F465927

General Info

Members Datasets Scaffolds Average Seq Length
580 283 1160 304

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10028663|Ga0075369_100286632
Length 341
Sequence MILAPHAGATNSTPVTVPKPRAAANFRPKPACDTLLMVPSIARPKLEGNVAVGDDRQIGFAEFGDPLGRAVFWLHGTPGARRQIPVEARVYAERNHIRLIGVDRPGIGSSTPFQYENVLAFADDLRTIADVLGIDKMAIIGLSGGGPYTLACAAKMPERVVAVGVLGGVAPAVGPERIGGGAMALGSAMAPFMPFIGLPLRLAAVSLIRVAKPFADRAIDVYGRVSPVGDRQLLARPEFKAMFLDDLLNGSRKQMAAPFADVVVFAKDWGFRLDEVKVPVRWWHGDKDHIIPFAHGEHVVALLPDAELYTLPGESHLAGLGYAEEILDRLMALWDDLEPGA

Samples

Sample ID Description Type Environment
1 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
152 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
153 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
154 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
155 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
215 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
245 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
249 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
255 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
259 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
260 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
261 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
262 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
263 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
264 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
265 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
266 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
267 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
268 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
269 2643221576 Nocardioides sp. Root614 Isolate Unclassified
270 2643221590 Nocardioides sp. Root682 Isolate Unclassified
271 2643221617 Nocardioides sp. Root79 Isolate Unclassified
272 2643221620 Nocardioides sp. Root240 Isolate Unclassified
273 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
274 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
275 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
276 2738541305 Nocardioides sp. CF167 Isolate Unclassified
277 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
278 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
279 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
280 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
281 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
282 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
283 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.41
Metatranscriptomes 0
Isolates 2.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.76
Nodule 0
Rhizoplane 11.72
Rhizosphere 60
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075369_10028663 3300006186 Bacteria 2335
2 JGI24746J21847_1012120 3300001977 Bacteria 1262
3 JGI24747J21853_1004997 3300001978 Bacteria 1211
4 JGI24743J22301_10034800 3300001991 Bacteria 1000
5 JGI24744J21845_10003208 3300002077 Bacteria 3356
6 JGI24742J22300_10015389 3300002244 Bacteria 1287
7 rootL2_10065193 3300003322 Bacteria 2202
8 Ga0055540_1000024 3300003792 Bacteria 199164
9 Ga0055540_1001436 3300003792 Bacteria 14199
10 Ga0055540_1001629 3300003792 Bacteria 13038
11 Ga0055540_1006954 3300003792 Bacteria 4373
12 Ga0070658_10017847 3300005327 Bacteria 5675
13 Ga0070676_10037414 3300005328 Bacteria 2799
14 Ga0070676_10189839 3300005328 Bacteria 1341
15 Ga0070690_100004021 3300005330 Bacteria 8137
16 Ga0068869_100134475 3300005334 Bacteria 1904
17 Ga0070680_100555905 3300005336 Bacteria 984
18 Ga0070682_100075937 3300005337 Bacteria 2162
19 Ga0070682_100107874 3300005337 Bacteria 1850
20 Ga0070689_100093198 3300005340 Bacteria 2377
21 Ga0070691_10029109 3300005341 Bacteria 2583
22 Ga0070668_100005304 3300005347 Bacteria 9567
23 Ga0070669_100032804 3300005353 Bacteria 3752
24 Ga0070675_100051707 3300005354 Bacteria 3377
25 Ga0070674_100000574 3300005356 Bacteria 18552
26 Ga0070674_100020678 3300005356 Bacteria 4212
27 Ga0070674_100114317 3300005356 Bacteria 1987
28 Ga0070659_100005422 3300005366 Bacteria 9160
29 Ga0070659_100109916 3300005366 Bacteria 2225
30 Ga0070659_100148133 3300005366 Bacteria 1913
31 Ga0070667_100000075 3300005367 Bacteria 120953
32 Ga0070667_100000568 3300005367 Bacteria 36558
33 Ga0070667_100010725 3300005367 Bacteria 7571
34 Ga0070709_10003995 3300005434 Bacteria 7956
35 Ga0070709_10118432 3300005434 Bacteria 1791
36 Ga0070710_10004165 3300005437 Bacteria 6864
37 Ga0070710_10007809 3300005437 Bacteria 5191
38 Ga0070701_10006457 3300005438 Bacteria 4938
39 Ga0070711_100000116 3300005439 Bacteria 41548
40 Ga0070711_100015727 3300005439 Bacteria 4790
41 Ga0070705_100010248 3300005440 Bacteria 4685
42 Ga0070700_100000880 3300005441 Bacteria 14816
43 Ga0070694_100109913 3300005444 Bacteria 1963
44 Ga0070694_100137019 3300005444 Bacteria 1774
45 Ga0070678_100024764 3300005456 Bacteria 4024
46 Ga0070662_100043251 3300005457 Bacteria 3222
47 Ga0070662_100091374 3300005457 Bacteria 2286
48 Ga0068867_100000745 3300005459 Bacteria 21851
49 Ga0068853_100016371 3300005539 Bacteria 6102
50 Ga0070672_100042233 3300005543 Bacteria 3510
51 Ga0070696_100008742 3300005546 Bacteria 6779
52 Ga0070696_100090098 3300005546 Bacteria 2182
53 Ga0070693_100027230 3300005547 Bacteria 3095
54 Ga0070693_100080975 3300005547 Bacteria 1935
55 Ga0070665_100003826 3300005548 Bacteria 15936
56 Ga0070665_100009906 3300005548 Bacteria 9638
57 Ga0070665_100011758 3300005548 Bacteria 8837
58 Ga0070665_100049124 3300005548 Bacteria 4233
59 Ga0070704_100001170 3300005549 Bacteria 13690
60 Ga0070664_100018672 3300005564 Bacteria 5702
61 Ga0068854_100027881 3300005578 Bacteria 3896
62 Ga0070702_100030937 3300005615 Bacteria 2923
