479 3300046499 Bacteria 4134
176 Ga0495594_0054825 3300046499 Bacteria 2197
177 Ga0495594_0091330 3300046499 Bacteria 1706
178 Ga0495594_0171539 3300046499 Bacteria 1234
179 Ga0495594_0351495 3300046499 Bacteria 839
180 Ga0495596_0049892 3300046500 Bacteria 1640
181 Ga0495607_0029485 3300046501 Bacteria 3376
182 Ga0495607_0121545 3300046501 Bacteria 1370
183 Ga0495583_0050219 3300046506 Bacteria 1906
184 Ga0495606_0004400 3300046507 Bacteria 14101
185 Ga0495608_0064632 3300046511 Bacteria 2398
186 Ga0495610_0153840 3300046512 Bacteria 978
187 Ga0495616_0020022 3300046513 Bacteria 3646
188 Ga0495620_0005734 3300046515 Bacteria 6904
189 Ga0495628_0050035 3300046516 Bacteria 3306
190 Ga0495628_0079575 3300046516 Bacteria 2548
191 Ga0495630_0004077 3300046517 Bacteria 10232
192 Ga0495630_0389401 3300046517 Bacteria 1067
193 Ga0495630_0522452 3300046517 Bacteria 910
194 Ga0495630_0527866 3300046517 Bacteria 905
195 Ga0495630_1218385 3300046517 Bacteria 569
196 Ga0495631_0023972 3300046518 Bacteria 2822
197 Ga0495631_0040994 3300046518 Bacteria 2050
198 Ga0495631_0374512 3300046518 Bacteria 606
199 Ga0495632_0062921 3300046519 Bacteria 1798
200 Ga0495637_0183822 3300046520 Bacteria 774
201 Ga0495643_0037953 3300046522 Bacteria 2640
202 Ga0495648_0058127 3300046524 Bacteria 2314
203 Ga0495666_0022643 3300046526 Bacteria 3111
204 Ga0495666_0023497 3300046526 Bacteria 3048
205 Ga0495666_0070190 3300046526 Bacteria 1666
206 Ga0495652_0044038 3300046529 Bacteria 3844
207 Ga0495654_0059472 3300046530 Bacteria 1840
208 Ga0495665_0033527 3300046531 Bacteria 2746
209 Ga0495640_0006243 3300046533 Bacteria 9434
210 Ga0495640_0019075 3300046533 Bacteria 5070
211 Ga0495640_0049751 3300046533 Bacteria 2888
212 Ga0495640_0097207 3300046533 Bacteria 1936
213 Ga0495586_0081500 3300046535 Bacteria 1778
214 Ga0495587_0021413 3300046536 Bacteria 3986
215 Ga0495609_0066338 3300046538 Bacteria 1590
216 Ga0495609_0160952 3300046538 Bacteria 951
217 Ga0495597_0020713 3300046542 Bacteria 3060
218 Ga0495597_0190531 3300046542 Bacteria 825
219 Ga0495645_0034939 3300046543 Bacteria 3664
220 Ga0495645_0237930 3300046543 Bacteria 1216
221 Ga0495622_0019114 3300046557 Bacteria 3190
222 Ga0495633_0026590 3300046558 Bacteria 2838
223 Ga0495667_0284999 3300046559 Bacteria 1048
224 Ga0495667_0423487 3300046559 Bacteria 838
225 Ga0495668_0009205 3300046616 Bacteria 6076
226 Ga0495668_0158439 3300046616 Bacteria 1240
227 Ga0495634_0020737 3300046642 Bacteria 4656
228 Ga0495634_0096209 3300046642 Bacteria 1917
229 Ga0495634_0257113 3300046642 Bacteria 1066
230 Ga0495611_0156727 3300046648 Bacteria 1063
231 Ga0495625_0059122 3300046660 Bacteria 2720
232 Ga0495625_0736178 3300046660 Bacteria 579
233 Ga0495635_0075927 3300046663 Bacteria 2302
234 Ga0495635_0974555 3300046663 Bacteria 540
235 Ga0495661_0045944 3300046665 Bacteria 2668
236 Ga0495661_0139676 3300046665 Bacteria 1319
237 Ga0495588_0006043 3300046674 Bacteria 5432
238 Ga0495588_0006782 3300046674 Bacteria 5180
239 Ga0495588_0015839 3300046674 Bacteria 3636
240 Ga0495588_0125519 3300046674 Bacteria 1353
241 Ga0495588_0673634 3300046674 Bacteria 541
242 Ga0495657_0004665 3300046675 Bacteria 10931
243 Ga0495657_0010291 3300046675 Bacteria 7043
244 Ga0495657_0020501 3300046675 Bacteria 4751
245 Ga0495657_0037058 3300046675 Bacteria 3364
246 Ga0495623_0022746 3300046679 Bacteria 4047
247 Ga0495623_0066410 3300046679 Bacteria 2253
248 Ga0495646_0552891 3300046680 Bacteria 587
249 Ga0495613_0001798 3300046689 Bacteria 16307
250 Ga0495613_0012549 3300046689 Bacteria 6297
251 Ga0495613_0013478 3300046689 Bacteria 6071
252 Ga0495613_0015440 3300046689 Bacteria 5678
253 Ga0495613_0018159 3300046689 Bacteria 5242
254 Ga0495613_0019906 3300046689 Bacteria 5001
255 Ga0495613_0064046 3300046689 Bacteria 2689
256 Ga0495613_0415937 3300046689 Bacteria 915
257 Ga0495613_0744950 3300046689 Bacteria 642
258 Ga0495624_0039081 3300046690 Bacteria 3044
259 Ga0495624_0226677 3300046690 Bacteria 1132
260 Ga0495624_0291074 3300046690 Bacteria 985
261 Ga0495670_0008165 3300046691 Bacteria 5147
262 Ga0495670_0027981 3300046691 Bacteria 2794
