F465912

General Info

Members Datasets Scaffolds Average Seq Length
580 243 1160 121

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100410117|Ga0070708_1004101172
Length 131
Sequence MLNFFSPTLALLFQEAERGRLGQMAEQMGRAAANPDLSKFLVIGALLFIIGVAGVLTRRNIIVIFMSIELILNAANLNFIAFSRYLSQAGNPNAVAGQIFTVFIIIGLGIVIALYRNKETIWVDEIDLLKW

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
173 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
174 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
185 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
186 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
200 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
201 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
202 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
206 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
207 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
208 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
209 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
210 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
211 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
212 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
213 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
214 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
215 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
216 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
217 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
218 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
219 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
220 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
221 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
222 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
223 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
224 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
225 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
226 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
227 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
228 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
229 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
230 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
231 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
232 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.45
Rhizosphere 95
Stem 0
Stem Tuber 0
Unclassified 16.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100410117 3300005445 Bacteria 1278
2 SwRhRL2b_contig_2181746 2162886007 Bacteria 2403
3 JGI25406J46586_10035405 3300003203 Bacteria 1823
4 JGI25406J46586_10076870 3300003203 Bacteria 1032
5 Ga0065714_10064454 3300005288 Bacteria 72991
6 Ga0065704_10172521 3300005289 Bacteria 1283
7 Ga0065712_10000129 3300005290 Bacteria 72972
8 Ga0065712_10002232 3300005290 Bacteria 7856
9 Ga0065712_10154501 3300005290 Bacteria 1345
10 Ga0065712_10179845 3300005290 Bacteria 1187
11 Ga0065715_10026374 3300005293 Bacteria 3467
12 Ga0065715_10092191 3300005293 Bacteria 5272
13 Ga0065715_10099080 3300005293 Bacteria 3440
14 Ga0065715_10112557 3300005293 Bacteria 2525
15 Ga0065715_10129208 3300005293 Bacteria 2050
16 Ga0065715_10136530 3300005293 Bacteria 1920
17 Ga0065715_10162909 3300005293 Bacteria 1608
18 Ga0065715_10190908 3300005293 Bacteria 1416
19 Ga0065715_10673152 3300005293 Bacteria 667
20 Ga0065715_10839096 3300005293 Unclassified 596
21 Ga0065707_10203920 3300005295 Bacteria 1297
22 Ga0065707_10235401 3300005295 Bacteria 1174
23 Ga0065707_11041311 3300005295 Bacteria 520
24 Ga0070676_10356521 3300005328 Bacteria 1007
25 Ga0070676_11076476 3300005328 Bacteria 606
26 Ga0070690_100002026 3300005330 Bacteria 10798
27 Ga0070690_100350027 3300005330 Bacteria 1072
28 Ga0070690_100375410 3300005330 Unclassified 1038
29 Ga0070670_100085841 3300005331 Bacteria 2705
30 Ga0068869_100053451 3300005334 Unclassified 2937
31 Ga0068869_100249879 3300005334 Bacteria 1416
32 Ga0068869_100869615 3300005334 Bacteria 778
33 Ga0068869_100932118 3300005334 Bacteria 753
34 Ga0068869_101682752 3300005334 Unclassified 566
35 Ga0070666_10073051 3300005335 Bacteria 2336
36 Ga0070666_10301446 3300005335 Bacteria 1141
37 Ga0070680_100064390 3300005336 Bacteria 3005