63 Ga0068852_100284267 3300005616 Bacteria 1596
64 Ga0068859_100000077 3300005617 Bacteria 91522
65 Ga0068859_100011843 3300005617 Bacteria 8758
66 Ga0068859_100503266 3300005617 Bacteria 1306
67 Ga0068866_10003067 3300005718 Bacteria 6894
68 Ga0068861_100031670 3300005719 Bacteria 3887
69 Ga0068863_100001808 3300005841 Bacteria 21226
70 Ga0068863_100050184 3300005841 Bacteria 3956
71 Ga0068858_100004271 3300005842 Bacteria 14053
72 Ga0068858_100013105 3300005842 Bacteria 7818
73 Ga0068858_100027318 3300005842 Bacteria 5303
74 Ga0068860_100000025 3300005843 Bacteria 271553
75 Ga0068860_100002961 3300005843 Bacteria 17524
76 Ga0068862_100000003 3300005844 Bacteria 369793
77 Ga0068862_100004932 3300005844 Bacteria 11234
78 Ga0068862_100196470 3300005844 Bacteria 1817
79 Ga0081455_10134699 3300005937 Bacteria 1927
80 Ga0081455_10157661 3300005937 Bacteria 1743
81 Ga0081455_10239978 3300005937 Bacteria 1332
82 Ga0081538_10113812 3300005981 Bacteria 1320
83 Ga0075365_10011556 3300006038 Bacteria 5197
84 Ga0075365_10016374 3300006038 Bacteria 4508
85 Ga0075365_10022655 3300006038 Bacteria 3939
86 Ga0075365_10023821 3300006038 Bacteria 3854
87 Ga0075365_10192534 3300006038 Bacteria 1427
88 Ga0075365_10245357 3300006038 Bacteria 1258
89 Ga0075368_10000981 3300006042 Bacteria 8913
90 Ga0075368_10001621 3300006042 Bacteria 7224
91 Ga0075368_10023642 3300006042 Bacteria 2349
92 Ga0075363_100000621 3300006048 Bacteria 11717
93 Ga0075363_100000747 3300006048 Bacteria 11111
94 Ga0075363_100002153 3300006048 Bacteria 7923
95 Ga0075363_100003630 3300006048 Bacteria 6615
96 Ga0075363_100019656 3300006048 Bacteria 3378
97 Ga0075363_100028710 3300006048 Bacteria 2864
98 Ga0075363_100098230 3300006048 Bacteria 1618
99 Ga0075364_10000083 3300006051 Bacteria 37238
100 Ga0075364_10006842 3300006051 Bacteria 6728
101 Ga0075364_10007205 3300006051 Bacteria 6586
102 Ga0075364_10007723 3300006051 Bacteria 6402
103 Ga0075364_10016696 3300006051 Bacteria 4571
104 Ga0075364_10017404 3300006051 Bacteria 4490
105 Ga0075364_10100644 3300006051 Bacteria 1924
106 Ga0075364_10150664 3300006051 Bacteria 1568
107 Ga0070715_10168071 3300006163 Bacteria 1090
108 Ga0070712_100001799 3300006175 Bacteria 13098
109 Ga0070712_100016565 3300006175 Bacteria 4761
110 Ga0075362_10020162 3300006177 Bacteria 2783
111 Ga0075367_10012667 3300006178 Bacteria 4509
112 Ga0075367_10015563 3300006178 Bacteria 4140
113 Ga0075367_10017337 3300006178 Bacteria 3951
114 Ga0075367_10034438 3300006178 Bacteria 2926
115 Ga0075367_10109964 3300006178 Bacteria 1691
116 Ga0075367_10143550 3300006178 Bacteria 1479
117 Ga0075367_10151152 3300006178 Bacteria 1441
118 Ga0075369_10000442 3300006186 Bacteria 12586
119 Ga0075369_10005567 3300006186 Bacteria 4715
120 Ga0075369_10018018 3300006186 Bacteria 2871
121 Ga0075369_10025989 3300006186 Bacteria 2439
122 Ga0097621_100044828 3300006237 Bacteria 3570
123 Ga0097621_100143209 3300006237 Bacteria 2044
124 Ga0097621_100434614 3300006237 Bacteria 1180
125 Ga0075370_10001390 3300006353 Bacteria 10435
126 Ga0075370_10007474 3300006353 Bacteria 5567
127 Ga0075370_10042259 3300006353 Bacteria 2575
128 Ga0075370_10075519 3300006353 Bacteria 1932
129 Ga0075370_10129079 3300006353 Bacteria 1474
130 Ga0068871_100084751 3300006358 Bacteria 2630
131 Ga0075428_100001851 3300006844 Bacteria 22659
132 Ga0075430_100173643 3300006846 Bacteria 1793
133 Ga0068865_100003056 3300006881 Bacteria 10010
134 Ga0097620_100000077 3300006931 Bacteria 91522
135 Ga0097620_100011844 3300006931 Bacteria 8758
136 Ga0097620_100503274 3300006931 Bacteria 1306
137 Ga0105245_10075694 3300009098 Bacteria 3065
138 Ga0105245_10261570 3300009098 Bacteria 1684
139 Ga0105247_10000010 3300009101 Bacteria 302475
140 Ga0105247_10002313 3300009101 Bacteria 13013
141 Ga0105247_10037008 3300009101 Bacteria 2976
142 Ga0105247_10236122 3300009101 Bacteria 1244
143 Ga0114129_10203476 3300009147 Bacteria 2680
144 Ga0105243_10005121 3300009148 Bacteria 10280
145 Ga0105243_10045678 3300009148 Bacteria 3443
146 Ga0105242_10000740 3300009176 Bacteria 25458
147 Ga0105248_10000078 3300009177 Bacteria 111935
148 Ga0105248_10006970 3300009177 Bacteria 12381
149 Ga0105248_10008276 3300009177 Bacteria 11428
150 Ga0105237_10001706 3300009545 Bacteria 28414
151 Ga0105237_10188604 3300009545 Bacteria 2062
152 Ga0105238_10600350 3300009551 Bacteria 1109
153 Ga0105249_10000010 3300009553 Bacteria 306939
154 Ga0105249_10018771 3300009553 Bacteria 6161
155 Ga0105249_10024197 3300009553 Bacteria 5457
156 Ga0105239_10011603 3300010375 Bacteria 9830
157 Ga0105239_10011949 3300010375 Bacteria 9683
158 Ga0105239_10160679 3300010375 Bacteria 2510
159 Ga0105239_10351284 3300010375 Bacteria 1665
160 Ga0157369_10123767 3300013105 Bacteria 2743
161 Ga0157378_10001255 3300013297 Bacteria 22855
162 Ga0163162_10018019 3300013306 Bacteria 6909
163 Ga0163162_10094633 3300013306 Bacteria 3074
164 Ga0157375_10001039 3300013308 Bacteria 23979
165 Ga0157375_10173300 3300013308 Bacteria 2306
166 Ga0163163_10547037 3300014325 Bacteria 1220
167 Ga0157380_10000278 3300014326 Bacteria 30716
168 Ga0157380_10233990 3300014326 Bacteria 1652
169 Ga0182008_10096878 3300014497 Bacteria 1456
170 Ga0157377_10009467 3300014745 Bacteria 4779
171 Ga0157377_10054769 3300014745 Bacteria 2259
172 Ga0157379_10115237 3300014968 Bacteria 2416
173 Ga0157376_10008320 3300014969 Bacteria 7479
174 Ga0163161_10014020 3300017792 Bacteria 5581
175 Ga0213876_10000669 3300021384 Bacteria 24435
176 Ga0213876_10001611 3300021384 Bacteria 13853
177 Ga0213876_10012123 3300021384 Bacteria 4592
178 Ga0213876_10012882 3300021384 Bacteria 4446
179 Ga0209673_1005504 3300025273 Bacteria 6344
180 Ga0209051_1000021 3300025303 Bacteria 507633
181 Ga0209051_1000890 3300025303 Bacteria 29929
