F465922

General Info

Members Datasets Scaffolds Average Seq Length
580 232 1160 149

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100035811|Ga0068857_1000358112
Length 167
Sequence MLSLSKHEGLGLGMSRNRSPRGGGRISSRHARREDGPSQRQLRVGEMLRHALAQILSRSDIRDPELDGVSITITQVKPSPDMRYATVYCAPLGGRNTGPIIAALNRHKGFLRGEMGHMISTKFTPDLRFVEDQSFAEAEKIENLLKSPQVQRDLVASDDEEENDSNV

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
81 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
169 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
228 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
229 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
230 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0
Rhizoplane 0.86
Rhizosphere 94.48
Stem 0
Stem Tuber 0
Unclassified 17.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100035811 3300005577 Bacteria 4396
2 JGI25153J46596_10000414 3300003215 Bacteria 28088
3 rootH1_10193728 3300003323 Bacteria 1071
4 Ga0070658_11427342 3300005327 Unclassified 601
5 Ga0070676_10043633 3300005328 Bacteria 2607
6 Ga0070676_10105397 3300005328 Unclassified 1748
7 Ga0070676_10555630 3300005328 Bacteria 822
8 Ga0070683_100019721 3300005329 Bacteria 5992
9 Ga0070683_100036341 3300005329 Bacteria 4507
10 Ga0070683_100275076 3300005329 Bacteria 1602
11 Ga0070683_101058243 3300005329 Unclassified 779
12 Ga0070670_100289300 3300005331 Unclassified 1432
13 Ga0070670_100396400 3300005331 Bacteria 1218
14 Ga0070677_10194128 3300005333 Bacteria 975
15 Ga0068869_100064460 3300005334 Bacteria 2695
16 Ga0068869_100226940 3300005334 Bacteria 1482
17 Ga0068869_100298081 3300005334 Unclassified 1301
18 Ga0070666_10038656 3300005335 Bacteria 3177
19 Ga0070666_10560400 3300005335 Bacteria 832
20 Ga0070666_10981950 3300005335 Unclassified 626
21 Ga0070680_100069576 3300005336 Bacteria 2890
22 Ga0070680_100288913 3300005336 Bacteria 1390
23 Ga0070680_100924481 3300005336 Bacteria 753
24 Ga0070680_101440168 3300005336 Unclassified 596
25 Ga0068868_100027288 3300005338 Bacteria 4356
26 Ga0068868_100107729 3300005338 Unclassified 2261
27 Ga0068868_100679712 3300005338 Bacteria 919
28 Ga0070660_100017981 3300005339 Bacteria 5158
29 Ga0070660_100057184 3300005339 Bacteria 3020
30 Ga0070660_100417830 3300005339 Bacteria 1110
31 Ga0070691_10000221 3300005341 Bacteria 19249
32 Ga0070675_100702946 3300005354 Bacteria 921
33 Ga0070671_101128229 3300005355 Unclassified 689
34 Ga0070671_101539415 3300005355 Unclassified 589
35 Ga0070674_100676820 3300005356 Bacteria 880
36 Ga0070673_100268659 3300005364 Bacteria 1492
37 Ga0070673_101050946 3300005364 Bacteria 759
38 Ga0070673_101259388 3300005364 Unclassified 694
39 Ga0070688_100589768 3300005365 Bacteria 849
40 Ga0070659_100472502 3300005366 Bacteria 1066
41 Ga0070667_101495470 3300005367 Bacteria 634
42 Ga0070709_10330654 3300005434 Bacteria 1121
43 Ga0070714_100058111 3300005435 Bacteria 3313
44 Ga0070714_100228303 3300005435 Bacteria 1714
45 Ga0070713_100000199 3300005436 Bacteria 40083
46 Ga0070713_100059249 3300005436 Bacteria 3197
47 Ga0070713_101051414 3300005436 Bacteria 786
48 Ga0070713_102309256 3300005436 Unclassified 521
49 Ga0070711_100028454 3300005439 Bacteria 3678
50 Ga0070678_100520882 3300005456 Bacteria 1052
51 Ga0070681_10060070 3300005458 Bacteria 3780
52 Ga0070681_10095917 3300005458 Bacteria 2914
53 Ga0070681_10760554 3300005458 Bacteria 885
54 Ga0070681_10790009 3300005458 Unclassified 866
55 Ga0068867_101362381 3300005459 Bacteria 657
56 Ga0070685_10229252 3300005466 Bacteria 1221
57 Ga0070699_100882386 3300005518 Bacteria 819
58 Ga0070679_100016543 3300005530 Bacteria 7119
59 Ga0070679_100039409 3300005530 Bacteria 4696
60 Ga0070679_100048839 3300005530 Bacteria 4215
61 Ga0070679_100089057 3300005530 Bacteria 3073
62 Ga0070684_100072692 3300005535 Bacteria 3028
63 Ga0070684_100383114 3300005535 Bacteria 1295
64 Ga0070684_101587764 3300005535 Bacteria 617
65 Ga0070697_100900768 3300005536 Unclassified 785
66 Ga0068853_100017815 3300005539 Bacteria 5866
67 Ga0068853_100187242 3300005539 Unclassified 1879
68 Ga0068853_100247246 3300005539 Bacteria 1636
69 Ga0068853_100644973 3300005539 Bacteria 1007
70 Ga0068853_100751616 3300005539 Bacteria 932
71 Ga0068853_101238254 3300005539 Unclassified 721
72 Ga0070695_100940607 3300005545 Bacteria 700
73 Ga0070696_101018462 3300005546 Unclassified 693
74 Ga0070693_100114735 3300005547 Unclassified 1663
75 Ga0070665_100000728 3300005548 Bacteria 43882
76 Ga0070665_100029750 3300005548 Bacteria 5496
77 Ga0070665_100042643 3300005548 Bacteria 4561
78 Ga0070665_100088187 3300005548 Bacteria 3108
79 Ga0070665_100253140 3300005548 Bacteria 1762
80 Ga0070665_100359243 3300005548 Unclassified 1462
81 Ga0068855_100000431 3300005563 Bacteria 51925
82 Ga0068855_100008435 3300005563 Bacteria 12464
83 Ga0068855_100019072 3300005563 Bacteria 8245
84 Ga0068855_100056139 3300005563 Bacteria 4622
85 Ga0068855_100188525 3300005563 Bacteria 2327
86 Ga0068855_100215598 3300005563 Bacteria 2155
87 Ga0068855_100262759 3300005563 Bacteria 1922
88 Ga0068855_100365332 3300005563 Unclassified 1587
89 Ga0068855_100457523 3300005563 Bacteria 1392
90 Ga0068855_100608989 3300005563 Unclassified 1177
91 Ga0068857_100043218 3300005577 Bacteria 3997
92 Ga0068857_100227828 3300005577 Bacteria 1704
93 Ga0068857_100256682 3300005577 Bacteria 1603
94 Ga0068857_100258385 3300005577 Unclassified 1598
95 Ga0068857_100299234 3300005577 Bacteria 1483
96 Ga0068857_100692795 3300005577 Unclassified 968
97 Ga0068857_101756534 3300005577 Unclassified 607