38 Ga0070680_100762773 3300005336 Unclassified 833
39 Ga0070680_100985871 3300005336 Bacteria 728
40 Ga0070682_100006217 3300005337 Bacteria 6693
41 Ga0070682_100127539 3300005337 Bacteria 1717
42 Ga0068868_100072771 3300005338 Bacteria 2743
43 Ga0068868_100708908 3300005338 Bacteria 901
44 Ga0070660_101115519 3300005339 Unclassified 668
45 Ga0070689_100476907 3300005340 Bacteria 1065
46 Ga0070689_100756895 3300005340 Unclassified 852
47 Ga0070687_100144727 3300005343 Bacteria 1388
48 Ga0070687_100401770 3300005343 Bacteria 899
49 Ga0070687_100482830 3300005343 Bacteria 831
50 Ga0070687_100715531 3300005343 Bacteria 701
51 Ga0070692_10006611 3300005345 Bacteria 5044
52 Ga0070692_10080196 3300005345 Bacteria 1756
53 Ga0070668_100016547 3300005347 Bacteria 5513
54 Ga0070669_100003362 3300005353 Bacteria 11500
55 Ga0070669_100308566 3300005353 Bacteria 1274
56 Ga0070675_100223573 3300005354 Bacteria 1640
57 Ga0070675_100376576 3300005354 Bacteria 1263
58 Ga0070675_100394801 3300005354 Unclassified 1233
59 Ga0070675_100777636 3300005354 Bacteria 874
60 Ga0070671_100634057 3300005355 Unclassified 925
61 Ga0070674_100172546 3300005356 Bacteria 1650
62 Ga0070673_100004775 3300005364 Bacteria 8607
63 Ga0070673_100083302 3300005364 Unclassified 2598
64 Ga0070673_100118339 3300005364 Bacteria 2206
65 Ga0070673_100288883 3300005364 Bacteria 1440
66 Ga0070673_100312677 3300005364 Unclassified 1386
67 Ga0070688_100315592 3300005365 Bacteria 1134
68 Ga0070659_100509048 3300005366 Bacteria 1027
69 Ga0070667_100013522 3300005367 Bacteria 6744
70 Ga0070701_10086616 3300005438 Bacteria 1707
71 Ga0070701_10091192 3300005438 Bacteria 1670
72 Ga0070701_10248509 3300005438 Bacteria 1073
73 Ga0070701_10612062 3300005438 Unclassified 723
74 Ga0070705_100037251 3300005440 Bacteria 2742
75 Ga0070705_100173971 3300005440 Bacteria 1452
76 Ga0070705_100492368 3300005440 Bacteria 929
77 Ga0070705_101013606 3300005440 Bacteria 674
78 Ga0070700_100000569 3300005441 Bacteria 18502
79 Ga0070700_100026091 3300005441 Bacteria 3447
80 Ga0070700_100223363 3300005441 Bacteria 1336
81 Ga0070700_100328809 3300005441 Bacteria 1126
82 Ga0070694_100024590 3300005444 Bacteria 3889
83 Ga0070694_100069200 3300005444 Bacteria 2427
84 Ga0070694_100100974 3300005444 Bacteria 2041
85 Ga0070694_100270774 3300005444 Bacteria 1291
86 Ga0070694_100327015 3300005444 Unclassified 1181
87 Ga0070694_100394669 3300005444 Unclassified 1082
88 Ga0070708_100000088 3300005445 Bacteria 60447
89 Ga0070708_101349034 3300005445 Bacteria 666
90 Ga0070678_100494481 3300005456 Bacteria 1078
91 Ga0070662_100024966 3300005457 Bacteria 4123
92 Ga0070662_100506686 3300005457 Bacteria 1007
93 Ga0070681_10000362 3300005458 Bacteria 36657
94 Ga0070681_10023187 3300005458 Bacteria 6243
95 Ga0070681_10952374 3300005458 Bacteria 778
96 Ga0068867_100039184 3300005459 Bacteria 3454
97 Ga0068867_100046388 3300005459 Bacteria 3192
98 Ga0068867_100097312 3300005459 Unclassified 2242
99 Ga0068867_100171181 3300005459 Bacteria 1720
100 Ga0068867_100279285 3300005459 Bacteria 1369
101 Ga0070685_11064618 3300005466 Bacteria 610
102 Ga0070706_100000044 3300005467 Bacteria 146303
103 Ga0070706_100034585 3300005467 Bacteria 4668
104 Ga0070706_100201206 3300005467 Bacteria 1860
105 Ga0070707_100044225 3300005468 Bacteria 4263
106 Ga0070707_100377943 3300005468 Bacteria 1376
107 Ga0070698_100070085 3300005471 Bacteria 3518
108 Ga0070698_100736120 3300005471 Unclassified 929
109 Ga0070699_100003368 3300005518 Bacteria 14140
110 Ga0070699_100028207 3300005518 Bacteria 4842
111 Ga0070679_100000540 3300005530 Bacteria 32202
112 Ga0070684_100653203 3300005535 Bacteria 979
113 Ga0070697_100001170 3300005536 Bacteria 19918
114 Ga0070697_100021957 3300005536 Bacteria 5063
115 Ga0070697_100103453 3300005536 Bacteria 2367
116 Ga0070697_100556390 3300005536 Unclassified 1006
117 Ga0068853_100604814 3300005539 Bacteria 1041
118 Ga0070672_100491225 3300005543 Bacteria 1061
119 Ga0070686_100012945 3300005544 Bacteria 4763
120 Ga0070686_100294036 3300005544 Bacteria 1202
121 Ga0070686_100451638 3300005544 Bacteria 988
122 Ga0070695_100028678 3300005545 Bacteria 3455
123 Ga0070695_100088542 3300005545 Bacteria 2062