263 Ga0495670_0247499 3300046691 Bacteria 950
264 Ga0495671_0130215 3300046692 Bacteria 1227
265 Ga0495671_0156660 3300046692 Bacteria 1108
266 Ga0495649_0195462 3300046694 Bacteria 1052
267 Ga0495649_0299793 3300046694 Bacteria 818
268 Ga0495589_0031247 3300046794 Bacteria 2680
269 Ga0495589_0125275 3300046794 Bacteria 1235
270 Ga0495589_0193551 3300046794 Bacteria 961
271 Ga0495589_0393626 3300046794 Bacteria 636
272 Ga0495600_0062616 3300046809 Bacteria 2430
273 Ga0495600_0259003 3300046809 Bacteria 1105
274 Ga0495660_0087570 3300046810 Bacteria 1623
275 Ga0495581_0041857 3300047315 Bacteria 2651
276 Ga0495581_0070715 3300047315 Bacteria 2019
277 Ga0495581_0182328 3300047315 Bacteria 1228
278 Ga0495581_0403685 3300047315 Bacteria 797
279 Ga0495604_0013579 3300047317 Bacteria 6496
280 Ga0495604_0014995 3300047317 Bacteria 6182
281 Ga0495604_0015806 3300047317 Bacteria 6023
282 Ga0495604_0066600 3300047317 Bacteria 2738
283 Ga0495604_0071256 3300047317 Bacteria 2629
284 Ga0495636_0004579 3300047318 Bacteria 5417
285 Ga0495636_0016102 3300047318 Bacteria 2983
286 Ga0495636_0064052 3300047318 Bacteria 1559
287 Ga0495636_0066334 3300047318 Bacteria 1534
288 Ga0495636_0081077 3300047318 Bacteria 1397
289 Ga0495636_0117639 3300047318 Bacteria 1173
290 Ga0495636_0138977 3300047318 Bacteria 1084
291 Ga0495636_0141620 3300047318 Bacteria 1074
292 Ga0495674_0060697 3300047319 Bacteria 3298
293 Ga0495674_0213158 3300047319 Bacteria 1599
294 Ga0495676_0001343 3300047321 Bacteria 21124
295 Ga0495676_0004519 3300047321 Bacteria 12726
296 Ga0495676_0067795 3300047321 Bacteria 2760
297 Ga0495676_0069483 3300047321 Bacteria 2717
298 Ga0495676_0334290 3300047321 Bacteria 1015
299 Ga0495676_0413483 3300047321 Bacteria 893
300 Ga0495683_0049537 3300047323 Bacteria 2103
301 Ga0495683_0071053 3300047323 Bacteria 1708
302 Ga0495683_0213773 3300047323 Bacteria 863
303 Ga0495687_001425 3300047443 Bacteria 22029
304 Ga0495687_009175 3300047443 Bacteria 5564
305 Ga0495687_052775 3300047443 Bacteria 1716
306 Ga0495687_056375 3300047443 Bacteria 1639
307 Ga0495687_161584 3300047443 Bacteria 752
308 Ga0495687_181096 3300047443 Bacteria 687
309 Ga0495675_0011908 3300047444 Bacteria 5465
310 Ga0495675_0061483 3300047444 Bacteria 2379
311 Ga0495675_0096044 3300047444 Bacteria 1858
312 Ga0495675_0100518 3300047444 Bacteria 1810
313 Ga0495675_0290657 3300047444 Bacteria 973
314 Ga0495675_0394545 3300047444 Bacteria 807
315 Ga0495685_009617 3300047447 Bacteria 3234
316 Ga0495685_014514 3300047447 Bacteria 2677
317 Ga0495685_014841 3300047447 Bacteria 2651
318 Ga0495685_015741 3300047447 Bacteria 2582
319 Ga0495685_022882 3300047447 Bacteria 2150
320 Ga0495685_089869 3300047447 Bacteria 1018
321 Ga0495685_101595 3300047447 Bacteria 949
322 Ga0495681_0001741 3300047470 Bacteria 16101
323 Ga0495681_0039948 3300047470 Bacteria 2287
324 Ga0495681_0145858 3300047470 Bacteria 996
325 Ga0495684_0051639 3300047471 Bacteria 3137
326 Ga0495686_0084564 3300047472 Bacteria 1933
327 Ga0495686_0134110 3300047472 Bacteria 1466
328 Ga0495686_0356694 3300047472 Bacteria 793
329 Ga0495593_0014543 3300047673 Bacteria 4473
330 Ga0495593_0022038 3300047673 Bacteria 3554
331 Ga0495593_0141943 3300047673 Bacteria 1216
332 Ga0495593_0242952 3300047673 Bacteria 902
333 Ga0495602_0076034 3300048088 Bacteria 2847
334 Ga0495614_0002397 3300048089 Bacteria 8330
335 Ga0495614_0021891 3300048089 Bacteria 2759
336 Ga0495614_0061700 3300048089 Bacteria 1611
337 Ga0495614_0171868 3300048089 Bacteria 972
338 Ga0495626_0024106 3300048091 Bacteria 2985
339 Ga0496102_1244036 3300048905 Bacteria 664
340 Ga0496106_0025566 3300048909 Bacteria 4395
341 Ga0496110_0546601 3300048913 Bacteria 1053
342 Ga0496113_0295312 3300048916 Bacteria 1297
343 Ga0496126_0132753 3300048929 Bacteria 2150
344 Ga0501306_032244 3300049127 Bacteria 784
345 Ga0495678_110768 3300049459 Bacteria 936
346 Ga0495682_0039222 3300049460 Bacteria 1739
347 Ga0501318_005455 3300049534 Bacteria 1262
348 Ga0501323_003231 3300049539 Bacteria 1653
349 Ga0501323_011969 3300049539 Bacteria 1054
350 Ga0501324_017100 3300049540 Bacteria 716