182 Ga0209051_1000955 3300025303 Bacteria 28356
183 Ga0209051_1003492 3300025303 Bacteria 10280
184 Ga0209051_1051712 3300025303 Bacteria 1364
185 Ga0207692_10016938 3300025898 Bacteria 3239
186 Ga0207692_10028720 3300025898 Bacteria 2635
187 Ga0207642_10024738 3300025899 Bacteria 2418
188 Ga0207710_10000028 3300025900 Bacteria 304525
189 Ga0207710_10001290 3300025900 Bacteria 12669
190 Ga0207688_10000743 3300025901 Bacteria 16183
191 Ga0207647_10022714 3300025904 Bacteria 4163
192 Ga0207645_10117171 3300025907 Bacteria 1727
193 Ga0207705_10015930 3300025909 Bacteria 5397
194 Ga0207705_10317653 3300025909 Bacteria 1196
195 Ga0207671_10009718 3300025914 Bacteria 8007
196 Ga0207693_10000767 3300025915 Bacteria 28847
197 Ga0207693_10004588 3300025915 Bacteria 11655
198 Ga0207663_10007111 3300025916 Bacteria 5781
199 Ga0207663_10012178 3300025916 Bacteria 4641
200 Ga0207657_10169678 3300025919 Bacteria 1768
201 Ga0207649_10074754 3300025920 Bacteria 2175
202 Ga0207681_10002509 3300025923 Bacteria 11666
203 Ga0207681_10321967 3300025923 Bacteria 1230
204 Ga0207659_10086680 3300025926 Bacteria 2329
205 Ga0207687_10006446 3300025927 Bacteria 7753
206 Ga0207687_10043956 3300025927 Bacteria 3080
207 Ga0207700_10212949 3300025928 Bacteria 1635
208 Ga0207700_10283034 3300025928 Bacteria 1427
209 Ga0207644_10004218 3300025931 Bacteria 9333
210 Ga0207644_10088786 3300025931 Bacteria 2300
211 Ga0207690_10037638 3300025932 Bacteria 3142
212 Ga0207690_10124970 3300025932 Bacteria 1874
213 Ga0207690_10136768 3300025932 Bacteria 1800
214 Ga0207706_10001473 3300025933 Bacteria 23528
215 Ga0207706_10002995 3300025933 Bacteria 16281
216 Ga0207706_10116096 3300025933 Bacteria 2354
217 Ga0207686_10002695 3300025934 Bacteria 9639
218 Ga0207709_10038955 3300025935 Bacteria 2835
219 Ga0207669_10012106 3300025937 Bacteria 4228
220 Ga0207669_10238083 3300025937 Bacteria 1347
221 Ga0207704_10009035 3300025938 Bacteria 4790
222 Ga0207665_10003151 3300025939 Bacteria 11053
223 Ga0207665_10025542 3300025939 Bacteria 3898
224 Ga0207691_10038351 3300025940 Bacteria 4435
225 Ga0207691_10190017 3300025940 Bacteria 1791
226 Ga0207711_10000069 3300025941 Bacteria 115038
227 Ga0207711_10006148 3300025941 Bacteria 10146
228 Ga0207711_10008722 3300025941 Bacteria 8478
229 Ga0207689_10007397 3300025942 Bacteria 9630
230 Ga0207679_10011328 3300025945 Bacteria 5769
231 Ga0207712_10000016 3300025961 Bacteria 343014
232 Ga0207712_10017361 3300025961 Bacteria 4672
233 Ga0207712_10061757 3300025961 Bacteria 2661
234 Ga0207668_10000890 3300025972 Bacteria 18029
235 Ga0207640_10020635 3300025981 Bacteria 3914
236 Ga0207658_10001986 3300025986 Bacteria 15254
237 Ga0207658_10004292 3300025986 Bacteria 9930
238 Ga0207658_10012411 3300025986 Bacteria 5820
239 Ga0207658_10022404 3300025986 Bacteria 4398
240 Ga0207658_10023258 3300025986 Bacteria 4324
241 Ga0207677_10009122 3300026023 Bacteria 5569
242 Ga0207703_10031836 3300026035 Bacteria 4172
243 Ga0207703_10042499 3300026035 Bacteria 3646
244 Ga0207703_10166763 3300026035 Bacteria 1933
245 Ga0207639_10003677 3300026041 Bacteria 10306
246 Ga0207678_10053867 3300026067 Bacteria 3466
247 Ga0207708_10000742 3300026075 Bacteria 24488
248 Ga0207708_10001425 3300026075 Bacteria 17938
249 Ga0207641_10000962 3300026088 Bacteria 29547
250 Ga0207648_10000085 3300026089 Bacteria 88563
251 Ga0207675_100001558 3300026118 Bacteria 22972
252 Ga0207675_100016529 3300026118 Bacteria 6890
253 Ga0207675_100107534 3300026118 Bacteria 2630
254 Ga0207683_10000289 3300026121 Bacteria 45201
255 Ga0207683_10006265 3300026121 Bacteria 10193
256 Ga0207683_10265168 3300026121 Bacteria 1569
257 Ga0207698_10210586 3300026142 Bacteria 1749
258 Ga0209813_10100359 3300027866 Bacteria 984
259 Ga0268266_10007205 3300028379 Bacteria 10062
260 Ga0268266_10018456 3300028379 Bacteria 5944
261 Ga0268265_10000010 3300028380 Bacteria 370129
262 Ga0268265_10050151 3300028380 Bacteria 3143
263 Ga0268264_10000053 3300028381 Bacteria 320368
264 Ga0268264_10107174 3300028381 Bacteria 2440
265 Ga0265327_10000021 3300031251 Bacteria 417788
266 Ga0265327_10002544 3300031251 Bacteria 18974
267 Ga0316578_10145139 3300031728 Bacteria 1429
268 Ga0307410_10077244 3300031852 Bacteria 2327
269 Ga0307409_100010079 3300031995 Bacteria 5848
270 Ga0307409_100342055 3300031995 Bacteria 1408
271 Ga0307416_100315446 3300032002 Bacteria 1562
272 Ga0307415_100045914 3300032126 Bacteria 2932
273 Ga0373937_0074524 3300036401 Bacteria 3132
274 Ga0316584_0021517 3300036712 Bacteria 4688
275 Ga0395900_0037901 3300037418 Bacteria 4970
276 Ga0395905_0506398 3300037471 Bacteria 1108
277 Ga0436364_0141110 3300037853 Bacteria 3590
278 Ga0436364_1270496 3300037853 Bacteria 1366
279 Ga0395901_0289230 3300038443 Bacteria 1701
280 Ga0395901_0368201 3300038443 Bacteria 1481
281 Ga0436365_0343744 3300039437 Bacteria 7674
282 Ga0436365_0644256 3300039437 Bacteria 38608
283 Ga0436365_0892314 3300039437 Bacteria 56989
284 Ga0436365_1083994 3300039437 Bacteria 225582
285 Ga0436365_1190653 3300039437 Bacteria 2430
286 Ga0436363_1015480 3300039450 Bacteria 15225
287 Ga0439466_0031473 3300041411 Bacteria 1814
288 Ga0439465_0006805 3300041413 Bacteria 3634
289 Ga0439465_0006816 3300041413 Bacteria 3632
290 Ga0439465_0009319 3300041413 Bacteria 3093
291 Ga0451793_1004691 3300041452 Bacteria 3324
292 Ga0451793_1218879 3300041452 Bacteria 6407
293 Ga0451795_1693408 3300041456 Bacteria 2506
294 Ga0451833_0124552 3300041491 Bacteria 7970
295 Ga0439448_0005026 3300042005 Bacteria 3759
296 Ga0450907_003160 3300042146 Bacteria 2981
297 Ga0466969_0102158 3300044656 Bacteria 1348
298 Ga0466972_0025730 3300044658 Bacteria 2915
299 Ga0466965_0003838 3300044683 Bacteria 6637