124 Ga0070695_100290657 3300005545 Bacteria 1204
125 Ga0070696_100039730 3300005546 Bacteria 3249
126 Ga0070696_100143746 3300005546 Bacteria 1746
127 Ga0070696_100144115 3300005546 Unclassified 1744
128 Ga0070696_100207026 3300005546 Bacteria 1467
129 Ga0070696_100305483 3300005546 Bacteria 1220
130 Ga0070696_100485609 3300005546 Bacteria 980
131 Ga0070696_100672054 3300005546 Bacteria 842
132 Ga0070696_101804083 3300005546 Unclassified 529
133 Ga0070693_100033935 3300005547 Bacteria 2820
134 Ga0070693_100134067 3300005547 Bacteria 1552
135 Ga0070693_100210996 3300005547 Bacteria 1267
136 Ga0070693_100326635 3300005547 Bacteria 1043
137 Ga0070693_100504692 3300005547 Bacteria 859
138 Ga0070693_100742149 3300005547 Bacteria 723
139 Ga0070665_100382436 3300005548 Bacteria 1415
140 Ga0070665_101055142 3300005548 Unclassified 824
141 Ga0070704_100041904 3300005549 Bacteria 3163
142 Ga0070704_100054659 3300005549 Bacteria 2826
143 Ga0070704_100306310 3300005549 Bacteria 1325
144 Ga0070704_101064707 3300005549 Bacteria 734
145 Ga0070664_100163148 3300005564 Bacteria 1973
146 Ga0070664_100222650 3300005564 Bacteria 1688
147 Ga0070664_100248625 3300005564 Bacteria 1598
148 Ga0068854_100093737 3300005578 Bacteria 2239
149 Ga0068854_100255941 3300005578 Bacteria 1400
150 Ga0068854_101046950 3300005578 Bacteria 725
151 Ga0068854_101461602 3300005578 Bacteria 619
152 Ga0068856_101746397 3300005614 Bacteria 634
153 Ga0070702_100027052 3300005615 Bacteria 3090
154 Ga0070702_100313102 3300005615 Bacteria 1091
155 Ga0070702_100529064 3300005615 Bacteria 871
156 Ga0070702_100658897 3300005615 Bacteria 793
157 Ga0068852_100197824 3300005616 Bacteria 1900
158 Ga0068852_100398849 3300005616 Bacteria 1353
159 Ga0068852_100792368 3300005616 Unclassified 961
160 Ga0068852_101692325 3300005616 Bacteria 655
161 Ga0068859_100024046 3300005617 Bacteria 6114
162 Ga0068859_100143985 3300005617 Bacteria 2457
163 Ga0068859_100307905 3300005617 Bacteria 1678
164 Ga0068859_100403454 3300005617 Bacteria 1463
165 Ga0068859_100403716 3300005617 Bacteria 1462
166 Ga0068859_100497988 3300005617 Unclassified 1314
167 Ga0068859_101361699 3300005617 Bacteria 782
168 Ga0068864_100004529 3300005618 Bacteria 11410
169 Ga0068864_100399485 3300005618 Bacteria 1306
170 Ga0068864_100433393 3300005618 Bacteria 1254
171 Ga0068864_100567260 3300005618 Bacteria 1099
172 Ga0068864_100770564 3300005618 Unclassified 944
173 Ga0068864_100775973 3300005618 Bacteria 941
174 Ga0068866_11079247 3300005718 Bacteria 574
175 Ga0068861_100001904 3300005719 Bacteria 13437
176 Ga0068861_100144510 3300005719 Bacteria 1945
177 Ga0068861_100154530 3300005719 Bacteria 1886
178 Ga0068861_100241449 3300005719 Bacteria 1537
179 Ga0068861_100514888 3300005719 Bacteria 1084
180 Ga0068861_101236915 3300005719 Bacteria 723
181 Ga0068861_101332570 3300005719 Bacteria 699
182 Ga0068851_10008515 3300005834 Bacteria 4746
183 Ga0068870_10703847 3300005840 Bacteria 697
184 Ga0068863_100465714 3300005841 Bacteria 1241
185 Ga0068858_100080481 3300005842 Bacteria 3027
186 Ga0068858_100082508 3300005842 Bacteria 2988
187 Ga0068858_100134597 3300005842 Bacteria 2318
188 Ga0068858_101288422 3300005842 Bacteria 719
189 Ga0068860_100210396 3300005843 Bacteria 1886
190 Ga0068860_100339335 3300005843 Bacteria 1477
191 Ga0068860_100583719 3300005843 Bacteria 1122
192 Ga0068862_100033971 3300005844 Bacteria 4314
193 Ga0068862_100099617 3300005844 Bacteria 2540
194 Ga0068862_100314937 3300005844 Bacteria 1443
195 Ga0068862_100783545 3300005844 Bacteria 930
196 Ga0068862_101002504 3300005844 Bacteria 826
197 Ga0081540_1173862 3300005983 Unclassified 816
198 Ga0081539_10002342 3300005985 Bacteria 27236
199 Ga0081539_10004393 3300005985 Bacteria 15647
200 Ga0081539_10070859 3300005985 Unclassified 1870
201 Ga0081539_10075533 3300005985 Bacteria 1789
202 Ga0070716_100331794 3300006173 Bacteria 1070
203 Ga0070716_100450948 3300006173 Bacteria 938
204 Ga0097621_100017592 3300006237 Bacteria 5432
205 Ga0068871_100001909 3300006358 Bacteria 14090
206 Ga0068871_100036283 3300006358 Bacteria 3924
207 Ga0068871_100197082 3300006358 Bacteria 1737
208 Ga0075430_100055130 3300006846 Bacteria 3343
209 Ga0075430_100621207 3300006846 Bacteria 891