98 Ga0068854_100078830 3300005578 Bacteria 2427
99 Ga0068854_100137185 3300005578 Bacteria 1874
100 Ga0068856_100049115 3300005614 Bacteria 4158
101 Ga0068856_100057613 3300005614 Bacteria 3836
102 Ga0068856_100121004 3300005614 Bacteria 2619
103 Ga0068856_100171974 3300005614 Bacteria 2178
104 Ga0068856_100460646 3300005614 Bacteria 1292
105 Ga0068856_101533918 3300005614 Bacteria 680
106 Ga0068852_100040265 3300005616 Bacteria 3941
107 Ga0068852_100551543 3300005616 Bacteria 1153
108 Ga0068852_100700828 3300005616 Unclassified 1023
109 Ga0068859_100646405 3300005617 Bacteria 1150
110 Ga0068859_101806910 3300005617 Unclassified 675
111 Ga0068864_100047358 3300005618 Bacteria 3692
112 Ga0068864_100724800 3300005618 Unclassified 973
113 Ga0068864_101223925 3300005618 Unclassified 750
114 Ga0068866_10010715 3300005718 Bacteria 3940
115 Ga0068861_100953522 3300005719 Unclassified 816
116 Ga0068870_10168979 3300005840 Unclassified 1303
117 Ga0068858_100024068 3300005842 Bacteria 5675
118 Ga0068858_100068049 3300005842 Bacteria 3299
119 Ga0068858_100635443 3300005842 Bacteria 1037
120 Ga0068858_101619959 3300005842 Unclassified 639
121 Ga0068860_100390893 3300005843 Bacteria 1374
122 Ga0068860_101156214 3300005843 Unclassified 794
123 Ga0068860_101547961 3300005843 Unclassified 685
124 Ga0068862_100279344 3300005844 Bacteria 1530
125 Ga0068862_100650094 3300005844 Unclassified 1017
126 Ga0070712_100000069 3300006175 Bacteria 52912
127 Ga0070712_100001067 3300006175 Bacteria 16556
128 Ga0097621_100000555 3300006237 Bacteria 26237
129 Ga0097621_100017028 3300006237 Bacteria 5511
130 Ga0097621_100048364 3300006237 Bacteria 3450
131 Ga0097621_100196118 3300006237 Bacteria 1751
132 Ga0097621_100288044 3300006237 Unclassified 1447
133 Ga0097621_100485609 3300006237 Bacteria 1117
134 Ga0068871_100000785 3300006358 Bacteria 21375
135 Ga0068871_100026621 3300006358 Bacteria 4515
136 Ga0068871_100097970 3300006358 Bacteria 2452
137 Ga0068871_100143950 3300006358 Unclassified 2028
138 Ga0068871_100199313 3300006358 Bacteria 1727
139 Ga0068871_100254572 3300006358 Bacteria 1530
140 Ga0068871_100333349 3300006358 Bacteria 1338
141 Ga0068871_100484503 3300006358 Unclassified 1113
142 Ga0068871_100603042 3300006358 Bacteria 999
143 Ga0075434_100079320 3300006871 Bacteria 3279
144 Ga0075434_100082478 3300006871 Bacteria 3213
145 Ga0068865_100001556 3300006881 Bacteria 13404
146 Ga0068865_100533045 3300006881 Bacteria 983
147 Ga0075436_100006588 3300006914 Bacteria 7957
148 Ga0075436_100162976 3300006914 Bacteria 1572
149 Ga0097620_100646325 3300006931 Bacteria 1150
150 Ga0097620_101806507 3300006931 Unclassified 675
151 Ga0075435_100121913 3300007076 Bacteria 2176
152 Ga0105240_10003583 3300009093 Bacteria 24088
153 Ga0105240_10129943 3300009093 Bacteria 3022
154 Ga0105240_10170944 3300009093 Bacteria 2574
155 Ga0105240_10184021 3300009093 Bacteria 2463
156 Ga0105240_10360392 3300009093 Bacteria 1647
157 Ga0105240_10400751 3300009093 Unclassified 1545
158 Ga0105245_10175092 3300009098 Bacteria 2046
159 Ga0105247_10269910 3300009101 Bacteria 1170
160 Ga0105241_10101751 3300009174 Unclassified 2285
161 Ga0105241_10120549 3300009174 Bacteria 2111
162 Ga0105241_10259680 3300009174 Bacteria 1476
163 Ga0105241_10816015 3300009174 Unclassified 860
164 Ga0105241_11174551 3300009174 Bacteria 726
165 Ga0105241_11312795 3300009174 Bacteria 689
166 Ga0105241_11458130 3300009174 Bacteria 657
167 Ga0105241_11720921 3300009174 Unclassified 610
168 Ga0105241_11891816 3300009174 Bacteria 585
169 Ga0105242_10043648 3300009176 Bacteria 3627
170 Ga0105242_10704810 3300009176 Bacteria 988
171 Ga0105248_10027891 3300009177 Bacteria 6287
172 Ga0105248_10428966 3300009177 Bacteria 1489
173 Ga0105237_10014957 3300009545 Bacteria 8089
174 Ga0105237_10201419 3300009545 Bacteria 1991
175 Ga0105237_10235943 3300009545 Bacteria 1830
176 Ga0105237_10778664 3300009545 Bacteria 963
177 Ga0105237_11014684 3300009545 Bacteria 837
178 Ga0105237_11102632 3300009545 Unclassified 800
179 Ga0105237_11213858 3300009545 Bacteria 761
180 Ga0105237_11544846 3300009545 Unclassified 671
181 Ga0105238_10036451 3300009551 Bacteria 4999
182 Ga0105238_10048005 3300009551 Bacteria 4304
183 Ga0105238_10145480 3300009551 Bacteria 2347
184 Ga0105238_10315872 3300009551 Unclassified 1548
185 Ga0105238_10380886 3300009551 Bacteria 1402
186 Ga0105238_10431258 3300009551 Bacteria 1314
187 Ga0105238_10578725 3300009551 Bacteria 1129
188 Ga0105238_10799478 3300009551 Bacteria 959
189 Ga0105238_11774963 3300009551 Bacteria 649
190 Ga0105238_12431195 3300009551 Unclassified 559
191 Ga0105249_11028365 3300009553 Bacteria 893
192 Ga0105239_10061862 3300010375 Bacteria 4109
193 Ga0105239_10065043 3300010375 Bacteria 4004
194 Ga0105239_10671690 3300010375 Bacteria 1184
195 Ga0105239_10880365 3300010375 Bacteria 1028
196 Ga0105239_11149257 3300010375 Bacteria 894
197 Ga0105246_10094333 3300011119 Bacteria 2164
198 Ga0157370_10090442 3300013104 Bacteria 2874
199 Ga0157370_10215200 3300013104 Unclassified 1780
200 Ga0157370_11495705 3300013104 Unclassified 607
201 Ga0157369_10097500 3300013105 Bacteria 3136
202 Ga0157369_10789493 3300013105 Bacteria 976
203 Ga0157369_10892349 3300013105 Unclassified 912
204 Ga0157378_10174617 3300013297 Unclassified 2017
205 Ga0157378_10717117 3300013297 Bacteria 1021
206 Ga0163162_11278248 3300013306 Bacteria 833
207 Ga0157372_10005852 3300013307 Bacteria 13093
208 Ga0157372_10022120 3300013307 Bacteria 6878
209 Ga0157372_10119189 3300013307 Bacteria 3029