300 Ga0466965_0009910 3300044683 Bacteria 4432
301 Ga0466965_0011253 3300044683 Bacteria 4189
302 Ga0466965_0029927 3300044683 Bacteria 2651
303 Ga0466965_0047253 3300044683 Bacteria 2131
304 Ga0466966_0016952 3300044684 Bacteria 4815
305 Ga0466966_0080110 3300044684 Bacteria 2035
306 Ga0466966_0095560 3300044684 Bacteria 1841
307 Ga0466961_0005086 3300044693 Bacteria 8275
308 Ga0466961_0057327 3300044693 Bacteria 2480
309 Ga0466961_0068544 3300044693 Bacteria 2252
310 Ga0466963_0013252 3300044694 Bacteria 5060
311 Ga0466963_0033712 3300044694 Bacteria 3327
312 Ga0466963_0073522 3300044694 Bacteria 2305
313 Ga0466963_0142357 3300044694 Bacteria 1662
314 Ga0466963_0161836 3300044694 Bacteria 1558
315 Ga0466964_0034776 3300044706 Bacteria 2012
316 Ga0466964_0038784 3300044706 Bacteria 1917
317 Ga0466971_0004802 3300044719 Bacteria 5851
318 Ga0466971_0029334 3300044719 Bacteria 2460
319 Ga0466971_0086728 3300044719 Bacteria 1431
320 Ga0466968_0001663 3300044735 Bacteria 8019
321 Ga0466968_0004677 3300044735 Bacteria 5126
322 Ga0466968_0057387 3300044735 Bacteria 1674
323 Ga0466970_0003733 3300044765 Bacteria 7446
324 Ga0466970_0004587 3300044765 Bacteria 6819
325 Ga0466970_0037651 3300044765 Bacteria 2564
326 Ga0466970_0063665 3300044765 Bacteria 1977
327 Ga0466970_0067404 3300044765 Bacteria 1922
328 Ga0466970_0153070 3300044765 Bacteria 1274
329 Ga0466957_0002229 3300044842 Bacteria 10391
330 Ga0466957_0011090 3300044842 Bacteria 5188
331 Ga0466957_0018944 3300044842 Bacteria 4046
332 Ga0466957_0038385 3300044842 Bacteria 2885
333 Ga0466957_0049743 3300044842 Bacteria 2549
334 Ga0466957_0055938 3300044842 Bacteria 2411
335 Ga0466957_0211412 3300044842 Bacteria 1277
336 Ga0466960_0000358 3300044901 Bacteria 15617
337 Ga0466960_0001935 3300044901 Bacteria 7655
338 Ga0466960_0057682 3300044901 Bacteria 1894
339 Ga0466959_0006091 3300045049 Bacteria 8326
340 Ga0466959_0007649 3300045049 Bacteria 7598
341 Ga0466959_0029800 3300045049 Bacteria 4043
342 Ga0466959_0059458 3300045049 Bacteria 2783
343 Ga0466958_0014656 3300045836 Bacteria 4476
344 Ga0466967_0001630 3300045976 Bacteria 13239
345 Ga0466967_0001845 3300045976 Bacteria 12751
346 Ga0466967_0045247 3300045976 Bacteria 3823
347 Ga0466967_0107923 3300045976 Bacteria 2554
348 Ga0466967_0143339 3300045976 Bacteria 2227
349 Ga0466967_0195337 3300045976 Bacteria 1914
350 Ga0495638_0003957 3300046460 Bacteria 11421
351 Ga0495638_0023065 3300046460 Bacteria 4076
352 Ga0495580_0234794 3300046472 Bacteria 1258
353 Ga0495606_0023992 3300046507 Bacteria 4408
354 Ga0495608_0087401 3300046511 Bacteria 2019
355 Ga0495648_0002958 3300046524 Bacteria 15249
356 Ga0495640_0033449 3300046533 Bacteria 3651
357 Ga0495667_0017157 3300046559 Bacteria 4890
358 Ga0495668_0034488 3300046616 Bacteria 2838
359 Ga0495625_0093173 3300046660 Bacteria 2080
360 Ga0495623_0017739 3300046679 Bacteria 4598
361 Ga0495646_0194249 3300046680 Bacteria 1108
362 Ga0495624_0189436 3300046690 Bacteria 1251
363 Ga0495600_0112701 3300046809 Bacteria 1771
364 Ga0495581_0002594 3300047315 Bacteria 10271
365 Ga0495604_0026409 3300047317 Bacteria 4623
366 Ga0495672_0001719 3300047320 Bacteria 21197
367 Ga0495676_0135599 3300047321 Bacteria 1771
368 Ga0495680_0081576 3300047322 Bacteria 2441
369 Ga0495675_0105411 3300047444 Bacteria 1762
370 Ga0495673_0000872 3300047469 Bacteria 27846
371 Ga0495686_0000970 3300047472 Bacteria 35281
372 Ga0495593_0004693 3300047673 Bacteria 8127
373 Ga0496100_0000099 3300048903 Bacteria 49748
374 Ga0496100_0000896 3300048903 Bacteria 14217
375 Ga0496100_0009364 3300048903 Bacteria 5504
376 Ga0496100_0041994 3300048903 Bacteria 2918
377 Ga0496100_0126629 3300048903 Bacteria 1793
378 Ga0496100_0218300 3300048903 Bacteria 1398
379 Ga0496101_0000066 3300048904 Bacteria 122196
380 Ga0496101_0000074 3300048904 Bacteria 113105
381 Ga0496101_0003793 3300048904 Bacteria 9440
382 Ga0496101_0029018 3300048904 Bacteria 3868
383 Ga0496101_0043293 3300048904 Bacteria 3218
384 Ga0496102_0000070 3300048905 Bacteria 155087
385 Ga0496102_0000434 3300048905 Bacteria 48188
386 Ga0496102_0000938 3300048905 Bacteria 27521
387 Ga0496102_0019843 3300048905 Bacteria 5926
388 Ga0496102_0042195 3300048905 Bacteria 4134
389 Ga0496102_0436893 3300048905 Bacteria 1228
390 Ga0496102_0507501 3300048905 Bacteria 1128
391 Ga0496103_0000279 3300048906 Bacteria 48202
392 Ga0496103_0001307 3300048906 Bacteria 16933
393 Ga0496103_0001784 3300048906 Bacteria 14044
394 Ga0496103_0046760 3300048906 Bacteria 2673
395 Ga0496103_0049765 3300048906 Bacteria 2591
396 Ga0496103_0268627 3300048906 Bacteria 1097
397 Ga0496104_0005066 3300048907 Bacteria 11494
398 Ga0496104_0007153 3300048907 Bacteria 9837
399 Ga0496104_0042166 3300048907 Bacteria 4282
400 Ga0496104_0236096 3300048907 Bacteria 1740
401 Ga0496104_0290711 3300048907 Bacteria 1547
402 Ga0496105_0014110 3300048908 Bacteria 6358
403 Ga0496105_0014216 3300048908 Bacteria 6335
404 Ga0496106_0001034 3300048909 Bacteria 20471
405 Ga0496106_0003375 3300048909 Bacteria 11909
406 Ga0496106_0010302 3300048909 Bacteria 6912
407 Ga0496106_0018436 3300048909 Bacteria 5159
408 Ga0496106_0046233 3300048909 Bacteria 3271
409 Ga0496106_0048591 3300048909 Bacteria 3195
410 Ga0496107_0001357 3300048910 Bacteria 15061
411 Ga0496107_0001740 3300048910 Bacteria 13694
412 Ga0496107_0002250 3300048910 Bacteria 12441
413 Ga0496107_0018200 3300048910 Bacteria 4945
414 Ga0496107_0064372 3300048910 Bacteria 2658
415 Ga0496107_0153357 3300048910 Bacteria 1705
416 Ga0496108_0001607 3300048911 Bacteria 17902
417 Ga0496108_0015881 3300048911 Bacteria 6138
418 Ga0496109_0000820 3300048912 Bacteria 25931
419 Ga0496109_0001235 3300048912 Bacteria 21237
420 Ga0496110_0000374 3300048913 Bacteria 29938