210 Ga0075433_10033574 3300006852 Bacteria 4400
211 Ga0075433_10043971 3300006852 Bacteria 3879
212 Ga0075433_10051339 3300006852 Bacteria 3591
213 Ga0075433_10181208 3300006852 Bacteria 1874
214 Ga0075433_10247838 3300006852 Bacteria 1581
215 Ga0075434_100441479 3300006871 Unclassified 1323
216 Ga0075434_100615594 3300006871 Bacteria 1105
217 Ga0075434_100887781 3300006871 Unclassified 906
218 Ga0075434_101126640 3300006871 Bacteria 798
219 Ga0075434_101933465 3300006871 Unclassified 596
220 Ga0097620_100024045 3300006931 Bacteria 6114
221 Ga0097620_100143985 3300006931 Bacteria 2457
222 Ga0097620_100184841 3300006931 Bacteria 2168
223 Ga0097620_100307904 3300006931 Bacteria 1678
224 Ga0097620_100403451 3300006931 Bacteria 1463
225 Ga0097620_100403742 3300006931 Bacteria 1462
226 Ga0097620_100497952 3300006931 Unclassified 1314
227 Ga0097620_101361757 3300006931 Bacteria 782
228 Ga0075435_100016172 3300007076 Bacteria 5622
229 Ga0075435_100132520 3300007076 Bacteria 2086
230 Ga0105251_10161360 3300009011 Bacteria 1010
231 Ga0105251_10342400 3300009011 Bacteria 682
232 Ga0105250_10573889 3300009092 Unclassified 520
233 Ga0105240_10300065 3300009093 Bacteria 1838
234 Ga0105240_11258340 3300009093 Unclassified 782
235 Ga0111539_10001823 3300009094 Bacteria 28370
236 Ga0111539_11353795 3300009094 Bacteria 826
237 Ga0105245_10107553 3300009098 Bacteria 2589
238 Ga0105245_10818839 3300009098 Bacteria 970
239 Ga0105245_10977711 3300009098 Unclassified 890
240 Ga0105247_10123280 3300009101 Bacteria 1681
241 Ga0105247_10137278 3300009101 Bacteria 1599
242 Ga0105247_10144514 3300009101 Bacteria 1562
243 Ga0105247_10658241 3300009101 Bacteria 783
244 Ga0114129_10064807 3300009147 Bacteria 5100
245 Ga0114129_10069702 3300009147 Bacteria 4901
246 Ga0114129_10278498 3300009147 Bacteria 2235
247 Ga0114129_10700387 3300009147 Bacteria 1302
248 Ga0114129_10963610 3300009147 Unclassified 1077
249 Ga0114129_11504096 3300009147 Unclassified 827
250 Ga0105243_10011430 3300009148 Bacteria 6719
251 Ga0105243_10322980 3300009148 Bacteria 1407
252 Ga0105243_10407347 3300009148 Unclassified 1265
253 Ga0105243_10733494 3300009148 Bacteria 967
254 Ga0105241_10035070 3300009174 Bacteria 3773
255 Ga0105241_10063614 3300009174 Bacteria 2847
256 Ga0105241_10266175 3300009174 Bacteria 1458
257 Ga0105241_10397042 3300009174 Bacteria 1208
258 Ga0105241_11641976 3300009174 Bacteria 623
259 Ga0105242_10056873 3300009176 Bacteria 3201
260 Ga0105242_10122988 3300009176 Bacteria 2230
261 Ga0105242_10292767 3300009176 Unclassified 1483
262 Ga0105248_10019709 3300009177 Bacteria 7467
263 Ga0105248_10028533 3300009177 Bacteria 6218
264 Ga0105248_10160607 3300009177 Bacteria 2535
265 Ga0105248_12271242 3300009177 Unclassified 618
266 Ga0105248_12712821 3300009177 Unclassified 565
267 Ga0105237_10001434 3300009545 Bacteria 31525
268 Ga0105237_10500895 3300009545 Bacteria 1221
269 Ga0105238_10011882 3300009551 Bacteria 8771
270 Ga0105238_10030158 3300009551 Bacteria 5519
271 Ga0105238_10722790 3300009551 Bacteria 1008
272 Ga0105249_10001229 3300009553 Bacteria 22517
273 Ga0105249_10125739 3300009553 Bacteria 2441
274 Ga0105249_10511411 3300009553 Bacteria 1247
275 Ga0105249_11600805 3300009553 Unclassified 724
276 Ga0105249_12583828 3300009553 Unclassified 580
277 Ga0099796_10139109 3300010159 Bacteria 947
278 Ga0105239_10353643 3300010375 Bacteria 1659
279 Ga0105239_10641896 3300010375 Bacteria 1212
280 Ga0105239_11920674 3300010375 Bacteria 687
281 Ga0105246_10031226 3300011119 Bacteria 3524
282 Ga0105246_10181580 3300011119 Bacteria 1621
283 Ga0105246_11998260 3300011119 Bacteria 559
284 Ga0105246_12558889 3300011119 Bacteria 503
285 Ga0157373_10013832 3300013100 Bacteria 5917
286 Ga0157371_10458817 3300013102 Bacteria 937
287 Ga0157369_11488043 3300013105 Bacteria 689
288 Ga0157374_10075238 3300013296 Bacteria 3191
289 Ga0157374_11471512 3300013296 Bacteria 704
290 Ga0157378_10020300 3300013297 Bacteria 5843
291 Ga0157378_10030276 3300013297 Bacteria 4783
292 Ga0157378_10050659 3300013297 Bacteria 3695
293 Ga0157378_11152038 3300013297 Bacteria 814
294 Ga0157378_11677113 3300013297 Bacteria 682
295 Ga0163162_10000019 3300013306 Bacteria 220603