351 Ga0501031_0138804 3300049568 Bacteria 1588
352 Ga0501031_0159352 3300049568 Bacteria 1475
353 Ga0501032_0015234 3300049569 Bacteria 5428
354 Ga0501032_0204819 3300049569 Bacteria 1287
355 Ga0501032_0302660 3300049569 Bacteria 1033
356 Ga0501032_0639958 3300049569 Bacteria 675
357 Ga0501033_0012501 3300049570 Bacteria 6478
358 Ga0501033_0073098 3300049570 Bacteria 2517
359 Ga0501033_0323268 3300049570 Bacteria 1083
360 Ga0501033_0342800 3300049570 Bacteria 1047
361 Ga0501033_0792157 3300049570 Bacteria 641
362 Ga0501034_0123825 3300049571 Bacteria 2571
363 Ga0501034_0257988 3300049571 Bacteria 1686
364 Ga0501034_0344679 3300049571 Bacteria 1419
365 Ga0501034_0374961 3300049571 Bacteria 1348
366 Ga0501034_0852004 3300049571 Bacteria 801
367 Ga0501034_0868377 3300049571 Bacteria 791
368 Ga0501034_1239155 3300049571 Bacteria 624
369 Ga0501036_0007816 3300049572 Bacteria 8746
370 Ga0501036_0036723 3300049572 Bacteria 4147
371 Ga0501036_0114810 3300049572 Bacteria 2275
372 Ga0501036_0161555 3300049572 Bacteria 1888
373 Ga0501036_0372179 3300049572 Bacteria 1192
374 Ga0501036_0496549 3300049572 Bacteria 1015
375 Ga0501036_0569724 3300049572 Bacteria 940
376 Ga0501037_0001764 3300049573 Bacteria 15705
377 Ga0501037_0019702 3300049573 Bacteria 4976
378 Ga0501037_0078699 3300049573 Bacteria 2392
379 Ga0501037_0411334 3300049573 Bacteria 927
380 Ga0501037_0502702 3300049573 Bacteria 822
381 Ga0501037_0644383 3300049573 Bacteria 708
382 Ga0501037_0752976 3300049573 Bacteria 645
383 Ga0501038_0139740 3300049574 Bacteria 1982
384 Ga0501038_0289987 3300049574 Bacteria 1286
385 Ga0501038_0726641 3300049574 Bacteria 742
386 Ga0501038_1083526 3300049574 Bacteria 585
387 Ga0501039_0086481 3300049575 Bacteria 2441
388 Ga0501039_0249507 3300049575 Bacteria 1395
389 Ga0501039_0369106 3300049575 Bacteria 1127
390 Ga0501040_0641449 3300049576 Bacteria 767
391 Ga0501041_0000939 3300049577 Bacteria 15803
392 Ga0501042_0340971 3300049578 Bacteria 1083
393 Ga0501042_0735829 3300049578 Bacteria 717
394 Ga0501043_0000673 3300049579 Bacteria 30061
395 Ga0501043_0001814 3300049579 Bacteria 18371
396 Ga0501043_0087521 3300049579 Bacteria 2448
397 Ga0501043_0121542 3300049579 Bacteria 2048
398 Ga0501043_0310563 3300049579 Bacteria 1203
399 Ga0501043_0752162 3300049579 Bacteria 708
400 Ga0501047_0000103 3300049581 Bacteria 104053
401 Ga0501047_0001475 3300049581 Bacteria 22933
402 Ga0501047_0038200 3300049581 Bacteria 4644
403 Ga0501047_0123393 3300049581 Bacteria 2470
404 Ga0501047_0172621 3300049581 Bacteria 2030
405 Ga0501047_0176613 3300049581 Bacteria 2003
406 Ga0501047_0196388 3300049581 Bacteria 1880
407 Ga0501048_0397859 3300049582 Bacteria 984
408 Ga0501067_0017334 3300049583 Bacteria 3980
409 Ga0501068_0020964 3300049584 Bacteria 3813
410 Ga0501068_0200915 3300049584 Bacteria 1264
411 Ga0501068_0434520 3300049584 Bacteria 848
412 Ga0501069_0301207 3300049585 Bacteria 940
413 Ga0501070_0006796 3300049586 Bacteria 9734
414 Ga0501070_0018219 3300049586 Bacteria 5890
415 Ga0501070_1050374 3300049586 Bacteria 630
416 Ga0501071_0075374 3300049587 Bacteria 2462
417 Ga0501071_0710699 3300049587 Bacteria 774
418 Ga0501072_0013204 3300049588 Bacteria 6324
419 Ga0501073_0463938 3300049589 Bacteria 875
420 Ga0501073_0521685 3300049589 Bacteria 821
421 Ga0501074_0004273 3300049590 Bacteria 10196
422 Ga0501074_0080868 3300049590 Bacteria 2331
423 Ga0501079_0084483 3300049741 Bacteria 2455
424 Ga0501079_0748172 3300049741 Bacteria 769
425 Ga0501080_0547760 3300049742 Bacteria 1030
426 Ga0501083_0013620 3300049744 Bacteria 5684
427 Ga0501035_0000511 3300049822 Bacteria 43547
428 Ga0501035_0012965 3300049822 Bacteria 7693
429 Ga0501035_0027013 3300049822 Bacteria 5249
430 Ga0501035_0045231 3300049822 Bacteria 3960
431 Ga0501035_0066536 3300049822 Bacteria 3198
432 Ga0501035_0124842 3300049822 Bacteria 2247
433 Ga0501035_0151731 3300049822 Bacteria 2010
434 Ga0501035_0173199 3300049822 Bacteria 1863
435 Ga0501035_0179214 3300049822 Bacteria 1826
436 Ga0501035_0500173 3300049822 Bacteria 1000
437 Ga0501035_0597075 3300049822 Bacteria 900