210 Ga0157372_10257070 3300013307 Bacteria 2028
211 Ga0157372_10466400 3300013307 Bacteria 1472
212 Ga0157375_10858460 3300013308 Bacteria 1054
213 Ga0163163_10000012 3300014325 Bacteria 257369
214 Ga0163163_10335155 3300014325 Bacteria 1568
215 Ga0157377_10213120 3300014745 Bacteria 1233
216 Ga0157379_10017595 3300014968 Bacteria 6292
217 Ga0157379_10019177 3300014968 Bacteria 6039
218 Ga0157379_10141045 3300014968 Bacteria 2172
219 Ga0163161_10045941 3300017792 Bacteria 3150
220 Ga0213873_10095005 3300021358 Bacteria 851
221 Ga0213874_10018422 3300021377 Bacteria 1886
222 Ga0213876_10000238 3300021384 Bacteria 52596
223 Ga0213876_10000876 3300021384 Bacteria 20130
224 Ga0209233_1003964 3300025261 Bacteria 5129
225 Ga0209758_1000008 3300025297 Bacteria 1215263
226 Ga0207642_10049551 3300025899 Bacteria 1889
227 Ga0207688_10030018 3300025901 Bacteria 2997
228 Ga0207680_10001097 3300025903 Bacteria 12764
229 Ga0207680_10021696 3300025903 Bacteria 3478
230 Ga0207680_10080923 3300025903 Bacteria 2040
231 Ga0207680_10215568 3300025903 Bacteria 1314
232 Ga0207647_10152523 3300025904 Bacteria 1350
233 Ga0207647_10283036 3300025904 Bacteria 946
234 Ga0207699_10000124 3300025906 Bacteria 54948
235 Ga0207699_10342968 3300025906 Bacteria 1053
236 Ga0207645_10082202 3300025907 Bacteria 2065
237 Ga0207645_10101480 3300025907 Bacteria 1857
238 Ga0207643_10133745 3300025908 Unclassified 1477
239 Ga0207705_10000503 3300025909 Bacteria 33230
240 Ga0207705_10046283 3300025909 Bacteria 3126
241 Ga0207654_10020731 3300025911 Bacteria 3490
242 Ga0207654_10072122 3300025911 Bacteria 2055
243 Ga0207654_10086317 3300025911 Unclassified 1902
244 Ga0207654_10137018 3300025911 Bacteria 1556
245 Ga0207654_10241603 3300025911 Bacteria 1207
246 Ga0207654_10297613 3300025911 Bacteria 1096
247 Ga0207654_10531875 3300025911 Unclassified 833
248 Ga0207707_10000656 3300025912 Bacteria 34258
249 Ga0207707_10079997 3300025912 Bacteria 2854
250 Ga0207707_10207019 3300025912 Bacteria 1709
251 Ga0207707_10379593 3300025912 Bacteria 1215
252 Ga0207707_10484150 3300025912 Unclassified 1057
253 Ga0207707_10514681 3300025912 Bacteria 1020
254 Ga0207695_10000012 3300025913 Bacteria 840961
255 Ga0207695_10053564 3300025913 Bacteria 4220
256 Ga0207695_10079310 3300025913 Bacteria 3328
257 Ga0207695_10124159 3300025913 Bacteria 2546
258 Ga0207695_10151230 3300025913 Bacteria 2260
259 Ga0207695_10205088 3300025913 Bacteria 1884
260 Ga0207695_10208659 3300025913 Bacteria 1865
261 Ga0207695_10306132 3300025913 Bacteria 1480
262 Ga0207695_10705257 3300025913 Unclassified 890
263 Ga0207695_11320121 3300025913 Unclassified 602
264 Ga0207671_10107858 3300025914 Bacteria 2116
265 Ga0207671_10127467 3300025914 Bacteria 1951
266 Ga0207671_10246780 3300025914 Bacteria 1403
267 Ga0207693_10006235 3300025915 Bacteria 9892
268 Ga0207693_10010804 3300025915 Bacteria 7412
269 Ga0207663_10035153 3300025916 Bacteria 3003
270 Ga0207663_10244650 3300025916 Unclassified 1317
271 Ga0207660_10000505 3300025917 Bacteria 26051
272 Ga0207660_10090336 3300025917 Bacteria 2269
273 Ga0207660_10142515 3300025917 Bacteria 1833
274 Ga0207657_10000446 3300025919 Bacteria 43822
275 Ga0207657_10010192 3300025919 Bacteria 9388
276 Ga0207657_10435387 3300025919 Bacteria 1030
277 Ga0207649_10336058 3300025920 Bacteria 1114
278 Ga0207649_10477266 3300025920 Unclassified 945
279 Ga0207652_10000645 3300025921 Bacteria 34472
280 Ga0207652_10005875 3300025921 Bacteria 9935
281 Ga0207652_10014859 3300025921 Bacteria 6313
282 Ga0207652_10039269 3300025921 Bacteria 4017
283 Ga0207652_10065456 3300025921 Bacteria 3148
284 Ga0207694_10000006 3300025924 Bacteria 631109
285 Ga0207694_10018797 3300025924 Bacteria 5223
286 Ga0207694_10113695 3300025924 Bacteria 2155
287 Ga0207694_10116239 3300025924 Bacteria 2132
288 Ga0207694_10122042 3300025924 Bacteria 2081
289 Ga0207694_10220391 3300025924 Unclassified 1547
290 Ga0207694_10731567 3300025924 Bacteria 835
291 Ga0207694_10928376 3300025924 Unclassified 736
292 Ga0207650_10074312 3300025925 Bacteria 2562
293 Ga0207650_10308998 3300025925 Unclassified 1293
294 Ga0207687_10030352 3300025927 Bacteria 3644
295 Ga0207687_10223950 3300025927 Bacteria 1482
296 Ga0207700_10000026 3300025928 Bacteria 139690
297 Ga0207664_10054513 3300025929 Bacteria 3169
298 Ga0207664_10329579 3300025929 Bacteria 1348
299 Ga0207664_11727974 3300025929 Bacteria 548
300 Ga0207644_11026605 3300025931 Unclassified 692
301 Ga0207690_10184878 3300025932 Bacteria 1572
302 Ga0207690_11434245 3300025932 Unclassified 577
303 Ga0207709_10009371 3300025935 Bacteria 5387
304 Ga0207709_11696538 3300025935 Unclassified 525
305 Ga0207669_11110683 3300025937 Bacteria 668
306 Ga0207704_10002683 3300025938 Bacteria 8026
307 Ga0207704_10556961 3300025938 Bacteria 932
308 Ga0207691_10508630 3300025940 Bacteria 1023
309 Ga0207711_10149061 3300025941 Bacteria 2110
310 Ga0207711_10385748 3300025941 Bacteria 1300
311 Ga0207711_10514827 3300025941 Bacteria 1115
312 Ga0207689_10035161 3300025942 Bacteria 4162
313 Ga0207689_10066153 3300025942 Bacteria 2973
314 Ga0207689_10089282 3300025942 Bacteria 2532
315 Ga0207661_10039973 3300025944 Bacteria 3685
316 Ga0207661_10176963 3300025944 Bacteria 1861
317 Ga0207667_10000232 3300025949 Bacteria 77277
318 Ga0207667_10036762 3300025949 Bacteria 5243
319 Ga0207667_10077663 3300025949 Bacteria 3443
320 Ga0207667_10163980 3300025949 Bacteria 2285
321 Ga0207667_10190924 3300025949 Bacteria 2102
322 Ga0207667_10271096 3300025949 Bacteria 1735
323 Ga0207667_10395366 3300025949 Bacteria 1407