296 Ga0163162_10023529 3300013306 Bacteria 6080
297 Ga0163162_10133383 3300013306 Bacteria 2594
298 Ga0163162_10162670 3300013306 Bacteria 2354
299 Ga0163162_10675394 3300013306 Bacteria 1156
300 Ga0163162_11089538 3300013306 Unclassified 905
301 Ga0163162_11247563 3300013306 Bacteria 844
302 Ga0163162_11858633 3300013306 Bacteria 689
303 Ga0157372_10979898 3300013307 Unclassified 979
304 Ga0157372_11067866 3300013307 Unclassified 934
305 Ga0157375_10009610 3300013308 Bacteria 8497
306 Ga0157375_10062927 3300013308 Bacteria 3689
307 Ga0157375_10393929 3300013308 Bacteria 1552
308 Ga0157375_10678576 3300013308 Bacteria 1185
309 Ga0157375_10699404 3300013308 Bacteria 1167
310 Ga0163163_10020704 3300014325 Bacteria 6199
311 Ga0163163_10194771 3300014325 Bacteria 2075
312 Ga0163163_11027780 3300014325 Bacteria 887
313 Ga0157380_10008700 3300014326 Bacteria 7255
314 Ga0157380_10115772 3300014326 Bacteria 2261
315 Ga0157380_10235444 3300014326 Bacteria 1647
316 Ga0157380_10370627 3300014326 Bacteria 1347
317 Ga0157380_11044134 3300014326 Bacteria 853
318 Ga0157380_11979982 3300014326 Bacteria 644
319 Ga0157377_10199385 3300014745 Bacteria 1270
320 Ga0157377_10345992 3300014745 Bacteria 996
321 Ga0157377_10365358 3300014745 Unclassified 973
322 Ga0157377_11486313 3300014745 Unclassified 538
323 Ga0157379_10074973 3300014968 Bacteria 3028
324 Ga0157379_10265326 3300014968 Bacteria 1561
325 Ga0157376_10181928 3300014969 Unclassified 1922
326 Ga0157376_10285560 3300014969 Bacteria 1556
327 Ga0163161_11001607 3300017792 Bacteria 713
328 Ga0213876_10000347 3300021384 Bacteria 39952
329 Ga0213875_10499735 3300021388 Bacteria 584
330 Ga0207656_10178270 3300025321 Bacteria 1019
331 Ga0207653_10019958 3300025885 Bacteria 2118
332 Ga0207710_10031686 3300025900 Bacteria 2313
333 Ga0207710_10063320 3300025900 Bacteria 1682
334 Ga0207710_10325009 3300025900 Bacteria 780
335 Ga0207680_10109073 3300025903 Bacteria 1792
336 Ga0207647_10015664 3300025904 Bacteria 5191
337 Ga0207699_10223421 3300025906 Bacteria 1287
338 Ga0207645_10459942 3300025907 Bacteria 859
339 Ga0207643_10006279 3300025908 Bacteria 6360
340 Ga0207643_10155588 3300025908 Bacteria 1373
341 Ga0207684_10001881 3300025910 Bacteria 21837
342 Ga0207684_10040919 3300025910 Bacteria 3930
343 Ga0207684_10891395 3300025910 Bacteria 748
344 Ga0207654_10076341 3300025911 Bacteria 2005
345 Ga0207654_10331054 3300025911 Unclassified 1044
346 Ga0207707_10000031 3300025912 Bacteria 159505
347 Ga0207707_10192908 3300025912 Bacteria 1777
348 Ga0207707_10937404 3300025912 Bacteria 714
349 Ga0207671_10000811 3300025914 Bacteria 39493
350 Ga0207671_10503249 3300025914 Bacteria 966
351 Ga0207660_10001234 3300025917 Bacteria 17132
352 Ga0207660_10848542 3300025917 Bacteria 745
353 Ga0207662_10122821 3300025918 Bacteria 1630
354 Ga0207662_10190723 3300025918 Bacteria 1322
355 Ga0207662_10206484 3300025918 Bacteria 1274
356 Ga0207662_10393375 3300025918 Bacteria 938
357 Ga0207657_10955849 3300025919 Bacteria 658
358 Ga0207652_10000375 3300025921 Bacteria 46312
359 Ga0207646_10249531 3300025922 Unclassified 1603
360 Ga0207646_10314691 3300025922 Bacteria 1415
361 Ga0207681_10253256 3300025923 Bacteria 1375
362 Ga0207681_11154721 3300025923 Bacteria 650
363 Ga0207694_10034482 3300025924 Bacteria 3880
364 Ga0207650_10250331 3300025925 Bacteria 1434
365 Ga0207650_10548210 3300025925 Unclassified 969
366 Ga0207659_10470395 3300025926 Bacteria 1061
367 Ga0207659_10499066 3300025926 Unclassified 1030
368 Ga0207690_10135093 3300025932 Bacteria 1810
369 Ga0207706_10032728 3300025933 Bacteria 4628
370 Ga0207706_10632477 3300025933 Bacteria 918
371 Ga0207686_10192817 3300025934 Archaea 1454
372 Ga0207686_10308664 3300025934 Bacteria 1177
373 Ga0207709_10006281 3300025935 Bacteria 6672
374 Ga0207709_10076738 3300025935 Bacteria 2139
375 Ga0207709_10323524 3300025935 Bacteria 1155
376 Ga0207669_10568673 3300025937 Bacteria 917
377 Ga0207665_10105064 3300025939 Unclassified 1977
378 Ga0207665_10403481 3300025939 Bacteria 1041
379 Ga0207665_10409483 3300025939 Bacteria 1034
380 Ga0207711_10008322 3300025941 Bacteria 8684
381 Ga0207711_10013894 3300025941 Bacteria 6687
382 Ga0207711_10307606 3300025941 Bacteria 1463