438 Ga0501035_1023916 3300049822 Bacteria 648
439 Ga0501044_0001298 3300049823 Bacteria 29533
440 Ga0501044_0011560 3300049823 Bacteria 9566
441 Ga0501044_0014460 3300049823 Bacteria 8519
442 Ga0501044_0034925 3300049823 Bacteria 5268
443 Ga0501044_0087748 3300049823 Bacteria 3141
444 Ga0501044_0138075 3300049823 Bacteria 2427
445 Ga0501044_0289306 3300049823 Bacteria 1570
446 Ga0501044_0305880 3300049823 Bacteria 1517
447 Ga0501044_0514703 3300049823 Bacteria 1097
448 Ga0501044_0726148 3300049823 Bacteria 877
449 Ga0501044_1010628 3300049823 Bacteria 703
450 Ga0501045_0568459 3300049824 Bacteria 840
451 nmdc:mga03n38_129835_c1 3300050490 Bacteria 1248
452 nmdc:mga03n38_587506_c1 3300050490 Bacteria 633
453 nmdc:mga06z11_791449_c1 3300050494 Bacteria 578
454 nmdc:mga04h51_17996_c1 3300050495 Bacteria 2075
455 Ga0495601_0062884 3300053077 Bacteria 2358
456 Ga0500610_0172092 3300053079 Bacteria 1068
457 Ga0495619_0045360 3300053085 Bacteria 2888
458 Ga0495619_0053348 3300053085 Bacteria 2674
459 Ga0500578_0028288 3300053086 Bacteria 3601
460 Ga0500647_0114955 3300053091 Bacteria 1277
461 Ga0500651_0190893 3300053093 Bacteria 1213
462 Ga0500654_187482 3300053099 Bacteria 647
463 Ga0500660_089777 3300053100 Bacteria 1377
464 Ga0500556_0068674 3300053104 Bacteria 1320
465 Ga0500560_008650 3300053107 Bacteria 2462
466 Ga0500560_085403 3300053107 Bacteria 1051
467 Ga0500614_122143 3300053123 Bacteria 767
468 Ga0500621_161026 3300053126 Bacteria 832
469 Ga0500628_002519 3300053129 Bacteria 3022
470 Ga0500652_104593 3300053131 Bacteria 1183
471 Ga0500658_0012991 3300053134 Bacteria 3075
472 Ga0500561_0006086 3300053137 Bacteria 2281
473 Ga0500573_0045295 3300053140 Bacteria 2536
474 Ga0500588_0011216 3300053146 Bacteria 2188
475 Ga0500600_0038537 3300053149 Bacteria 2766
476 Ga0500600_0085134 3300053149 Bacteria 1700
477 Ga0500600_0139716 3300053149 Bacteria 1221
478 Ga0500616_0070710 3300053153 Bacteria 1780
479 Ga0500633_0011907 3300053160 Bacteria 2383
480 Ga0500634_0069886 3300053161 Bacteria 1839
481 Ga0500634_0160721 3300053161 Bacteria 1037
482 Ga0500587_000721 3300053739 Bacteria 4243
483 Ga0501084_0343590 3300054114 Bacteria 1260
484 Ga0587106_100801 3300059605 Bacteria 589
485 Ga0587122_042903 3300059628 Bacteria 567
486 Ga0501082_0002273 3300060353 Bacteria 16836
487 Ga0466962_0002779 3300061719 Bacteria 8316
488 2547406402 2547132111 Bacteria 8013147
489 2554259651 2554235005 Bacteria 6457341
490 2585300895 2582581312 Bacteria 7308206
491 2585303405 2582581313 Bacteria 10042643
492 2585316877 2582581314 Bacteria 11452267
493 2616695483 2616644814 Bacteria 11555299
494 2616906213 2616644941 Bacteria 8510691
495 2643760335 2643221548 Bacteria 8053412
496 2643904387 2643221578 Bacteria 9213798
497 2643946695 2643221587 Bacteria 7586415
498 2644015675 2643221601 Bacteria 7493239
499 2644177404 2643221631 Bacteria 8168043
500 2644267898 2643221647 Bacteria 10741251
501 2644388963 2643221670 Bacteria 6497041
502 2644406346 2643221673 Bacteria 9196637
503 2644434499 2643221677 Bacteria 7584031
504 2644443573 2643221678 Bacteria 9540101
505 2644459968 2643221682 Bacteria 6743283
506 2644632491 2643221714 Bacteria 9015452
507 2784586640 2784132148 Bacteria 8627943
508 2785345858 2784746763 Bacteria 9783172
509 2785367032 2784746768 Bacteria 10036182
510 2786668069 2786546132 Bacteria 10419719
511 2804843621 2802429296 Bacteria 7227771
512 2808847535 2808606359 Bacteria 9866990
513 2808918267 2808606375 Bacteria 9466072
514 2809230167 2808606448 Bacteria 8656184
515 2811846857 2808606982 Bacteria 7791042
516 2812360434 2811994879 Bacteria 9313447
517 2812482527 2811994917 Bacteria 7761064
518 2819699842 2818991463 Bacteria 7948711
519 2819744000 2818991472 Bacteria 10089953
520 2852637588 2852635781 Bacteria 8251373
521 2862186374 2862178590 Bacteria 8583590
522 2862289782 2862281513 Bacteria 9621493
523 2862291967 2862290372 Bacteria 7471434
524 2862510316 2862507626 Bacteria 9425308
525 2862516480 2862507626 Bacteria 9425308
526 2862583847 2862574272 Bacteria 10567477
527 2863407089 2863404153 Bacteria 9672205