324 Ga0207667_10424060 3300025949 Unclassified 1353
325 Ga0207667_10581557 3300025949 Unclassified 1130
326 Ga0207667_10698261 3300025949 Unclassified 1017
327 Ga0207667_10839972 3300025949 Bacteria 913
328 Ga0207651_10195016 3300025960 Bacteria 1618
329 Ga0207651_11494409 3300025960 Bacteria 608
330 Ga0207712_10036291 3300025961 Bacteria 3356
331 Ga0207712_10364637 3300025961 Bacteria 1205
332 Ga0207712_11007635 3300025961 Bacteria 739
333 Ga0207668_11187984 3300025972 Unclassified 685
334 Ga0207658_10058566 3300025986 Bacteria 2867
335 Ga0207677_10027899 3300026023 Bacteria 3564
336 Ga0207677_10261130 3300026023 Unclassified 1412
337 Ga0207677_10630369 3300026023 Bacteria 944
338 Ga0207703_10034742 3300026035 Bacteria 4002
339 Ga0207703_10164436 3300026035 Bacteria 1946
340 Ga0207703_10280825 3300026035 Bacteria 1512
341 Ga0207703_11063066 3300026035 Bacteria 777
342 Ga0207639_10031125 3300026041 Bacteria 3919
343 Ga0207639_10035298 3300026041 Bacteria 3699
344 Ga0207639_10187053 3300026041 Bacteria 1766
345 Ga0207639_10305619 3300026041 Bacteria 1407
346 Ga0207639_10444230 3300026041 Unclassified 1176
347 Ga0207639_10554664 3300026041 Unclassified 1055
348 Ga0207639_10614463 3300026041 Bacteria 1003
349 Ga0207639_10740886 3300026041 Bacteria 913
350 Ga0207678_10161700 3300026067 Bacteria 1912
351 Ga0207702_10000021 3300026078 Bacteria 196115
352 Ga0207702_10051688 3300026078 Bacteria 3475
353 Ga0207702_10092104 3300026078 Bacteria 2656
354 Ga0207702_10286208 3300026078 Bacteria 1560
355 Ga0207702_10907494 3300026078 Bacteria 873
356 Ga0207641_10016723 3300026088 Bacteria 6007
357 Ga0207641_10386322 3300026088 Bacteria 1342
358 Ga0207648_10005026 3300026089 Bacteria 13424
359 Ga0207648_10242225 3300026089 Bacteria 1606
360 Ga0207648_12071158 3300026089 Unclassified 530
361 Ga0207676_10069569 3300026095 Bacteria 2819
362 Ga0207676_10286434 3300026095 Bacteria 1498
363 Ga0207676_11264123 3300026095 Unclassified 732
364 Ga0207674_10021355 3300026116 Bacteria 6974
365 Ga0207674_10034755 3300026116 Bacteria 5266
366 Ga0207674_10217751 3300026116 Bacteria 1858
367 Ga0207674_10343244 3300026116 Unclassified 1444
368 Ga0207674_10412202 3300026116 Unclassified 1306
369 Ga0207674_10458084 3300026116 Unclassified 1233
370 Ga0207683_10040461 3300026121 Bacteria 4068
371 Ga0207683_10186525 3300026121 Bacteria 1882
372 Ga0207683_10383010 3300026121 Bacteria 1293
373 Ga0207683_11237543 3300026121 Bacteria 692
374 Ga0207698_10028069 3300026142 Bacteria 4007
375 Ga0207698_10092871 3300026142 Bacteria 2475
376 Ga0207698_10303754 3300026142 Bacteria 1487
377 Ga0207698_11840614 3300026142 Unclassified 620
378 Ga0268266_10000385 3300028379 Bacteria 67236
379 Ga0268266_10056365 3300028379 Bacteria 3381
380 Ga0268266_10059694 3300028379 Bacteria 3285
381 Ga0268266_10067090 3300028379 Bacteria 3104
382 Ga0268266_10155603 3300028379 Bacteria 2064
383 Ga0268266_10722142 3300028379 Bacteria 961
384 Ga0268265_10594974 3300028380 Bacteria 1056
385 Ga0268264_10274831 3300028381 Unclassified 1575
386 Ga0268264_11087866 3300028381 Unclassified 808
387 Ga0265318_10003447 3300028577 Bacteria 7938
388 Ga0265338_10003840 3300028800 Bacteria 20856
389 Ga0265338_10021227 3300028800 Bacteria 6782
390 Ga0265338_10048737 3300028800 Bacteria 3850
391 Ga0265330_10003911 3300031235 Bacteria 7661
392 Ga0265332_10138369 3300031238 Bacteria 1020
393 Ga0265320_10000034 3300031240 Bacteria 141117
394 Ga0265325_10000067 3300031241 Bacteria 72846
395 Ga0265325_10027745 3300031241 Bacteria 3058
396 Ga0265325_10052589 3300031241 Bacteria 2090
397 Ga0265329_10030438 3300031242 Bacteria 1759
398 Ga0265329_10073747 3300031242 Bacteria 1080
399 Ga0265340_10000433 3300031247 Bacteria 22516
400 Ga0265340_10020192 3300031247 Bacteria 3427
401 Ga0265340_10042303 3300031247 Bacteria 2237
402 Ga0265339_10002397 3300031249 Bacteria 13434
403 Ga0265339_10004682 3300031249 Bacteria 9286
404 Ga0265331_10002965 3300031250 Bacteria 11167
405 Ga0265331_10005968 3300031250 Bacteria 7273
406 Ga0265331_10114224 3300031250 Bacteria 1237
407 Ga0265316_10008995 3300031344 Bacteria 9211
408 Ga0265316_10022033 3300031344 Bacteria 5383
409 Ga0265316_10034163 3300031344 Bacteria 4133
410 Ga0265316_10121243 3300031344 Unclassified 1975
411 Ga0265316_10529159 3300031344 Bacteria 840
412 Ga0265313_10001732 3300031595 Bacteria 20073
413 Ga0265313_10002160 3300031595 Bacteria 17462
414 Ga0265313_10002736 3300031595 Bacteria 14894
415 Ga0265313_10028403 3300031595 Bacteria 2908
416 Ga0265313_10317059 3300031595 Bacteria 623
417 Ga0307508_10379701 3300031616 Bacteria 1004
418 Ga0265314_10010084 3300031711 Bacteria 7917
419 Ga0265314_10021416 3300031711 Bacteria 4970
420 Ga0265314_10066754 3300031711 Bacteria 2425
421 Ga0265314_10107012 3300031711 Bacteria 1785
422 Ga0265314_10110827 3300031711 Bacteria 1744
423 Ga0265314_10135026 3300031711 Unclassified 1533
424 Ga0265314_10458264 3300031711 Unclassified 678
425 Ga0265342_10009273 3300031712 Bacteria 6952
426 Ga0265342_10045243 3300031712 Bacteria 2650
427 Ga0265342_10204145 3300031712 Unclassified 1072
428 Ga0265342_10611652 3300031712 Bacteria 549
429 Ga0307516_10056907 3300031730 Bacteria 3811
430 Ga0316583_10177427 3300032133 Bacteria 741
431 Ga0373923_0456234 3300035111 Unclassified 620
432 Ga0373957_0050070 3300035120 Bacteria 1596
433 Ga0373931_0015740 3300035691 Bacteria 3712
434 Ga0373933_0219525 3300035724 Bacteria 1219
435 Ga0373937_0000477 3300036401 Bacteria 36794
436 Ga0373937_0320529 3300036401 Bacteria 1466