383 Ga0207711_10358714 3300025941 Bacteria 1350
384 Ga0207689_10062501 3300025942 Bacteria 3062
385 Ga0207689_10087394 3300025942 Bacteria 2561
386 Ga0207689_10183300 3300025942 Unclassified 1726
387 Ga0207689_10524525 3300025942 Bacteria 994
388 Ga0207679_10128729 3300025945 Bacteria 2027
389 Ga0207679_10297997 3300025945 Bacteria 1389
390 Ga0207667_11529601 3300025949 Unclassified 638
391 Ga0207651_10037589 3300025960 Bacteria 3173
392 Ga0207651_10160042 3300025960 Bacteria 1764
393 Ga0207651_10575489 3300025960 Bacteria 982
394 Ga0207651_11486943 3300025960 Unclassified 610
395 Ga0207712_10001474 3300025961 Bacteria 16058
396 Ga0207712_10046986 3300025961 Bacteria 2995
397 Ga0207712_10213545 3300025961 Bacteria 1538
398 Ga0207712_10483313 3300025961 Bacteria 1056
399 Ga0207668_10011040 3300025972 Bacteria 5477
400 Ga0207640_10113218 3300025981 Bacteria 1928
401 Ga0207640_10251664 3300025981 Bacteria 1372
402 Ga0207640_10260655 3300025981 Bacteria 1351
403 Ga0207640_10639614 3300025981 Unclassified 905
404 Ga0207640_10866587 3300025981 Bacteria 787
405 Ga0207658_10375441 3300025986 Unclassified 1244
406 Ga0207677_10130763 3300026023 Bacteria 1905
407 Ga0207703_10103754 3300026035 Bacteria 2414
408 Ga0207703_10124429 3300026035 Bacteria 2218
409 Ga0207703_11349868 3300026035 Bacteria 686
410 Ga0207639_10182984 3300026041 Unclassified 1784
411 Ga0207639_10274854 3300026041 Unclassified 1479
412 Ga0207639_10391747 3300026041 Bacteria 1250
413 Ga0207708_10002514 3300026075 Bacteria 13496
414 Ga0207708_10212493 3300026075 Bacteria 1547
415 Ga0207708_10282198 3300026075 Bacteria 1346
416 Ga0207708_10353628 3300026075 Bacteria 1206
417 Ga0207708_10996665 3300026075 Bacteria 728
418 Ga0207702_10350703 3300026078 Bacteria 1412
419 Ga0207702_11229726 3300026078 Bacteria 743
420 Ga0207702_11583770 3300026078 Bacteria 648
421 Ga0207641_10176243 3300026088 Bacteria 1955
422 Ga0207641_10349290 3300026088 Bacteria 1409
423 Ga0207641_11283461 3300026088 Unclassified 733
424 Ga0207641_11764389 3300026088 Bacteria 621
425 Ga0207648_10091699 3300026089 Bacteria 2656
426 Ga0207648_10103735 3300026089 Bacteria 2493
427 Ga0207648_10106315 3300026089 Bacteria 2462
428 Ga0207648_10186742 3300026089 Bacteria 1836
429 Ga0207676_10025927 3300026095 Bacteria 4353
430 Ga0207676_10071443 3300026095 Bacteria 2787
431 Ga0207676_10115993 3300026095 Bacteria 2249
432 Ga0207676_10379516 3300026095 Bacteria 1315
433 Ga0207676_10485746 3300026095 Bacteria 1170
434 Ga0207676_11414267 3300026095 Unclassified 692
435 Ga0207676_11513937 3300026095 Bacteria 668
436 Ga0207676_11671668 3300026095 Unclassified 635
437 Ga0207676_12261855 3300026095 Unclassified 541
438 Ga0207674_10902546 3300026116 Unclassified 852
439 Ga0207675_100008601 3300026118 Bacteria 9597
440 Ga0207675_100150357 3300026118 Bacteria 2216
441 Ga0207675_100209985 3300026118 Bacteria 1872
442 Ga0207675_101479811 3300026118 Unclassified 700
443 Ga0207683_10965720 3300026121 Bacteria 791
444 Ga0207698_10246864 3300026142 Bacteria 1631
445 Ga0207698_10618570 3300026142 Bacteria 1070
446 Ga0207698_11654657 3300026142 Bacteria 655
447 Ga0207428_10049148 3300027907 Bacteria 3381
448 Ga0207428_10360926 3300027907 Bacteria 1068
449 Ga0268266_10132071 3300028379 Bacteria 2234
450 Ga0268265_10039453 3300028380 Bacteria 3481
451 Ga0268265_10062034 3300028380 Bacteria 2871
452 Ga0268265_10132703 3300028380 Bacteria 2073
453 Ga0268265_10475296 3300028380 Archaea 1173
454 Ga0268265_10818555 3300028380 Bacteria 909
455 Ga0268264_10059606 3300028381 Bacteria 3198
456 Ga0268264_10193232 3300028381 Bacteria 1857
457 Ga0268264_10322599 3300028381 Bacteria 1461
458 Ga0268264_10587404 3300028381 Bacteria 1096
459 Ga0307515_10109793 3300028794 Bacteria 3236
460 Ga0316176_1030826 3300030732 Bacteria 545
461 Ga0307408_100425260 3300031548 Unclassified 1146
462 Ga0307405_10039635 3300031731 Bacteria 2849
463 Ga0307410_10332430 3300031852 Bacteria 1209
464 Ga0307406_10190182 3300031901 Bacteria 1502
465 Ga0307416_100280694 3300032002 Bacteria 1642
466 Ga0307411_10120873 3300032005 Bacteria 1895
467 Ga0373951_0001129 3300035091 Bacteria 7098
468 Ga0373952_0246203 3300035092 Bacteria 540
469 Ga0373941_0118591 3300035115 Unclassified 941