528 2867375218 2867369537 Bacteria 6501581
529 2867434664 2867428634 Bacteria 9590268
530 2875392593 2875391855 Bacteria 7600475
531 2877683512 2877676314 Bacteria 9512378
532 2912722622 2912715099 Bacteria 9460473
533 2912726304 2912723979 Bacteria 8557534
534 2912758733 2912757875 Bacteria 7940295
535 2918502402 2918501144 Bacteria 8668083
536 2919472310 2919468124 Bacteria 9133025
537 2935393723 2935390628 Bacteria 7043367
538 2946052124 2946045630 Bacteria 8527308
539 2946065455 2946064051 Bacteria 8957905
540 2946073818 2946072368 Bacteria 8999607
541 2947231952 2947224130 Bacteria 9938529
542 2954011195 2954002825 Bacteria 9173742
543 2954388768 2954380949 Bacteria 10050426
544 2954674357 2954673503 Bacteria 9685905
545 2954689774 2954682443 Bacteria 9862841
546 2954699558 2954691527 Bacteria 10720516
547 2954702659 2954701450 Bacteria 10834262
548 2954718495 2954711539 Bacteria 10867210
549 2954728465 2954721474 Bacteria 10456478
550 2954733344 2954731030 Bacteria 10243860
551 2954747362 2954740390 Bacteria 10229294
552 2954752227 2954749733 Bacteria 10366972
553 2954766477 2954759201 Bacteria 9358192
554 2966604538 2966598605 Bacteria 7676064
555 2990059701 2990059506 Bacteria 9321252
556 2990090370 2990088156 Bacteria 6657676
557 2995470626 2995463766 Bacteria 8577691
558 2997453748 2997451912 Bacteria 8492419
559 2997601563 2997600082 Bacteria 9896405
560 2997603835 2997600082 Bacteria 9896405
561 3006327258 3006321560 Bacteria 8247479
562 3006394344 3006393351 Bacteria 6615579
563 3006428284 3006425503 Bacteria 6491253
564 3006490031 3006486233 Bacteria 8157040
565 3006501443 3006493962 Bacteria 8825450
566 8008561192 8008558824 Bacteria 10610750
567 8008580862 8008574985 Bacteria 7815457
568 8023631331 8023623736 Bacteria 8593882
569 8025414753 8025413630 Bacteria 7014048
570 8025478371 8025478263 Bacteria 8209203
571 8025535427 8025530807 Bacteria 8495698
572 8047901201 8047893842 Bacteria 11723082
573 8048129244 8048127548 Bacteria 11053136
574 8048357701 8048356638 Bacteria 11044339
575 8048378140 8048369669 Bacteria 11666822
576 8048387238 8048379754 Bacteria 11877923
577 8054160647 8054160619 Bacteria 7783213
578 8056450641 8056447290 Bacteria 7680491
579 8056668988 8056667051 Bacteria 6953971
580 8056835828 8056829672 Bacteria 9045328
581 Ga0105244_10335537
582 JGI24737J22298_10019328
583 JGI24735J21928_10105224
584 rootH1_10019087
585 rootH2_10022202
586 rootH1_10001145
587 rootH1_10061145
588 JGI25160J50197_1033845
589 JGI25160J50197_1035017
590 JGI25160J50197_1064574
591 Ga0070685_10384860
592 Ga0070706_101334575
593 Ga0070698_100098074
594 Ga0070699_100094902
595 Ga0068853_100698446
596 Ga0070665_100226419
597 Ga0068854_101305160
598 Ga0068856_100309128
599 Ga0081455_10431480
600 Ga0075368_10025764
601 Ga0075363_100151456
602 Ga0075363_100736817
603 Ga0075370_10372666
604 Ga0105251_10038988
605 Ga0105245_11273438
606 Ga0105239_10434823
607 Ga0105239_10912035
608 Ga0157369_10768243
609 Ga0157378_11491644
610 Ga0157372_10554441
611 Ga0182008_10003812
612 Ga0157376_11842975
613 Ga0182006_1113317
614 Ga0182007_10000589
615 Ga0182005_1074168
616 Ga0183367_1017
617 Ga0224712_10133382
618 Ga0209758_1006643
619 Ga0207426_1023646
620 Ga0207426_1033835
621 Ga0207713_1031520
622 Ga0207640_10724938
623 Ga0207639_10624985
624 Ga0207702_10155065
625 Ga0209813_10011215
626 Ga0268266_10201174
627 Ga0307517_10014692
628 Ga0307515_10001750
629 Ga0268256_1043259
630 Ga0307511_10001518
631 Ga0307512_10007510
632 Ga0307513_10016324
633 Ga0307513_10132987
634 Ga0307509_10021531
635 Ga0307509_10445207
636 Ga0307509_10465424
637 Ga0307508_10020993
638 Ga0307508_10111339
639 Ga0307508_10188038
640 Ga0307508_10494021
641 Ga0307514_10130255
642 Ga0307514_10183921
643 Ga0307514_10307221
644 Ga0307516_10003631
645 Ga0307516_10058774
646 Ga0307516_10347582
647 Ga0307516_10415725
648 Ga0307518_10379114
649 Ga0307507_10177065
650 Ga0307510_10224480
651 Ga0307510_10285448
652 Ga0307510_10292951
653 Ga0395899_0835837
654 Ga0395900_0193747
655 Ga0395900_0911875
656 Ga0395898_0006327
657 Ga0395898_0025127
658 Ga0395898_0599307