437 Ga0373925_0048834 3300037068 Bacteria 3154
438 Ga0395899_0813106 3300037312 Unclassified 576
439 Ga0395900_0067819 3300037418 Bacteria 3665
440 Ga0395900_0068022 3300037418 Bacteria 3660
441 Ga0395898_0011262 3300037466 Bacteria 9303
442 Ga0395898_0136968 3300037466 Bacteria 2344
443 Ga0436364_0016379 3300037853 Bacteria 592
444 Ga0395901_0130244 3300038443 Bacteria 2643
445 Ga0436365_0173471 3300039437 Bacteria 110650
446 Ga0436365_0371658 3300039437 Bacteria 1159
447 Ga0436365_1070125 3300039437 Bacteria 29375
448 Ga0436365_1079900 3300039437 Bacteria 15840
449 Ga0436360_1174122 3300039438 Bacteria 1009
450 Ga0436361_0353224 3300039447 Bacteria 809
451 Ga0436363_1436133 3300039450 Bacteria 4234
452 Ga0436363_1502905 3300039450 Bacteria 2297
453 Ga0436362_1272734 3300039453 Bacteria 2339
454 Ga0451833_1022335 3300041491 Unclassified 643
455 Ga0466967_1668662 3300045976 Unclassified 635
456 Ga0495629_0165706 3300046459 Bacteria 1535
457 Ga0495580_0505101 3300046472 Bacteria 807
458 Ga0495582_0060910 3300046473 Bacteria 2083
459 Ga0495585_0135095 3300046492 Bacteria 1295
460 Ga0495583_0099740 3300046506 Unclassified 1241
461 Ga0495606_0197705 3300046507 Unclassified 1148
462 Ga0495665_0208115 3300046531 Bacteria 1013
463 Ga0495586_0031063 3300046535 Bacteria 2859
464 Ga0495587_0042006 3300046536 Bacteria 2728
465 Ga0495609_0028059 3300046538 Bacteria 2570
466 Ga0495645_0508889 3300046543 Bacteria 752
467 Ga0495656_0454975 3300046615 Bacteria 675
468 Ga0495661_0346253 3300046665 Unclassified 733
469 Ga0495657_0160605 3300046675 Bacteria 1391
470 Ga0495657_0269687 3300046675 Bacteria 1021
471 Ga0495657_0588071 3300046675 Bacteria 645
472 Ga0495599_0682765 3300046678 Unclassified 593
473 Ga0495658_0804266 3300046683 Unclassified 602
474 Ga0495624_0555018 3300046690 Bacteria 686
475 Ga0495670_0044281 3300046691 Unclassified 2222
476 Ga0495589_0138219 3300046794 Bacteria 1168
477 Ga0495602_0245277 3300048088 Bacteria 1338
478 Ga0496102_0677599 3300048905 Unclassified 954
479 Ga0496104_1427131 3300048907 Bacteria 595
480 Ga0496106_0143632 3300048909 Bacteria 1878
481 Ga0496106_1138446 3300048909 Unclassified 610
482 Ga0496107_1179717 3300048910 Unclassified 551
483 Ga0496121_0003135 3300048924 Bacteria 23853
484 Ga0496126_0002681 3300048929 Bacteria 23520
485 Ga0496126_0072590 3300048929 Bacteria 3061
486 Ga0495682_0120474 3300049460 Bacteria 939
487 Ga0501031_0978068 3300049568 Unclassified 541
488 Ga0501032_0256318 3300049569 Bacteria 1135
489 Ga0501032_0686627 3300049569 Bacteria 649
490 Ga0501033_0007293 3300049570 Bacteria 8625
491 Ga0501033_0008682 3300049570 Bacteria 7860
492 Ga0501033_0019311 3300049570 Bacteria 5152
493 Ga0501033_0029250 3300049570 Bacteria 4140
494 Ga0501033_0073276 3300049570 Bacteria 2514
495 Ga0501033_0086625 3300049570 Bacteria 2293
496 Ga0501033_0102774 3300049570 Bacteria 2084
497 Ga0501034_0012904 3300049571 Bacteria 8617
498 Ga0501034_0023409 3300049571 Bacteria 6294
499 Ga0501034_0142000 3300049571 Bacteria 2380
500 Ga0501034_0303648 3300049571 Bacteria 1532
501 Ga0501034_0385822 3300049571 Unclassified 1325
502 Ga0501034_0915410 3300049571 Bacteria 764
503 Ga0501036_0268886 3300049572 Bacteria 1427
504 Ga0501036_0404131 3300049572 Bacteria 1139
505 Ga0501037_0034888 3300049573 Bacteria 3711
506 Ga0501038_0105287 3300049574 Bacteria 2343
507 Ga0501038_0160240 3300049574 Bacteria 1829
508 Ga0501038_0230301 3300049574 Bacteria 1475
509 Ga0501038_0749583 3300049574 Bacteria 728
510 Ga0501039_0499082 3300049575 Bacteria 955
511 Ga0501039_1035287 3300049575 Bacteria 637
512 Ga0501042_0446098 3300049578 Bacteria 938
513 Ga0501043_0066909 3300049579 Bacteria 2821
514 Ga0501043_0095137 3300049579 Bacteria 2341
515 Ga0501043_0182332 3300049579 Bacteria 1636
516 Ga0501046_0030942 3300049580 Bacteria 4343
517 Ga0501046_1033399 3300049580 Bacteria 569
518 Ga0501047_0004276 3300049581 Bacteria 13445
519 Ga0501047_0006677 3300049581 Bacteria 10845
520 Ga0501047_0012702 3300049581 Bacteria 7978
521 Ga0501047_0069035 3300049581 Bacteria 3404
522 Ga0501047_0124787 3300049581 Bacteria 2455
523 Ga0501047_0142537 3300049581 Bacteria 2274
524 Ga0501047_0212564 3300049581 Bacteria 1792
525 Ga0501047_0281663 3300049581 Bacteria 1507
526 Ga0501047_0431343 3300049581 Bacteria 1149
527 Ga0501047_0598066 3300049581 Bacteria 925
528 Ga0501048_0006442 3300049582 Bacteria 8922
529 Ga0501067_0003319 3300049583 Bacteria 8853
530 Ga0501068_0016254 3300049584 Bacteria 4289
531 Ga0501069_0002382 3300049585 Bacteria 9536
532 Ga0501070_0042799 3300049586 Bacteria 3771
533 Ga0501070_0107298 3300049586 Bacteria 2308
534 Ga0501070_0118000 3300049586 Bacteria 2192
535 Ga0501072_0275439 3300049588 Bacteria 1338
536 Ga0501072_0293623 3300049588 Bacteria 1292
537 Ga0501073_0006529 3300049589 Bacteria 8678
538 Ga0501073_0059220 3300049589 Bacteria 2676
539 Ga0501073_0158460 3300049589 Bacteria 1568
540 Ga0501073_0446506 3300049589 Bacteria 894
541 Ga0501073_0693905 3300049589 Bacteria 702
542 Ga0501074_0032851 3300049590 Bacteria 3759
543 Ga0501074_0091991 3300049590 Bacteria 2172
544 Ga0501074_0444897 3300049590 Bacteria 919
545 Ga0501079_0002116 3300049741 Bacteria 14274
546 Ga0501080_0029498 3300049742 Bacteria 5106
547 Ga0501080_0041312 3300049742 Bacteria 4298
548 Ga0501080_0413258 3300049742 Bacteria 1213
549 Ga0501083_0001758 3300049744 Bacteria 14790
550 Ga0501035_0013137 3300049822 Bacteria 7643
551 Ga0501035_0015714 3300049822 Bacteria 6986
552 Ga0501035_0054364 3300049822 Bacteria 3578
553 Ga0501035_0059850 3300049822 Bacteria 3392