421 Ga0496110_0035755 3300048913 Bacteria 4312
422 Ga0496111_0019512 3300048914 Bacteria 4711
423 Ga0496111_0116592 3300048914 Bacteria 1970
424 Ga0496111_0182563 3300048914 Bacteria 1560
425 Ga0496112_0016252 3300048915 Bacteria 6965
426 Ga0496112_0216263 3300048915 Bacteria 1873
427 Ga0496112_0341264 3300048915 Bacteria 1441
428 Ga0496113_0023843 3300048916 Bacteria 4343
429 Ga0496113_0174815 3300048916 Bacteria 1701
430 Ga0496113_0329949 3300048916 Bacteria 1223
431 Ga0496114_0000817 3300048917 Bacteria 23337
432 Ga0496114_0010356 3300048917 Bacteria 7419
433 Ga0496114_0010783 3300048917 Bacteria 7274
434 Ga0496115_0002053 3300048918 Bacteria 14415
435 Ga0496115_0005716 3300048918 Bacteria 9053
436 Ga0496115_0143204 3300048918 Bacteria 1972
437 Ga0496115_0470548 3300048918 Bacteria 1013
438 Ga0496116_0000595 3300048919 Bacteria 48079
439 Ga0496116_0003820 3300048919 Bacteria 14715
440 Ga0496116_0004212 3300048919 Bacteria 13825
441 Ga0496117_0000233 3300048920 Bacteria 105282
442 Ga0496117_0000818 3300048920 Bacteria 48202
443 Ga0496117_0031094 3300048920 Bacteria 4083
444 Ga0496117_0031426 3300048920 Bacteria 4052
445 Ga0496118_0000860 3300048921 Bacteria 48202
446 Ga0496118_0001917 3300048921 Bacteria 29593
447 Ga0496118_0058455 3300048921 Bacteria 2881
448 Ga0496119_0000321 3300048922 Bacteria 67218
449 Ga0496119_0004421 3300048922 Bacteria 14008
450 Ga0496119_0006722 3300048922 Bacteria 10568
451 Ga0496120_0000787 3300048923 Bacteria 45736
452 Ga0496120_0035402 3300048923 Bacteria 2982
453 Ga0496121_0000014 3300048924 Bacteria 609379
454 Ga0496121_0000080 3300048924 Bacteria 230195
455 Ga0496121_0005073 3300048924 Bacteria 17179
456 Ga0496122_0000097 3300048925 Bacteria 199223
457 Ga0496123_0114649 3300048926 Bacteria 1531
458 Ga0496124_0000019 3300048927 Bacteria 436995
459 Ga0496124_0048160 3300048927 Bacteria 3644
460 Ga0496124_0078141 3300048927 Bacteria 2728
461 Ga0496124_0178802 3300048927 Bacteria 1635
462 Ga0496124_0197403 3300048927 Bacteria 1533
463 Ga0496125_0000014 3300048928 Bacteria 610124
464 Ga0496125_0007894 3300048928 Bacteria 11239
465 Ga0496125_0101589 3300048928 Bacteria 2116
466 Ga0496126_0000017 3300048929 Bacteria 610676
467 Ga0496126_0001999 3300048929 Bacteria 28832
468 Ga0496126_0012981 3300048929 Bacteria 8503
469 Ga0496126_0051399 3300048929 Bacteria 3751
470 Ga0496126_0090294 3300048929 Bacteria 2695
471 Ga0501031_0240692 3300049568 Bacteria 1176
472 Ga0501032_0012119 3300049569 Bacteria 6171
473 Ga0501032_0016224 3300049569 Bacteria 5240
474 Ga0501032_0059104 3300049569 Bacteria 2573
475 Ga0501033_0071078 3300049570 Bacteria 2557
476 Ga0501033_0081775 3300049570 Bacteria 2369
477 Ga0501034_0018095 3300049571 Bacteria 7231
478 Ga0501034_0048841 3300049571 Bacteria 4270
479 Ga0501034_0058952 3300049571 Bacteria 3857
480 Ga0501036_0017259 3300049572 Bacteria 6032
481 Ga0501036_0038725 3300049572 Bacteria 4036
482 Ga0501037_0001085 3300049573 Bacteria 20185
483 Ga0501037_0027883 3300049573 Bacteria 4173
484 Ga0501037_0163158 3300049573 Bacteria 1588
485 Ga0501038_0017627 3300049574 Bacteria 6452
486 Ga0501039_0001389 3300049575 Bacteria 17780
487 Ga0501041_0049601 3300049577 Bacteria 2557
488 Ga0501042_0027007 3300049578 Bacteria 4036
489 Ga0501043_0079446 3300049579 Bacteria 2577
490 Ga0501046_0000881 3300049580 Bacteria 29192
491 Ga0501047_0089669 3300049581 Bacteria 2952
492 Ga0501047_0104911 3300049581 Bacteria 2707
493 Ga0501047_0107645 3300049581 Bacteria 2669
494 Ga0501048_0299816 3300049582 Bacteria 1143
495 Ga0501068_0113835 3300049584 Bacteria 1684
496 Ga0501069_0182601 3300049585 Bacteria 1213
497 Ga0501070_0002960 3300049586 Bacteria 14793
498 Ga0501070_0003851 3300049586 Bacteria 12943
499 Ga0501070_0053440 3300049586 Bacteria 3351
500 Ga0501070_0143546 3300049586 Bacteria 1971
501 Ga0501073_0073762 3300049589 Bacteria 2376
502 Ga0501074_0142802 3300049590 Bacteria 1712
503 Ga0501080_0016903 3300049742 Bacteria 6739
504 Ga0501035_0000337 3300049822 Bacteria 54675
505 Ga0501035_0001176 3300049822 Bacteria 27261
506 Ga0501044_0000512 3300049823 Bacteria 47131
507 Ga0501044_0106742 3300049823 Bacteria 2812
508 Ga0501044_0172498 3300049823 Bacteria 2133
509 nmdc:mga03683_558_c1 3300050489 Bacteria 10707
510 nmdc:mga03n38_150767_c1 3300050490 Bacteria 1170
511 nmdc:mga03n38_3614_c1 3300050490 Bacteria 4995
512 nmdc:mga03n38_53676_c1 3300050490 Bacteria 1808
513 nmdc:mga03n38_61484_c1 3300050490 Bacteria 1711
514 nmdc:mga03n38_73277_c1 3300050490 Bacteria 1590
515 nmdc:mga03n38_77853_c1 3300050490 Bacteria 1551
516 nmdc:mga00v17_126340_c1 3300050491 Bacteria 1632
517 nmdc:mga00v17_13820_c1 3300050491 Bacteria 4490
518 nmdc:mga00v17_142355_c1 3300050491 Bacteria 1538
519 nmdc:mga00v17_186032_c1 3300050491 Bacteria 1341
520 nmdc:mga00v17_59489_c1 3300050491 Bacteria 2344
521 nmdc:mga00v17_9870_c1 3300050491 Bacteria 5190
522 nmdc:mga0yw44_101108_c1 3300050492 Bacteria 1837
523 nmdc:mga0yw44_31127_c1 3300050492 Bacteria 3100
524 nmdc:mga0yw44_327902_c1 3300050492 Bacteria 1029
525 nmdc:mga0yw44_3834_c1 3300050492 Bacteria 6755
526 nmdc:mga0yw44_6737_c1 3300050492 Bacteria 5580
527 nmdc:mga0yw44_74951_c1 3300050492 Bacteria 2109
528 nmdc:mga06z11_12199_c1 3300050494 Bacteria 3731
529 nmdc:mga06z11_124469_c1 3300050494 Bacteria 1441
530 nmdc:mga06z11_215153_c1 3300050494 Bacteria 1121
531 nmdc:mga06z11_286509_c1 3300050494 Bacteria 977
532 nmdc:mga06z11_37467_c1 3300050494 Bacteria 2401
533 nmdc:mga06z11_4890_c1 3300050494 Bacteria 5315
534 nmdc:mga06z11_68183_c1 3300050494 Bacteria 1875
535 nmdc:mga06z11_90178_c1 3300050494 Bacteria 1663
536 nmdc:mga04h51_1461_c1 3300050495 Bacteria 5470
537 nmdc:mga04h51_17455_c1 3300050495 Bacteria 2100
538 nmdc:mga07m45_163042_c1 3300050496 Bacteria 1294