659 Ga0395905_0474261
660 Ga0395901_0250262
661 Ga0395901_0952285
662 Ga0439436_0006065
663 Ga0439436_0011993
664 Ga0439439_0063285
665 Ga0439439_0103032
666 Ga0451800_1490878
667 Ga0451802_1670684
668 Ga0451841_0072486
669 Ga0451849_0389586
670 Ga0451843_0412225
671 Ga0451853_0823836
672 Ga0451853_0979725
673 Ga0451853_1127343
674 Ga0451853_1456412
675 Ga0439433_0005228
676 Ga0439433_0125079
677 Ga0439448_0029030
678 Ga0439449_0010902
679 Ga0439449_0022524
680 Ga0439449_0351485
681 Ga0439454_009102
682 Ga0439455_0009322
683 Ga0439457_001029
684 Ga0439457_007870
685 Ga0439462_0013666
686 Ga0450903_000849
687 Ga0439458_0005581
688 Ga0439458_0053204
689 Ga0450901_029484
690 Ga0466969_0032120
691 Ga0466972_0014725
692 Ga0466972_0185142
693 Ga0466965_0273835
694 Ga0466965_0286712
695 Ga0466966_0027584
696 Ga0466966_0236094
697 Ga0466966_0236943
698 Ga0466961_0004936
699 Ga0466961_0222452
700 Ga0466963_0002522
701 Ga0466963_0005806
702 Ga0466964_0026468
703 Ga0466964_0286669
704 Ga0466971_0211839
705 Ga0466971_0417522
706 Ga0466970_0003215
707 Ga0466970_0004312
708 Ga0466970_0115766
709 Ga0466970_0629689
710 Ga0466957_0004830
711 Ga0466960_0098540
712 Ga0466959_0005110
713 Ga0466959_0105360
714 Ga0466958_0003164
715 Ga0466958_0265300
716 Ga0466958_0588620
717 Ga0466967_0006426
718 Ga0466967_0044884
719 Ga0466967_0476145
720 Ga0495627_116680
721 Ga0495592_0009218
722 Ga0495592_0023370
723 Ga0495603_0047254
724 Ga0495603_0054449
725 Ga0495603_0081529
726 Ga0495603_0310578
727 Ga0495629_0030214
728 Ga0495629_0051479
729 Ga0495629_0057811
730 Ga0495629_0348752
731 Ga0495629_0440217
732 Ga0495638_0133054
733 Ga0495638_0349936
734 Ga0495651_0067037
735 Ga0495651_0079729
736 Ga0495653_0035872
737 Ga0495653_0098422
738 Ga0495580_0652552
739 Ga0495582_0227578
740 Ga0495582_0356678
741 Ga0495605_0021977
742 Ga0495605_0099570
743 Ga0495662_0002095
744 Ga0495662_0020224
745 Ga0495662_0026399
746 Ga0495662_0057375
747 Ga0495662_0274192
748 Ga0495664_0070796
749 Ga0495664_0371693
750 Ga0495664_0472996
751 Ga0495585_0023385
752 Ga0495585_0125602
753 Ga0495585_0292535
754 Ga0495594_0008747
755 Ga0495594_0014479
756 Ga0495594_0054825
757 Ga0495594_0091330
758 Ga0495594_0171539
759 Ga0495594_0351495
760 Ga0495596_0049892
761 Ga0495607_0029485
762 Ga0495607_0121545
763 Ga0495583_0050219
764 Ga0495606_0004400
765 Ga0495608_0064632
766 Ga0495610_0153840
767 Ga0495616_0020022
768 Ga0495620_0005734
769 Ga0495628_0050035
770 Ga0495628_0079575
771 Ga0495630_0004077
772 Ga0495630_0389401
773 Ga0495630_0522452
774 Ga0495630_0527866
775 Ga0495630_1218385
776 Ga0495631_0023972
777 Ga0495631_0040994
778 Ga0495631_0374512
779 Ga0495632_0062921
780 Ga0495637_0183822
781 Ga0495643_0037953
782 Ga0495648_0058127
783 Ga0495666_0022643
784 Ga0495666_0023497
785 Ga0495666_0070190
786 Ga0495652_0044038
787 Ga0495654_0059472
788 Ga0495665_0033527
789 Ga0495640_0006243
790 Ga0495640_0019075
791 Ga0495640_0049751
792 Ga0495640_0097207
793 Ga0495586_0081500
794 Ga0495587_0021413
795 Ga0495609_0066338
796 Ga0495609_0160952
797 Ga0495597_0020713
798 Ga0495597_0190531
799 Ga0495645_0034939
800 Ga0495645_0237930
801 Ga0495622_0019114
802 Ga0495633_0026590
803 Ga0495667_0284999
804 Ga0495667_0423487
805 Ga0495668_0009205
806 Ga0495668_0158439
807 Ga0495634_0020737
808 Ga0495634_0096209
809 Ga0495634_0257113
810 Ga0495611_0156727
811 Ga0495625_0059122
812 Ga0495625_0736178
813 Ga0495635_0075927
814 Ga0495635_0974555
815 Ga0495661_0045944
816 Ga0495661_0139676
817 Ga0495588_0006043
818 Ga0495588_0006782
819 Ga0495588_0015839
820 Ga0495588_0125519
821 Ga0495588_0673634
822 Ga0495657_0004665
823 Ga0495657_0010291
824 Ga0495657_0020501
825 Ga0495657_0037058
826 Ga0495623_0022746
827 Ga0495623_0066410
828 Ga0495646_0552891
829 Ga0495613_0001798
830 Ga0495613_0012549
831 Ga0495613_0013478
832 Ga0495613_0015440
833 Ga0495613_0018159
834 Ga0495613_0019906
835 Ga0495613_0064046
836 Ga0495613_0415937
837 Ga0495613_0744950
838 Ga0495624_0039081
839 Ga0495624_0226677
840 Ga0495624_0291074
841 Ga0495670_0008165
842 Ga0495670_0027981
843 Ga0495670_0247499
844 Ga0495671_0130215
845 Ga0495671_0156660