554 Ga0501035_0227748 3300049822 Bacteria 1589
555 Ga0501035_0259530 3300049822 Bacteria 1473
556 Ga0501044_0006688 3300049823 Bacteria 12711
557 Ga0501044_0010747 3300049823 Bacteria 9934
558 Ga0501044_0026002 3300049823 Bacteria 6201
559 Ga0501044_0047597 3300049823 Bacteria 4435
560 Ga0501044_0079551 3300049823 Bacteria 3321
561 Ga0501044_0088210 3300049823 Bacteria 3132
562 Ga0501044_0198282 3300049823 Bacteria 1966
563 Ga0501044_0238004 3300049823 Bacteria 1765
564 Ga0501044_0954345 3300049823 Bacteria 730
565 Ga0501045_0514682 3300049824 Bacteria 888
566 nmdc:mga0n895_154786_c1 3300050512 Bacteria 2323
567 nmdc:mga0n895_59681_c1 3300050512 Bacteria 3763
568 nmdc:mga0rr50_8792_c1 3300050513 Bacteria 6302
569 nmdc:mga08x19_31250_c1 3300050514 Bacteria 3349
570 nmdc:mga08x19_54_c1 3300050514 Bacteria 121662
571 Ga0500635_0015083 3300053080 Bacteria 2277
572 Ga0500595_000508 3300053119 Bacteria 23460
573 Ga0500595_019273 3300053119 Bacteria 2479
574 Ga0500595_021189 3300053119 Bacteria 2324
575 Ga0500595_199131 3300053119 Unclassified 553
576 Ga0500614_134042 3300053123 Bacteria 737
577 Ga0500568_0174320 3300053139 Unclassified 791
578 Ga0501084_0009040 3300054114 Bacteria 8244
579 Ga0501084_0098035 3300054114 Bacteria 2461
580 Ga0501082_0007259 3300060353 Bacteria 9559
581 Ga0068857_100035811
582 JGI25153J46596_10000414
583 rootH1_10193728
584 Ga0070658_11427342
585 Ga0070676_10043633
586 Ga0070676_10105397
587 Ga0070676_10555630
588 Ga0070683_100019721
589 Ga0070683_100036341
590 Ga0070683_100275076
591 Ga0070683_101058243
592 Ga0070670_100289300
593 Ga0070670_100396400
594 Ga0070677_10194128
595 Ga0068869_100064460
596 Ga0068869_100226940
597 Ga0068869_100298081
598 Ga0070666_10038656
599 Ga0070666_10560400
600 Ga0070666_10981950
601 Ga0070680_100069576
602 Ga0070680_100288913
603 Ga0070680_100924481
604 Ga0070680_101440168
605 Ga0068868_100027288
606 Ga0068868_100107729
607 Ga0068868_100679712
608 Ga0070660_100017981
609 Ga0070660_100057184
610 Ga0070660_100417830
611 Ga0070691_10000221
612 Ga0070675_100702946
613 Ga0070671_101128229
614 Ga0070671_101539415
615 Ga0070674_100676820
616 Ga0070673_100268659
617 Ga0070673_101050946
618 Ga0070673_101259388
619 Ga0070688_100589768
620 Ga0070659_100472502
621 Ga0070667_101495470
622 Ga0070709_10330654
623 Ga0070714_100058111
624 Ga0070714_100228303
625 Ga0070713_100000199
626 Ga0070713_100059249
627 Ga0070713_101051414
628 Ga0070713_102309256
629 Ga0070711_100028454
630 Ga0070678_100520882
631 Ga0070681_10060070
632 Ga0070681_10095917
633 Ga0070681_10760554
634 Ga0070681_10790009
635 Ga0068867_101362381
636 Ga0070685_10229252
637 Ga0070699_100882386
638 Ga0070679_100016543
639 Ga0070679_100039409
640 Ga0070679_100048839
641 Ga0070679_100089057
642 Ga0070684_100072692
643 Ga0070684_100383114
644 Ga0070684_101587764
645 Ga0070697_100900768
646 Ga0068853_100017815
647 Ga0068853_100187242
648 Ga0068853_100247246
649 Ga0068853_100644973
650 Ga0068853_100751616
651 Ga0068853_101238254
652 Ga0070695_100940607
653 Ga0070696_101018462
654 Ga0070693_100114735
655 Ga0070665_100000728
656 Ga0070665_100029750
657 Ga0070665_100042643
658 Ga0070665_100088187
659 Ga0070665_100253140
660 Ga0070665_100359243
661 Ga0068855_100000431
662 Ga0068855_100008435
663 Ga0068855_100019072
664 Ga0068855_100056139
665 Ga0068855_100188525
666 Ga0068855_100215598
667 Ga0068855_100262759
668 Ga0068855_100365332
669 Ga0068855_100457523
670 Ga0068855_100608989
671 Ga0068857_100043218
672 Ga0068857_100227828
673 Ga0068857_100256682
674 Ga0068857_100258385
675 Ga0068857_100299234
676 Ga0068857_100692795
677 Ga0068857_101756534
678 Ga0068854_100078830
679 Ga0068854_100137185
680 Ga0068856_100049115
681 Ga0068856_100057613
682 Ga0068856_100121004
683 Ga0068856_100171974
684 Ga0068856_100460646
685 Ga0068856_101533918
686 Ga0068852_100040265
687 Ga0068852_100551543
688 Ga0068852_100700828
689 Ga0068859_100646405
690 Ga0068859_101806910
691 Ga0068864_100047358
692 Ga0068864_100724800
693 Ga0068864_101223925
694 Ga0068866_10010715
695 Ga0068861_100953522
696 Ga0068870_10168979
697 Ga0068858_100024068
698 Ga0068858_100068049
699 Ga0068858_100635443
700 Ga0068858_101619959
701 Ga0068860_100390893
702 Ga0068860_101156214
703 Ga0068860_101547961
704 Ga0068862_100279344
705 Ga0068862_100650094
706 Ga0070712_100000069
707 Ga0070712_100001067
708 Ga0097621_100000555
709 Ga0097621_100017028
710 Ga0097621_100048364
711 Ga0097621_100196118
712 Ga0097621_100288044
713 Ga0097621_100485609
714 Ga0068871_100000785
715 Ga0068871_100026621
716 Ga0068871_100097970
717 Ga0068871_100143950
718 Ga0068871_100199313
719 Ga0068871_100254572
720 Ga0068871_100333349
721 Ga0068871_100484503
722 Ga0068871_100603042
723 Ga0075434_100079320
724 Ga0075434_100082478
725 Ga0068865_100001556
726 Ga0068865_100533045
727 Ga0075436_100006588
728 Ga0075436_100162976
729 Ga0097620_100646325
730 Ga0097620_101806507
731 Ga0075435_100121913
732 Ga0105240_10003583
733 Ga0105240_10129943
734 Ga0105240_10170944
735 Ga0105240_10184021
736 Ga0105240_10360392
737 Ga0105240_10400751
738 Ga0105245_10175092
739 Ga0105247_10269910
740 Ga0105241_10101751
741 Ga0105241_10120549
742 Ga0105241_10259680
743 Ga0105241_10816015
744 Ga0105241_11174551
745 Ga0105241_11312795
746 Ga0105241_11458130
747 Ga0105241_11720921
748 Ga0105241_11891816
749 Ga0105242_10043648
750 Ga0105242_10704810
751 Ga0105248_10027891
752 Ga0105248_10428966
753 Ga0105237_10014957
754 Ga0105237_10201419
755 Ga0105237_10235943
756 Ga0105237_10778664
757 Ga0105237_11014684
758 Ga0105237_11102632