539 nmdc:mga07m45_200760_c1 3300050496 Bacteria 1160
540 nmdc:mga07m45_20396_c1 3300050496 Bacteria 3600
541 nmdc:mga07m45_22366_c1 3300050496 Bacteria 3451
542 nmdc:mga07m45_5625_c1 3300050496 Bacteria 6259
543 nmdc:mga05p37_174640_c1 3300050507 Bacteria 2618
544 nmdc:mga06r32_16416_c1 3300050510 Bacteria 6748
545 nmdc:mga0sz30_22520_c1 3300050516 Bacteria 2558
546 nmdc:mga0sz30_5425_c1 3300050516 Bacteria 4679
547 Ga0500610_0012429 3300053079 Bacteria 3922
548 Ga0500635_0001350 3300053080 Bacteria 5877
549 Ga0495595_0032681 3300053084 Bacteria 2344
550 Ga0495619_0221258 3300053085 Bacteria 1311
551 Ga0500643_007130 3300053087 Bacteria 4571
552 Ga0500643_008732 3300053087 Bacteria 3951
553 Ga0500644_0000053 3300053088 Bacteria 69275
554 Ga0500556_0010652 3300053104 Bacteria 2704
555 Ga0500608_106555 3300053122 Bacteria 1291
556 Ga0500642_0039178 3300053130 Bacteria 2036
557 Ga0500652_006534 3300053131 Bacteria 3761
558 Ga0500658_0057040 3300053134 Bacteria 1613
559 Ga0500573_0007825 3300053140 Bacteria 5853
560 Ga0500604_0059360 3300053151 Bacteria 1198
561 Ga0500645_000006 3300053730 Bacteria 276677
562 Ga0500645_012341 3300053730 Bacteria 2763
563 Ga0466962_0006464 3300061719 Bacteria 5625
564 Ga0466962_0017351 3300061719 Bacteria 3466
565 Ga0466962_0042614 3300061719 Bacteria 2172
566 2643891212 2643221576 Bacteria 5214352
567 2643960260 2643221590 Bacteria 5214697
568 2644101928 2643221617 Bacteria 5139111
569 2644115151 2643221620 Bacteria 5134593
570 2644485558 2643221687 Bacteria 6500351
571 2738665397 2738541264 Bacteria 5935393
572 2738704403 2738541274 Bacteria 6909446
573 2738870113 2738541305 Bacteria 4910150
574 2739144531 2738541356 Bacteria 5935017
575 2739331114 2738543028 Bacteria 6917070
576 2812333523 2811994874 Bacteria 5367947
577 2902797989 2902792274 Bacteria 7270173
578 2902799491 2902799365 Bacteria 5419524
579 2902843355 2902837492 Bacteria 6697721
580 2939585568 2939582691 Bacteria 7088898
581 Ga0075369_10028663
582 JGI24746J21847_1012120
583 JGI24747J21853_1004997
584 JGI24743J22301_10034800
585 JGI24744J21845_10003208
586 JGI24742J22300_10015389
587 rootL2_10065193
588 Ga0055540_1000024
589 Ga0055540_1001436
590 Ga0055540_1001629
591 Ga0055540_1006954
592 Ga0070658_10017847
593 Ga0070676_10037414
594 Ga0070676_10189839
595 Ga0070690_100004021
596 Ga0068869_100134475
597 Ga0070680_100555905
598 Ga0070682_100075937
599 Ga0070682_100107874
600 Ga0070689_100093198
601 Ga0070691_10029109
602 Ga0070668_100005304
603 Ga0070669_100032804
604 Ga0070675_100051707
605 Ga0070674_100000574
606 Ga0070674_100020678
607 Ga0070674_100114317
608 Ga0070659_100005422
609 Ga0070659_100109916
610 Ga0070659_100148133
611 Ga0070667_100000075
612 Ga0070667_100000568
613 Ga0070667_100010725
614 Ga0070709_10003995
615 Ga0070709_10118432
616 Ga0070710_10004165
617 Ga0070710_10007809
618 Ga0070701_10006457
619 Ga0070711_100000116
620 Ga0070711_100015727
621 Ga0070705_100010248
622 Ga0070700_100000880
623 Ga0070694_100109913
624 Ga0070694_100137019
625 Ga0070678_100024764
626 Ga0070662_100043251
627 Ga0070662_100091374
628 Ga0068867_100000745
629 Ga0068853_100016371
630 Ga0070672_100042233
631 Ga0070696_100008742
632 Ga0070696_100090098
633 Ga0070693_100027230
634 Ga0070693_100080975
635 Ga0070665_100003826
636 Ga0070665_100009906
637 Ga0070665_100011758
638 Ga0070665_100049124
639 Ga0070704_100001170
640 Ga0070664_100018672
641 Ga0068854_100027881
642 Ga0070702_100030937
643 Ga0068852_100284267
644 Ga0068859_100000077
645 Ga0068859_100011843
646 Ga0068859_100503266
647 Ga0068866_10003067
648 Ga0068861_100031670
649 Ga0068863_100001808
650 Ga0068863_100050184
651 Ga0068858_100004271
652 Ga0068858_100013105
653 Ga0068858_100027318
654 Ga0068860_100000025
655 Ga0068860_100002961
656 Ga0068862_100000003
657 Ga0068862_100004932
658 Ga0068862_100196470
659 Ga0081455_10134699
660 Ga0081455_10157661
661 Ga0081455_10239978
662 Ga0081538_10113812
663 Ga0075365_10011556
664 Ga0075365_10016374
665 Ga0075365_10022655
666 Ga0075365_10023821
667 Ga0075365_10192534
668 Ga0075365_10245357
669 Ga0075368_10000981
670 Ga0075368_10001621
671 Ga0075368_10023642
672 Ga0075363_100000621
673 Ga0075363_100000747
674 Ga0075363_100002153
675 Ga0075363_100003630
676 Ga0075363_100019656
677 Ga0075363_100028710
678 Ga0075363_100098230
679 Ga0075364_10000083
680 Ga0075364_10006842
681 Ga0075364_10007205
682 Ga0075364_10007723
683 Ga0075364_10016696
684 Ga0075364_10017404
685 Ga0075364_10100644
686 Ga0075364_10150664
687 Ga0070715_10168071
688 Ga0070712_100001799
689 Ga0070712_100016565
690 Ga0075362_10020162
691 Ga0075367_10012667
692 Ga0075367_10015563
693 Ga0075367_10017337
694 Ga0075367_10034438
695 Ga0075367_10109964
696 Ga0075367_10143550
697 Ga0075367_10151152
698 Ga0075369_10000442
699 Ga0075369_10005567
700 Ga0075369_10018018
701 Ga0075369_10025989
702 Ga0097621_100044828
703 Ga0097621_100143209
704 Ga0097621_100434614
705 Ga0075370_10001390
706 Ga0075370_10007474
707 Ga0075370_10042259
708 Ga0075370_10075519
709 Ga0075370_10129079
710 Ga0068871_100084751
711 Ga0075428_100001851
712 Ga0075430_100173643
713 Ga0068865_100003056
714 Ga0097620_100000077
715 Ga0097620_100011844
716 Ga0097620_100503274
717 Ga0105245_10075694
718 Ga0105245_10261570
719 Ga0105247_10000010
720 Ga0105247_10002313
721 Ga0105247_10037008
722 Ga0105247_10236122
723 Ga0114129_10203476
724 Ga0105243_10005121
725 Ga0105243_10045678
726 Ga0105242_10000740
727 Ga0105248_10000078
728 Ga0105248_10006970
729 Ga0105248_10008276
730 Ga0105237_10001706
731 Ga0105237_10188604
732 Ga0105238_10600350
733 Ga0105249_10000010
734 Ga0105249_10018771
735 Ga0105249_10024197
736 Ga0105239_10011603
737 Ga0105239_10011949
738 Ga0105239_10160679
739 Ga0105239_10351284
740 Ga0157369_10123767