846 Ga0495649_0195462
847 Ga0495649_0299793
848 Ga0495589_0031247
849 Ga0495589_0125275
850 Ga0495589_0193551
851 Ga0495589_0393626
852 Ga0495600_0062616
853 Ga0495600_0259003
854 Ga0495660_0087570
855 Ga0495581_0041857
856 Ga0495581_0070715
857 Ga0495581_0182328
858 Ga0495581_0403685
859 Ga0495604_0013579
860 Ga0495604_0014995
861 Ga0495604_0015806
862 Ga0495604_0066600
863 Ga0495604_0071256
864 Ga0495636_0004579
865 Ga0495636_0016102
866 Ga0495636_0064052
867 Ga0495636_0066334
868 Ga0495636_0081077
869 Ga0495636_0117639
870 Ga0495636_0138977
871 Ga0495636_0141620
872 Ga0495674_0060697
873 Ga0495674_0213158
874 Ga0495676_0001343
875 Ga0495676_0004519
876 Ga0495676_0067795
877 Ga0495676_0069483
878 Ga0495676_0334290
879 Ga0495676_0413483
880 Ga0495683_0049537
881 Ga0495683_0071053
882 Ga0495683_0213773
883 Ga0495687_001425
884 Ga0495687_009175
885 Ga0495687_052775
886 Ga0495687_056375
887 Ga0495687_161584
888 Ga0495687_181096
889 Ga0495675_0011908
890 Ga0495675_0061483
891 Ga0495675_0096044
892 Ga0495675_0100518
893 Ga0495675_0290657
894 Ga0495675_0394545
895 Ga0495685_009617
896 Ga0495685_014514
897 Ga0495685_014841
898 Ga0495685_015741
899 Ga0495685_022882
900 Ga0495685_089869
901 Ga0495685_101595
902 Ga0495681_0001741
903 Ga0495681_0039948
904 Ga0495681_0145858
905 Ga0495684_0051639
906 Ga0495686_0084564
907 Ga0495686_0134110
908 Ga0495686_0356694
909 Ga0495593_0014543
910 Ga0495593_0022038
911 Ga0495593_0141943
912 Ga0495593_0242952
913 Ga0495602_0076034
914 Ga0495614_0002397
915 Ga0495614_0021891
916 Ga0495614_0061700
917 Ga0495614_0171868
918 Ga0495626_0024106
919 Ga0496102_1244036
920 Ga0496106_0025566
921 Ga0496110_0546601
922 Ga0496113_0295312
923 Ga0496126_0132753
924 Ga0501306_032244
925 Ga0495678_110768
926 Ga0495682_0039222
927 Ga0501318_005455
928 Ga0501323_003231
929 Ga0501323_011969
930 Ga0501324_017100
931 Ga0501031_0138804
932 Ga0501031_0159352
933 Ga0501032_0015234
934 Ga0501032_0204819
935 Ga0501032_0302660
936 Ga0501032_0639958
937 Ga0501033_0012501
938 Ga0501033_0073098
939 Ga0501033_0323268
940 Ga0501033_0342800
941 Ga0501033_0792157
942 Ga0501034_0123825
943 Ga0501034_0257988
944 Ga0501034_0344679
945 Ga0501034_0374961
946 Ga0501034_0852004
947 Ga0501034_0868377
948 Ga0501034_1239155
949 Ga0501036_0007816
950 Ga0501036_0036723
951 Ga0501036_0114810
952 Ga0501036_0161555
953 Ga0501036_0372179
954 Ga0501036_0496549
955 Ga0501036_0569724
956 Ga0501037_0001764
957 Ga0501037_0019702
958 Ga0501037_0078699
959 Ga0501037_0411334
960 Ga0501037_0502702
961 Ga0501037_0644383
962 Ga0501037_0752976
963 Ga0501038_0139740
964 Ga0501038_0289987
965 Ga0501038_0726641
966 Ga0501038_1083526
967 Ga0501039_0086481
968 Ga0501039_0249507
969 Ga0501039_0369106
970 Ga0501040_0641449
971 Ga0501041_0000939
972 Ga0501042_0340971
973 Ga0501042_0735829
974 Ga0501043_0000673
975 Ga0501043_0001814
976 Ga0501043_0087521
977 Ga0501043_0121542
978 Ga0501043_0310563
979 Ga0501043_0752162
980 Ga0501047_0000103
981 Ga0501047_0001475
982 Ga0501047_0038200
983 Ga0501047_0123393
984 Ga0501047_0172621
985 Ga0501047_0176613
986 Ga0501047_0196388
987 Ga0501048_0397859
988 Ga0501067_0017334
989 Ga0501068_0020964
990 Ga0501068_0200915
991 Ga0501068_0434520
992 Ga0501069_0301207
993 Ga0501070_0006796
994 Ga0501070_0018219
995 Ga0501070_1050374
996 Ga0501071_0075374
997 Ga0501071_0710699
998 Ga0501072_0013204
999 Ga0501073_0463938
1000 Ga0501073_0521685
1001 Ga0501074_0004273
1002 Ga0501074_0080868
1003 Ga0501079_0084483
1004 Ga0501079_0748172
1005 Ga0501080_0547760
1006 Ga0501083_0013620
1007 Ga0501035_0000511
1008 Ga0501035_0012965
1009 Ga0501035_0027013
1010 Ga0501035_0045231
1011 Ga0501035_0066536
1012 Ga0501035_0124842
1013 Ga0501035_0151731
1014 Ga0501035_0173199
1015 Ga0501035_0179214
1016 Ga0501035_0500173
1017 Ga0501035_0597075
1018 Ga0501035_1023916
1019 Ga0501044_0001298
1020 Ga0501044_0011560
1021 Ga0501044_0014460
1022 Ga0501044_0034925
1023 Ga0501044_0087748
1024 Ga0501044_0138075
1025 Ga0501044_0289306
1026 Ga0501044_0305880
1027 Ga0501044_0514703
1028 Ga0501044_0726148
1029 Ga0501044_1010628
1030 Ga0501045_0568459