759 Ga0105237_11213858
760 Ga0105237_11544846
761 Ga0105238_10036451
762 Ga0105238_10048005
763 Ga0105238_10145480
764 Ga0105238_10315872
765 Ga0105238_10380886
766 Ga0105238_10431258
767 Ga0105238_10578725
768 Ga0105238_10799478
769 Ga0105238_11774963
770 Ga0105238_12431195
771 Ga0105249_11028365
772 Ga0105239_10061862
773 Ga0105239_10065043
774 Ga0105239_10671690
775 Ga0105239_10880365
776 Ga0105239_11149257
777 Ga0105246_10094333
778 Ga0157370_10090442
779 Ga0157370_10215200
780 Ga0157370_11495705
781 Ga0157369_10097500
782 Ga0157369_10789493
783 Ga0157369_10892349
784 Ga0157378_10174617
785 Ga0157378_10717117
786 Ga0163162_11278248
787 Ga0157372_10005852
788 Ga0157372_10022120
789 Ga0157372_10119189
790 Ga0157372_10257070
791 Ga0157372_10466400
792 Ga0157375_10858460
793 Ga0163163_10000012
794 Ga0163163_10335155
795 Ga0157377_10213120
796 Ga0157379_10017595
797 Ga0157379_10019177
798 Ga0157379_10141045
799 Ga0163161_10045941
800 Ga0213873_10095005
801 Ga0213874_10018422
802 Ga0213876_10000238
803 Ga0213876_10000876
804 Ga0209233_1003964
805 Ga0209758_1000008
806 Ga0207642_10049551
807 Ga0207688_10030018
808 Ga0207680_10001097
809 Ga0207680_10021696
810 Ga0207680_10080923
811 Ga0207680_10215568
812 Ga0207647_10152523
813 Ga0207647_10283036
814 Ga0207699_10000124
815 Ga0207699_10342968
816 Ga0207645_10082202
817 Ga0207645_10101480
818 Ga0207643_10133745
819 Ga0207705_10000503
820 Ga0207705_10046283
821 Ga0207654_10020731
822 Ga0207654_10072122
823 Ga0207654_10086317
824 Ga0207654_10137018
825 Ga0207654_10241603
826 Ga0207654_10297613
827 Ga0207654_10531875
828 Ga0207707_10000656
829 Ga0207707_10079997
830 Ga0207707_10207019
831 Ga0207707_10379593
832 Ga0207707_10484150
833 Ga0207707_10514681
834 Ga0207695_10000012
835 Ga0207695_10053564
836 Ga0207695_10079310
837 Ga0207695_10124159
838 Ga0207695_10151230
839 Ga0207695_10205088
840 Ga0207695_10208659
841 Ga0207695_10306132
842 Ga0207695_10705257
843 Ga0207695_11320121
844 Ga0207671_10107858
845 Ga0207671_10127467
846 Ga0207671_10246780
847 Ga0207693_10006235
848 Ga0207693_10010804
849 Ga0207663_10035153
850 Ga0207663_10244650
851 Ga0207660_10000505
852 Ga0207660_10090336
853 Ga0207660_10142515
854 Ga0207657_10000446
855 Ga0207657_10010192
856 Ga0207657_10435387
857 Ga0207649_10336058
858 Ga0207649_10477266
859 Ga0207652_10000645
860 Ga0207652_10005875
861 Ga0207652_10014859
862 Ga0207652_10039269
863 Ga0207652_10065456
864 Ga0207694_10000006
865 Ga0207694_10018797
866 Ga0207694_10113695
867 Ga0207694_10116239
868 Ga0207694_10122042
869 Ga0207694_10220391
870 Ga0207694_10731567
871 Ga0207694_10928376
872 Ga0207650_10074312
873 Ga0207650_10308998
874 Ga0207687_10030352
875 Ga0207687_10223950
876 Ga0207700_10000026
877 Ga0207664_10054513
878 Ga0207664_10329579
879 Ga0207664_11727974
880 Ga0207644_11026605
881 Ga0207690_10184878
882 Ga0207690_11434245
883 Ga0207709_10009371
884 Ga0207709_11696538
885 Ga0207669_11110683
886 Ga0207704_10002683
887 Ga0207704_10556961
888 Ga0207691_10508630
889 Ga0207711_10149061
890 Ga0207711_10385748
891 Ga0207711_10514827
892 Ga0207689_10035161
893 Ga0207689_10066153
894 Ga0207689_10089282
895 Ga0207661_10039973
896 Ga0207661_10176963
897 Ga0207667_10000232
898 Ga0207667_10036762
899 Ga0207667_10077663
900 Ga0207667_10163980
901 Ga0207667_10190924
902 Ga0207667_10271096
903 Ga0207667_10395366
904 Ga0207667_10424060
905 Ga0207667_10581557
906 Ga0207667_10698261
907 Ga0207667_10839972
908 Ga0207651_10195016
909 Ga0207651_11494409
910 Ga0207712_10036291
911 Ga0207712_10364637
912 Ga0207712_11007635
913 Ga0207668_11187984
914 Ga0207658_10058566
915 Ga0207677_10027899
916 Ga0207677_10261130
917 Ga0207677_10630369
918 Ga0207703_10034742
919 Ga0207703_10164436
920 Ga0207703_10280825
921 Ga0207703_11063066
922 Ga0207639_10031125
923 Ga0207639_10035298
924 Ga0207639_10187053
925 Ga0207639_10305619
926 Ga0207639_10444230
927 Ga0207639_10554664
928 Ga0207639_10614463
929 Ga0207639_10740886
930 Ga0207678_10161700
931 Ga0207702_10000021
932 Ga0207702_10051688
933 Ga0207702_10092104
934 Ga0207702_10286208
935 Ga0207702_10907494
936 Ga0207641_10016723
937 Ga0207641_10386322
938 Ga0207648_10005026
939 Ga0207648_10242225
940 Ga0207648_12071158
941 Ga0207676_10069569
942 Ga0207676_10286434
943 Ga0207676_11264123
944 Ga0207674_10021355
945 Ga0207674_10034755
946 Ga0207674_10217751
947 Ga0207674_10343244
948 Ga0207674_10412202
949 Ga0207674_10458084
950 Ga0207683_10040461
951 Ga0207683_10186525
952 Ga0207683_10383010
953 Ga0207683_11237543
954 Ga0207698_10028069
955 Ga0207698_10092871
956 Ga0207698_10303754
957 Ga0207698_11840614
958 Ga0268266_10000385
959 Ga0268266_10056365
960 Ga0268266_10059694
961 Ga0268266_10067090
962 Ga0268266_10155603
963 Ga0268266_10722142
964 Ga0268265_10594974
965 Ga0268264_10274831
966 Ga0268264_11087866
967 Ga0265318_10003447
968 Ga0265338_10003840
969 Ga0265338_10021227
970 Ga0265338_10048737
971 Ga0265330_10003911
972 Ga0265332_10138369
973 Ga0265320_10000034
974 Ga0265325_10000067
975 Ga0265325_10027745
976 Ga0265325_10052589
977 Ga0265329_10030438
978 Ga0265329_10073747
979 Ga0265340_10000433
980 Ga0265340_10020192
981 Ga0265340_10042303
982 Ga0265339_10002397
983 Ga0265339_10004682
984 Ga0265331_10002965
985 Ga0265331_10005968
986 Ga0265331_10114224
987 Ga0265316_10008995
988 Ga0265316_10022033
989 Ga0265316_10034163
990 Ga0265316_10121243
991 Ga0265316_10529159
992 Ga0265313_10001732
993 Ga0265313_10002160
994 Ga0265313_10002736
995 Ga0265313_10028403
996 Ga0265313_10317059
997 Ga0307508_10379701
998 Ga0265314_10010084