741 Ga0157378_10001255
742 Ga0163162_10018019
743 Ga0163162_10094633
744 Ga0157375_10001039
745 Ga0157375_10173300
746 Ga0163163_10547037
747 Ga0157380_10000278
748 Ga0157380_10233990
749 Ga0182008_10096878
750 Ga0157377_10009467
751 Ga0157377_10054769
752 Ga0157379_10115237
753 Ga0157376_10008320
754 Ga0163161_10014020
755 Ga0213876_10000669
756 Ga0213876_10001611
757 Ga0213876_10012123
758 Ga0213876_10012882
759 Ga0209673_1005504
760 Ga0209051_1000021
761 Ga0209051_1000890
762 Ga0209051_1000955
763 Ga0209051_1003492
764 Ga0209051_1051712
765 Ga0207692_10016938
766 Ga0207692_10028720
767 Ga0207642_10024738
768 Ga0207710_10000028
769 Ga0207710_10001290
770 Ga0207688_10000743
771 Ga0207647_10022714
772 Ga0207645_10117171
773 Ga0207705_10015930
774 Ga0207705_10317653
775 Ga0207671_10009718
776 Ga0207693_10000767
777 Ga0207693_10004588
778 Ga0207663_10007111
779 Ga0207663_10012178
780 Ga0207657_10169678
781 Ga0207649_10074754
782 Ga0207681_10002509
783 Ga0207681_10321967
784 Ga0207659_10086680
785 Ga0207687_10006446
786 Ga0207687_10043956
787 Ga0207700_10212949
788 Ga0207700_10283034
789 Ga0207644_10004218
790 Ga0207644_10088786
791 Ga0207690_10037638
792 Ga0207690_10124970
793 Ga0207690_10136768
794 Ga0207706_10001473
795 Ga0207706_10002995
796 Ga0207706_10116096
797 Ga0207686_10002695
798 Ga0207709_10038955
799 Ga0207669_10012106
800 Ga0207669_10238083
801 Ga0207704_10009035
802 Ga0207665_10003151
803 Ga0207665_10025542
804 Ga0207691_10038351
805 Ga0207691_10190017
806 Ga0207711_10000069
807 Ga0207711_10006148
808 Ga0207711_10008722
809 Ga0207689_10007397
810 Ga0207679_10011328
811 Ga0207712_10000016
812 Ga0207712_10017361
813 Ga0207712_10061757
814 Ga0207668_10000890
815 Ga0207640_10020635
816 Ga0207658_10001986
817 Ga0207658_10004292
818 Ga0207658_10012411
819 Ga0207658_10022404
820 Ga0207658_10023258
821 Ga0207677_10009122
822 Ga0207703_10031836
823 Ga0207703_10042499
824 Ga0207703_10166763
825 Ga0207639_10003677
826 Ga0207678_10053867
827 Ga0207708_10000742
828 Ga0207708_10001425
829 Ga0207641_10000962
830 Ga0207648_10000085
831 Ga0207675_100001558
832 Ga0207675_100016529
833 Ga0207675_100107534
834 Ga0207683_10000289
835 Ga0207683_10006265
836 Ga0207683_10265168
837 Ga0207698_10210586
838 Ga0209813_10100359
839 Ga0268266_10007205
840 Ga0268266_10018456
841 Ga0268265_10000010
842 Ga0268265_10050151
843 Ga0268264_10000053
844 Ga0268264_10107174
845 Ga0265327_10000021
846 Ga0265327_10002544
847 Ga0316578_10145139
848 Ga0307410_10077244
849 Ga0307409_100010079
850 Ga0307409_100342055
851 Ga0307416_100315446
852 Ga0307415_100045914
853 Ga0373937_0074524
854 Ga0316584_0021517
855 Ga0395900_0037901
856 Ga0395905_0506398
857 Ga0436364_0141110
858 Ga0436364_1270496
859 Ga0395901_0289230
860 Ga0395901_0368201
861 Ga0436365_0343744
862 Ga0436365_0644256
863 Ga0436365_0892314
864 Ga0436365_1083994
865 Ga0436365_1190653
866 Ga0436363_1015480
867 Ga0439466_0031473
868 Ga0439465_0006805
869 Ga0439465_0006816
870 Ga0439465_0009319
871 Ga0451793_1004691
872 Ga0451793_1218879
873 Ga0451795_1693408
874 Ga0451833_0124552
875 Ga0439448_0005026
876 Ga0450907_003160
877 Ga0466969_0102158
878 Ga0466972_0025730
879 Ga0466965_0003838
880 Ga0466965_0009910
881 Ga0466965_0011253
882 Ga0466965_0029927
883 Ga0466965_0047253
884 Ga0466966_0016952
885 Ga0466966_0080110
886 Ga0466966_0095560
887 Ga0466961_0005086
888 Ga0466961_0057327
889 Ga0466961_0068544
890 Ga0466963_0013252
891 Ga0466963_0033712
892 Ga0466963_0073522
893 Ga0466963_0142357
894 Ga0466963_0161836
895 Ga0466964_0034776
896 Ga0466964_0038784
897 Ga0466971_0004802
898 Ga0466971_0029334
899 Ga0466971_0086728
900 Ga0466968_0001663
901 Ga0466968_0004677
902 Ga0466968_0057387
903 Ga0466970_0003733
904 Ga0466970_0004587
905 Ga0466970_0037651
906 Ga0466970_0063665
907 Ga0466970_0067404
908 Ga0466970_0153070
909 Ga0466957_0002229
910 Ga0466957_0011090
911 Ga0466957_0018944
912 Ga0466957_0038385
913 Ga0466957_0049743
914 Ga0466957_0055938
915 Ga0466957_0211412
916 Ga0466960_0000358
917 Ga0466960_0001935
918 Ga0466960_0057682
919 Ga0466959_0006091
920 Ga0466959_0007649
921 Ga0466959_0029800
922 Ga0466959_0059458
923 Ga0466958_0014656
924 Ga0466967_0001630
925 Ga0466967_0001845
926 Ga0466967_0045247
927 Ga0466967_0107923
928 Ga0466967_0143339
929 Ga0466967_0195337
930 Ga0495638_0003957
931 Ga0495638_0023065
932 Ga0495580_0234794
933 Ga0495606_0023992
934 Ga0495608_0087401
935 Ga0495648_0002958
936 Ga0495640_0033449
937 Ga0495667_0017157
938 Ga0495668_0034488
939 Ga0495625_0093173
940 Ga0495623_0017739
941 Ga0495646_0194249
942 Ga0495624_0189436
943 Ga0495600_0112701
944 Ga0495581_0002594
945 Ga0495604_0026409
946 Ga0495672_0001719
947 Ga0495676_0135599
948 Ga0495680_0081576
949 Ga0495675_0105411
950 Ga0495673_0000872
951 Ga0495686_0000970
952 Ga0495593_0004693
953 Ga0496100_0000099
954 Ga0496100_0000896
955 Ga0496100_0009364
956 Ga0496100_0041994
957 Ga0496100_0126629
958 Ga0496100_0218300
959 Ga0496101_0000066
960 Ga0496101_0000074
961 Ga0496101_0003793
962 Ga0496101_0029018
963 Ga0496101_0043293
964 Ga0496102_0000070
965 Ga0496102_0000434
966 Ga0496102_0000938
967 Ga0496102_0019843
968 Ga0496102_0042195
969 Ga0496102_0436893
970 Ga0496102_0507501
971 Ga0496103_0000279
972 Ga0496103_0001307
973 Ga0496103_0001784
974 Ga0496103_0046760
975 Ga0496103_0049765
976 Ga0496103_0268627
977 Ga0496104_0005066
978 Ga0496104_0007153
979 Ga0496104_0042166
980 Ga0496104_0236096
981 Ga0496104_0290711
982 Ga0496105_0014110
983 Ga0496105_0014216
984 Ga0496106_0001034
985 Ga0496106_0003375
986 Ga0496106_0010302
987 Ga0496106_0018436
988 Ga0496106_0046233
989 Ga0496106_0048591
990 Ga0496107_0001357
991 Ga0496107_0001740
992 Ga0496107_0002250
993 Ga0496107_0018200
994 Ga0496107_0064372
995 Ga0496107_0153357