1031 nmdc:mga03n38_129835_c1
1032 nmdc:mga03n38_587506_c1
1033 nmdc:mga06z11_791449_c1
1034 nmdc:mga04h51_17996_c1
1035 Ga0495601_0062884
1036 Ga0500610_0172092
1037 Ga0495619_0045360
1038 Ga0495619_0053348
1039 Ga0500578_0028288
1040 Ga0500647_0114955
1041 Ga0500651_0190893
1042 Ga0500654_187482
1043 Ga0500660_089777
1044 Ga0500556_0068674
1045 Ga0500560_008650
1046 Ga0500560_085403
1047 Ga0500614_122143
1048 Ga0500621_161026
1049 Ga0500628_002519
1050 Ga0500652_104593
1051 Ga0500658_0012991
1052 Ga0500561_0006086
1053 Ga0500573_0045295
1054 Ga0500588_0011216
1055 Ga0500600_0038537
1056 Ga0500600_0085134
1057 Ga0500600_0139716
1058 Ga0500616_0070710
1059 Ga0500633_0011907
1060 Ga0500634_0069886
1061 Ga0500634_0160721
1062 Ga0500587_000721
1063 Ga0501084_0343590
1064 Ga0587106_100801
1065 Ga0587122_042903
1066 Ga0501082_0002273
1067 Ga0466962_0002779
1068 2547406402
1069 2554259651
1070 2585300895
1071 2585303405
1072 2585316877
1073 2616695483
1074 2616906213
1075 2643760335
1076 2643904387
1077 2643946695
1078 2644015675
1079 2644177404
1080 2644267898
1081 2644388963
1082 2644406346
1083 2644434499
1084 2644443573
1085 2644459968
1086 2644632491
1087 2784586640
1088 2785345858
1089 2785367032
1090 2786668069
1091 2804843621
1092 2808847535
1093 2808918267
1094 2809230167
1095 2811846857
1096 2812360434
1097 2812482527
1098 2819699842
1099 2819744000
1100 2852637588
1101 2862186374
1102 2862289782
1103 2862291967
1104 2862510316
1105 2862516480
1106 2862583847
1107 2863407089
1108 2867375218
1109 2867434664
1110 2875392593
1111 2877683512
1112 2912722622
1113 2912726304
1114 2912758733
1115 2918502402
1116 2919472310
1117 2935393723
1118 2946052124
1119 2946065455
1120 2946073818
1121 2947231952
1122 2954011195
1123 2954388768
1124 2954674357
1125 2954689774
1126 2954699558
1127 2954702659
1128 2954718495
1129 2954728465
1130 2954733344
1131 2954747362
1132 2954752227
1133 2954766477
1134 2966604538
1135 2990059701
1136 2990090370
1137 2995470626
1138 2997453748
1139 2997601563
1140 2997603835
1141 3006327258
1142 3006394344
1143 3006428284
1144 3006490031
1145 3006501443
1146 8008561192
1147 8008580862
1148 8023631331
1149 8025414753
1150 8025478371
1151 8025535427
1152 8047901201
1153 8048129244
1154 8048357701
1155 8048378140
1156 8048387238
1157 8054160647
1158 8056450641
1159 8056668988
1160 8056835828

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00358

PTS_EIIA_1

phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1

12

137

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gpr-assembly1.cif.gz_A glucose permease iia from mycoplasma capricolum 0.9281 3 146
3our-assembly3.cif.gz_F crystal structure of complex between eiia and a novel pyruvate decarboxylase 0.8977 3 148
1gla-assembly1.cif.gz_F structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase 0.8961 3 149
1gpr-assembly1.cif.gz_A-2 refined crystal structure of iia domain of the glucose permease of bacillus subtilis at 1.9 angstroms resolution 0.896 4 149
4jbw-assembly1.cif.gz_M crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8878 1 149
ID Description Score Start End Superfamily
2gprA00 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9281 3 146 2.70.70.10
af_Q2FV87_535_686_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9117 1 147 2.70.70.10
af_P08722_474_624_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9086 3 149 2.70.70.10
af_Q2G1B0_104_262_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.905 3 146 2.70.70.10
af_Q2FYL0_6_165_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9039 2 146 2.70.70.10
ID Description Score Start End GO Terms
AF-A0A0J8C015-F1-model_v4 PTS glucose transporter subunit IIA 1.005 1 149 GO:0005737
GO:0009401
GO:0016301
AF-A0A101MYV1-F1-model_v4 PTS glucose transporter subunit IIA 1.005 1 149 GO:0005737
GO:0009401
GO:0016301
AF-A0A2P7ZKS1-F1-model_v4 deleted 1.005 1 149
AF-A0A5J6HUZ4-F1-model_v4 PTS glucose transporter subunit IIA 1.005 1 149 GO:0005737
GO:0009401
GO:0016301
AF-A0A6B2SGW1-F1-model_v4 PTS glucose transporter subunit IIA 1.005 1 149 GO:0005737
GO:0009401
GO:0016301

Map