999 Ga0265314_10021416
1000 Ga0265314_10066754
1001 Ga0265314_10107012
1002 Ga0265314_10110827
1003 Ga0265314_10135026
1004 Ga0265314_10458264
1005 Ga0265342_10009273
1006 Ga0265342_10045243
1007 Ga0265342_10204145
1008 Ga0265342_10611652
1009 Ga0307516_10056907
1010 Ga0316583_10177427
1011 Ga0373923_0456234
1012 Ga0373957_0050070
1013 Ga0373931_0015740
1014 Ga0373933_0219525
1015 Ga0373937_0000477
1016 Ga0373937_0320529
1017 Ga0373925_0048834
1018 Ga0395899_0813106
1019 Ga0395900_0067819
1020 Ga0395900_0068022
1021 Ga0395898_0011262
1022 Ga0395898_0136968
1023 Ga0436364_0016379
1024 Ga0395901_0130244
1025 Ga0436365_0173471
1026 Ga0436365_0371658
1027 Ga0436365_1070125
1028 Ga0436365_1079900
1029 Ga0436360_1174122
1030 Ga0436361_0353224
1031 Ga0436363_1436133
1032 Ga0436363_1502905
1033 Ga0436362_1272734
1034 Ga0451833_1022335
1035 Ga0466967_1668662
1036 Ga0495629_0165706
1037 Ga0495580_0505101
1038 Ga0495582_0060910
1039 Ga0495585_0135095
1040 Ga0495583_0099740
1041 Ga0495606_0197705
1042 Ga0495665_0208115
1043 Ga0495586_0031063
1044 Ga0495587_0042006
1045 Ga0495609_0028059
1046 Ga0495645_0508889
1047 Ga0495656_0454975
1048 Ga0495661_0346253
1049 Ga0495657_0160605
1050 Ga0495657_0269687
1051 Ga0495657_0588071
1052 Ga0495599_0682765
1053 Ga0495658_0804266
1054 Ga0495624_0555018
1055 Ga0495670_0044281
1056 Ga0495589_0138219
1057 Ga0495602_0245277
1058 Ga0496102_0677599
1059 Ga0496104_1427131
1060 Ga0496106_0143632
1061 Ga0496106_1138446
1062 Ga0496107_1179717
1063 Ga0496121_0003135
1064 Ga0496126_0002681
1065 Ga0496126_0072590
1066 Ga0495682_0120474
1067 Ga0501031_0978068
1068 Ga0501032_0256318
1069 Ga0501032_0686627
1070 Ga0501033_0007293
1071 Ga0501033_0008682
1072 Ga0501033_0019311
1073 Ga0501033_0029250
1074 Ga0501033_0073276
1075 Ga0501033_0086625
1076 Ga0501033_0102774
1077 Ga0501034_0012904
1078 Ga0501034_0023409
1079 Ga0501034_0142000
1080 Ga0501034_0303648
1081 Ga0501034_0385822
1082 Ga0501034_0915410
1083 Ga0501036_0268886
1084 Ga0501036_0404131
1085 Ga0501037_0034888
1086 Ga0501038_0105287
1087 Ga0501038_0160240
1088 Ga0501038_0230301
1089 Ga0501038_0749583
1090 Ga0501039_0499082
1091 Ga0501039_1035287
1092 Ga0501042_0446098
1093 Ga0501043_0066909
1094 Ga0501043_0095137
1095 Ga0501043_0182332
1096 Ga0501046_0030942
1097 Ga0501046_1033399
1098 Ga0501047_0004276
1099 Ga0501047_0006677
1100 Ga0501047_0012702
1101 Ga0501047_0069035
1102 Ga0501047_0124787
1103 Ga0501047_0142537
1104 Ga0501047_0212564
1105 Ga0501047_0281663
1106 Ga0501047_0431343
1107 Ga0501047_0598066
1108 Ga0501048_0006442
1109 Ga0501067_0003319
1110 Ga0501068_0016254
1111 Ga0501069_0002382
1112 Ga0501070_0042799
1113 Ga0501070_0107298
1114 Ga0501070_0118000
1115 Ga0501072_0275439
1116 Ga0501072_0293623
1117 Ga0501073_0006529
1118 Ga0501073_0059220
1119 Ga0501073_0158460
1120 Ga0501073_0446506
1121 Ga0501073_0693905
1122 Ga0501074_0032851
1123 Ga0501074_0091991
1124 Ga0501074_0444897
1125 Ga0501079_0002116
1126 Ga0501080_0029498
1127 Ga0501080_0041312
1128 Ga0501080_0413258
1129 Ga0501083_0001758
1130 Ga0501035_0013137
1131 Ga0501035_0015714
1132 Ga0501035_0054364
1133 Ga0501035_0059850
1134 Ga0501035_0227748
1135 Ga0501035_0259530
1136 Ga0501044_0006688
1137 Ga0501044_0010747
1138 Ga0501044_0026002
1139 Ga0501044_0047597
1140 Ga0501044_0079551
1141 Ga0501044_0088210
1142 Ga0501044_0198282
1143 Ga0501044_0238004
1144 Ga0501044_0954345
1145 Ga0501045_0514682
1146 nmdc:mga0n895_154786_c1
1147 nmdc:mga0n895_59681_c1
1148 nmdc:mga0rr50_8792_c1
1149 nmdc:mga08x19_31250_c1
1150 nmdc:mga08x19_54_c1
1151 Ga0500635_0015083
1152 Ga0500595_000508
1153 Ga0500595_019273
1154 Ga0500595_021189
1155 Ga0500595_199131
1156 Ga0500614_134042
1157 Ga0500568_0174320
1158 Ga0501084_0009040
1159 Ga0501084_0098035
1160 Ga0501082_0007259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02033

RBFA

Ribosome-binding factor A

40

145

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dyj-assembly1.cif.gz_A crystal structure of ribosome-binding factor a from thermus thermophilus hb8 0.8955 18 108
8bxa-assembly1.cif.gz_A crystal structure of ribosome binding factor a (rbfa) from s. aureus 0.8583 14 111
2dyj-assembly2.cif.gz_B crystal structure of ribosome-binding factor a from thermus thermophilus hb8 0.8469 18 108
7nav-assembly1.cif.gz_V bacterial 30s ribosomal subunit assembly complex state d (consensus refinement) 0.84 17 111
2dyj-assembly1.cif.gz_A crystal structure of ribosome-binding factor a from thermus thermophilus hb8 0.8321 18 108
ID Description Score Start End Superfamily
af_Q8SXX0_83_186_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8571 17 109 3.30.300.20
af_Q8IK05_65_185_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8488 17 121 3.30.300.20
af_Q8I516_410_512_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8471 17 107 3.30.300.20
2dyjB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8469 18 108 3.30.300.20
af_A0A0G2K1B0_81_186_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8362 17 109 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A437QP24-F1-model_v4 Ribosome-binding factor A 0.9787 12 131 GO:0005829
GO:0030490
GO:0043024
AF-A0A1M2YXV0-F1-model_v4 Ribosome-binding factor A 0.9676 11 133 GO:0005829
GO:0030490
GO:0043024
AF-A0A516H0D3-F1-model_v4 Ribosome-binding factor A 0.966 10 131 GO:0005829
GO:0030490
GO:0043024
AF-M5FHN4-F1-model_v4 Ribosome-binding factor A 0.9625 21 133 GO:0005829
GO:0030490
GO:0043024
AF-X6CJB4-F1-model_v4 Ribosome-binding factor A 0.9617 21 137 GO:0005829
GO:0030490
GO:0043024

Map