470 Ga0373962_0247647 3300035242 Unclassified 618
471 Ga0395899_0194253 3300037312 Bacteria 1419
472 Ga0395899_0323154 3300037312 Bacteria 1039
473 Ga0395900_0913029 3300037418 Bacteria 801
474 Ga0395900_0951387 3300037418 Unclassified 780
475 Ga0395900_1054915 3300037418 Unclassified 731
476 Ga0395898_0354551 3300037466 Bacteria 1399
477 Ga0395898_0491375 3300037466 Unclassified 1168
478 Ga0395898_0802059 3300037466 Unclassified 882
479 Ga0436364_1550876 3300037853 Bacteria 1135
480 Ga0395901_0201022 3300038443 Bacteria 2089
481 Ga0395901_1690584 3300038443 Unclassified 584
482 Ga0436365_0020615 3300039437 Bacteria 3435
483 Ga0436365_0140303 3300039437 Unclassified 741
484 Ga0436365_0289912 3300039437 Bacteria 336570
485 Ga0436365_1744743 3300039437 Bacteria 193023
486 Ga0436363_0925920 3300039450 Unclassified 621
487 Ga0436362_0504210 3300039453 Bacteria 604
488 Ga0439457_132091 3300042014 Bacteria 594
489 Ga0439446_0330921 3300042156 Bacteria 540
490 Ga0439458_0004208 3300042157 Bacteria 3325
491 Ga0466967_0684007 3300045976 Bacteria 1016
492 Ga0495632_0067000 3300046519 Bacteria 1732
493 Ga0496102_0218552 3300048905 Unclassified 1796
494 Ga0496102_1234876 3300048905 Unclassified 667
495 Ga0496103_0388292 3300048906 Bacteria 897
496 Ga0496104_0348118 3300048907 Bacteria 1394
497 Ga0496104_0687375 3300048907 Bacteria 931
498 Ga0496106_0186915 3300048909 Unclassified 1646
499 Ga0496106_0469340 3300048909 Bacteria 1011
500 Ga0496106_1395003 3300048909 Bacteria 541
501 Ga0496107_0547382 3300048910 Bacteria 857
502 Ga0496107_1088496 3300048910 Bacteria 578
503 Ga0496108_0211898 3300048911 Bacteria 1682
504 Ga0496109_0109999 3300048912 Bacteria 2562
505 Ga0496110_0119702 3300048913 Bacteria 2372
506 Ga0496112_0226962 3300048915 Bacteria 1823
507 Ga0496112_0278115 3300048915 Unclassified 1622
508 Ga0496112_0578432 3300048915 Bacteria 1056
509 Ga0496112_1293995 3300048915 Bacteria 645
510 Ga0496112_1607381 3300048915 Unclassified 563
511 Ga0496113_0501944 3300048916 Bacteria 974
512 Ga0496113_0616463 3300048916 Unclassified 869
513 Ga0501291_003975 3300049514 Bacteria 1865
514 Ga0501295_004796 3300049518 Bacteria 1787
515 Ga0501298_001740 3300049521 Bacteria 3221
516 Ga0501298_004063 3300049521 Bacteria 2290
517 Ga0501299_001323 3300049522 Bacteria 3153
518 Ga0501299_001815 3300049522 Bacteria 2851
519 Ga0501038_0006145 3300049574 Bacteria 11118
520 Ga0501040_1136160 3300049576 Bacteria 567
521 Ga0501198_072906 3300049649 Unclassified 651
522 Ga0501202_003677 3300049652 Bacteria 2642
523 Ga0501207_008749 3300049654 Bacteria 1469
524 Ga0501207_050135 3300049654 Bacteria 744
525 Ga0501211_009628 3300049658 Bacteria 947
526 Ga0501216_005730 3300049660 Bacteria 1882
527 Ga0501223_037156 3300049663 Bacteria 946
528 Ga0501227_014994 3300049665 Bacteria 1728
529 Ga0501233_019905 3300049668 Bacteria 1427
530 Ga0501235_036822 3300049669 Unclassified 1113
531 Ga0501238_021635 3300049671 Bacteria 912
532 Ga0501242_085460 3300049674 Bacteria 512
533 Ga0501243_005817 3300049675 Bacteria 1861
534 Ga0501247_026093 3300049677 Unclassified 779
535 Ga0501249_192856 3300049679 Unclassified 531
536 Ga0501251_008572 3300049681 Bacteria 1161
537 Ga0501251_079976 3300049681 Unclassified 572
538 Ga0501253_070883 3300049683 Bacteria 769
539 Ga0501261_037148 3300049690 Bacteria 756
540 Ga0501221_019872 3300049704 Unclassified 1308
541 Ga0501225_0011823 3300049705 Bacteria 2455
542 Ga0501234_016122 3300049707 Bacteria 1178
543 Ga0501263_060799 3300049760 Unclassified 592
544 Ga0501266_012190 3300049763 Unclassified 1107
545 Ga0501268_026626 3300049765 Unclassified 1023
546 Ga0501272_052344 3300049769 Bacteria 569
547 Ga0501274_002510 3300049771 Bacteria 1440
548 Ga0501276_008466 3300049773 Bacteria 838
549 Ga0501279_030862 3300049775 Bacteria 795
550 Ga0501279_080390 3300049775 Bacteria 561
551 Ga0501283_000230 3300049779 Bacteria 7411
552 nmdc:mga05p37_145608_c1 3300050507 Bacteria 2901
553 nmdc:mga05p37_1494031_c1 3300050507 Bacteria 673
554 nmdc:mga05p37_441503_c1 3300050507 Bacteria 1509
555 nmdc:mga05p37_636216_c1 3300050507 Bacteria 1197
556 nmdc:mga05p37_987028_c1 3300050507 Bacteria 896
557 nmdc:mga09592_150865_c1 3300050508 Bacteria 2005