996 Ga0496108_0001607
997 Ga0496108_0015881
998 Ga0496109_0000820
999 Ga0496109_0001235
1000 Ga0496110_0000374
1001 Ga0496110_0035755
1002 Ga0496111_0019512
1003 Ga0496111_0116592
1004 Ga0496111_0182563
1005 Ga0496112_0016252
1006 Ga0496112_0216263
1007 Ga0496112_0341264
1008 Ga0496113_0023843
1009 Ga0496113_0174815
1010 Ga0496113_0329949
1011 Ga0496114_0000817
1012 Ga0496114_0010356
1013 Ga0496114_0010783
1014 Ga0496115_0002053
1015 Ga0496115_0005716
1016 Ga0496115_0143204
1017 Ga0496115_0470548
1018 Ga0496116_0000595
1019 Ga0496116_0003820
1020 Ga0496116_0004212
1021 Ga0496117_0000233
1022 Ga0496117_0000818
1023 Ga0496117_0031094
1024 Ga0496117_0031426
1025 Ga0496118_0000860
1026 Ga0496118_0001917
1027 Ga0496118_0058455
1028 Ga0496119_0000321
1029 Ga0496119_0004421
1030 Ga0496119_0006722
1031 Ga0496120_0000787
1032 Ga0496120_0035402
1033 Ga0496121_0000014
1034 Ga0496121_0000080
1035 Ga0496121_0005073
1036 Ga0496122_0000097
1037 Ga0496123_0114649
1038 Ga0496124_0000019
1039 Ga0496124_0048160
1040 Ga0496124_0078141
1041 Ga0496124_0178802
1042 Ga0496124_0197403
1043 Ga0496125_0000014
1044 Ga0496125_0007894
1045 Ga0496125_0101589
1046 Ga0496126_0000017
1047 Ga0496126_0001999
1048 Ga0496126_0012981
1049 Ga0496126_0051399
1050 Ga0496126_0090294
1051 Ga0501031_0240692
1052 Ga0501032_0012119
1053 Ga0501032_0016224
1054 Ga0501032_0059104
1055 Ga0501033_0071078
1056 Ga0501033_0081775
1057 Ga0501034_0018095
1058 Ga0501034_0048841
1059 Ga0501034_0058952
1060 Ga0501036_0017259
1061 Ga0501036_0038725
1062 Ga0501037_0001085
1063 Ga0501037_0027883
1064 Ga0501037_0163158
1065 Ga0501038_0017627
1066 Ga0501039_0001389
1067 Ga0501041_0049601
1068 Ga0501042_0027007
1069 Ga0501043_0079446
1070 Ga0501046_0000881
1071 Ga0501047_0089669
1072 Ga0501047_0104911
1073 Ga0501047_0107645
1074 Ga0501048_0299816
1075 Ga0501068_0113835
1076 Ga0501069_0182601
1077 Ga0501070_0002960
1078 Ga0501070_0003851
1079 Ga0501070_0053440
1080 Ga0501070_0143546
1081 Ga0501073_0073762
1082 Ga0501074_0142802
1083 Ga0501080_0016903
1084 Ga0501035_0000337
1085 Ga0501035_0001176
1086 Ga0501044_0000512
1087 Ga0501044_0106742
1088 Ga0501044_0172498
1089 nmdc:mga03683_558_c1
1090 nmdc:mga03n38_150767_c1
1091 nmdc:mga03n38_3614_c1
1092 nmdc:mga03n38_53676_c1
1093 nmdc:mga03n38_61484_c1
1094 nmdc:mga03n38_73277_c1
1095 nmdc:mga03n38_77853_c1
1096 nmdc:mga00v17_126340_c1
1097 nmdc:mga00v17_13820_c1
1098 nmdc:mga00v17_142355_c1
1099 nmdc:mga00v17_186032_c1
1100 nmdc:mga00v17_59489_c1
1101 nmdc:mga00v17_9870_c1
1102 nmdc:mga0yw44_101108_c1
1103 nmdc:mga0yw44_31127_c1
1104 nmdc:mga0yw44_327902_c1
1105 nmdc:mga0yw44_3834_c1
1106 nmdc:mga0yw44_6737_c1
1107 nmdc:mga0yw44_74951_c1
1108 nmdc:mga06z11_12199_c1
1109 nmdc:mga06z11_124469_c1
1110 nmdc:mga06z11_215153_c1
1111 nmdc:mga06z11_286509_c1
1112 nmdc:mga06z11_37467_c1
1113 nmdc:mga06z11_4890_c1
1114 nmdc:mga06z11_68183_c1
1115 nmdc:mga06z11_90178_c1
1116 nmdc:mga04h51_1461_c1
1117 nmdc:mga04h51_17455_c1
1118 nmdc:mga07m45_163042_c1
1119 nmdc:mga07m45_200760_c1
1120 nmdc:mga07m45_20396_c1
1121 nmdc:mga07m45_22366_c1
1122 nmdc:mga07m45_5625_c1
1123 nmdc:mga05p37_174640_c1
1124 nmdc:mga06r32_16416_c1
1125 nmdc:mga0sz30_22520_c1
1126 nmdc:mga0sz30_5425_c1
1127 Ga0500610_0012429
1128 Ga0500635_0001350
1129 Ga0495595_0032681
1130 Ga0495619_0221258
1131 Ga0500643_007130
1132 Ga0500643_008732
1133 Ga0500644_0000053
1134 Ga0500556_0010652
1135 Ga0500608_106555
1136 Ga0500642_0039178
1137 Ga0500652_006534
1138 Ga0500658_0057040
1139 Ga0500573_0007825
1140 Ga0500604_0059360
1141 Ga0500645_000006
1142 Ga0500645_012341
1143 Ga0466962_0006464
1144 Ga0466962_0017351
1145 Ga0466962_0042614
1146 2643891212
1147 2643960260
1148 2644101928
1149 2644115151
1150 2644485558
1151 2738665397
1152 2738704403
1153 2738870113
1154 2739144531
1155 2739331114
1156 2812333523
1157 2902797989
1158 2902799491
1159 2902843355
1160 2939585568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

88

318

0.85

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

69

182

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ie6-assembly2.cif.gz_C-2 crystal structure of a lactonase mutant in complex with substrate b 0.8962 86 129
5ie7-assembly2.cif.gz_C-2 crystal structure of a lactonase double mutant in complex with substrate b 0.802 26 129
3t4u-assembly1.cif.gz_A l29i mutation in an aryl esterase from pseudomonas fluorescens leads to unique peptide flip and increased activity 0.7934 12 299
3hi4-assembly2.cif.gz_D switching catalysis from hydrolysis to perhydrolysis in p. fluorescens esterase 0.7929 12 299
3hea-assembly1.cif.gz_A the l29p/l124i mutation of pseudomonas fluorescens esterase 0.7914 12 299
ID Description Score Start End Superfamily
af_O05293_11_294_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9538 11 293 3.40.50.1820
af_O05293_11_294_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9473 11 293 3.40.50.1820
af_D4A328_4_184_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8693 241 280 3.40.50.1820
af_I1KMX1_1_216_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8386 10 130 3.40.50.1820
af_Q8IL54_9_192_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8133 11 132 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A524L978-F1-model_v4 Alpha/beta fold hydrolase 0.9373 5 145 GO:0016787
AF-A0A0U1DQS0-F1-model_v4 prolyl aminopeptidase (EC 3.4.11.5) (Prolyl aminopeptidase) 0.9153 1 149 GO:0004177
GO:0005737
GO:0006508
AF-A0A0H3M5G5-F1-model_v4 Possible alternative RNA polymerase sigma factor sigI 0.8883 181 304 GO:0003677
GO:0006352
GO:0016987
AF-A0A6I1ZK49-F1-model_v4 Non-heme chloroperoxidase (EC 1.11.1.10) 0.8842 12 139 GO:0016020
GO:0016691
AF-A0A537ZXG8-F1-model_v4 Alpha/beta hydrolase 0.8817 20 139 GO:0016787

Map