558 nmdc:mga09592_663007_c1 3300050508 Bacteria 890
559 nmdc:mga0qj67_562911_c1 3300050509 Bacteria 914
560 nmdc:mga0qj67_693531_c1 3300050509 Bacteria 810
561 nmdc:mga06r32_1085969_c1 3300050510 Unclassified 750
562 nmdc:mga06r32_253693_c1 3300050510 Bacteria 1747
563 nmdc:mga08y16_1430858_c1 3300050511 Bacteria 654
564 nmdc:mga08y16_81051_c1 3300050511 Bacteria 3384
565 nmdc:mga0n895_130984_c1 3300050512 Unclassified 2533
566 nmdc:mga0n895_171226_c1 3300050512 Bacteria 2203
567 nmdc:mga0n895_434512_c1 3300050512 Bacteria 1326
568 nmdc:mga0n895_864783_c1 3300050512 Bacteria 891
569 nmdc:mga0rr50_271206_c1 3300050513 Unclassified 1414
570 nmdc:mga0rr50_43611_c1 3300050513 Bacteria 3284
571 nmdc:mga08x19_12365_c1 3300050514 Bacteria 5141
572 nmdc:mga0a205_1392202_c1 3300050515 Unclassified 549
573 nmdc:mga0a205_301261_c1 3300050515 Bacteria 1476
574 nmdc:mga0a205_432285_c1 3300050515 Bacteria 1178
575 nmdc:mga0a205_46636_c1 3300050515 Bacteria 4179
576 nmdc:mga0a205_51702_c1 3300050515 Bacteria 3966
577 nmdc:mga0a205_68520_c1 3300050515 Bacteria 3426
578 nmdc:mga0a205_802922_c1 3300050515 Bacteria 789
579 Ga0587070_222444 3300059491 Bacteria 512
580 Ga0587077_117651 3300059493 Bacteria 659
581 Ga0070708_100410117
582 SwRhRL2b_contig_2181746
583 JGI25406J46586_10035405
584 JGI25406J46586_10076870
585 Ga0065714_10064454
586 Ga0065704_10172521
587 Ga0065712_10000129
588 Ga0065712_10002232
589 Ga0065712_10154501
590 Ga0065712_10179845
591 Ga0065715_10026374
592 Ga0065715_10092191
593 Ga0065715_10099080
594 Ga0065715_10112557
595 Ga0065715_10129208
596 Ga0065715_10136530
597 Ga0065715_10162909
598 Ga0065715_10190908
599 Ga0065715_10673152
600 Ga0065715_10839096
601 Ga0065707_10203920
602 Ga0065707_10235401
603 Ga0065707_11041311
604 Ga0070676_10356521
605 Ga0070676_11076476
606 Ga0070690_100002026
607 Ga0070690_100350027
608 Ga0070690_100375410
609 Ga0070670_100085841
610 Ga0068869_100053451
611 Ga0068869_100249879
612 Ga0068869_100869615
613 Ga0068869_100932118
614 Ga0068869_101682752
615 Ga0070666_10073051
616 Ga0070666_10301446
617 Ga0070680_100064390
618 Ga0070680_100762773
619 Ga0070680_100985871
620 Ga0070682_100006217
621 Ga0070682_100127539
622 Ga0068868_100072771
623 Ga0068868_100708908
624 Ga0070660_101115519
625 Ga0070689_100476907
626 Ga0070689_100756895
627 Ga0070687_100144727
628 Ga0070687_100401770
629 Ga0070687_100482830
630 Ga0070687_100715531
631 Ga0070692_10006611
632 Ga0070692_10080196
633 Ga0070668_100016547
634 Ga0070669_100003362
635 Ga0070669_100308566
636 Ga0070675_100223573
637 Ga0070675_100376576
638 Ga0070675_100394801
639 Ga0070675_100777636
640 Ga0070671_100634057
641 Ga0070674_100172546
642 Ga0070673_100004775
643 Ga0070673_100083302
644 Ga0070673_100118339
645 Ga0070673_100288883
646 Ga0070673_100312677
647 Ga0070688_100315592
648 Ga0070659_100509048
649 Ga0070667_100013522
650 Ga0070701_10086616
651 Ga0070701_10091192
652 Ga0070701_10248509
653 Ga0070701_10612062
654 Ga0070705_100037251
655 Ga0070705_100173971
656 Ga0070705_100492368
657 Ga0070705_101013606
658 Ga0070700_100000569
659 Ga0070700_100026091
660 Ga0070700_100223363
661 Ga0070700_100328809
662 Ga0070694_100024590
663 Ga0070694_100069200
664 Ga0070694_100100974
665 Ga0070694_100270774
666 Ga0070694_100327015
667 Ga0070694_100394669
668 Ga0070708_100000088
669 Ga0070708_101349034
670 Ga0070678_100494481
671 Ga0070662_100024966
672 Ga0070662_100506686
673 Ga0070681_10000362
674 Ga0070681_10023187
675 Ga0070681_10952374
676 Ga0068867_100039184
677 Ga0068867_100046388
678 Ga0068867_100097312
679 Ga0068867_100171181
680 Ga0068867_100279285
681 Ga0070685_11064618
682 Ga0070706_100000044
683 Ga0070706_100034585
684 Ga0070706_100201206
685 Ga0070707_100044225
686 Ga0070707_100377943
687 Ga0070698_100070085
688 Ga0070698_100736120
689 Ga0070699_100003368
690 Ga0070699_100028207
691 Ga0070679_100000540
692 Ga0070684_100653203
693 Ga0070697_100001170
694 Ga0070697_100021957
695 Ga0070697_100103453
696 Ga0070697_100556390
697 Ga0068853_100604814
698 Ga0070672_100491225
699 Ga0070686_100012945
700 Ga0070686_100294036
701 Ga0070686_100451638
702 Ga0070695_100028678
703 Ga0070695_100088542
704 Ga0070695_100290657
705 Ga0070696_100039730
706 Ga0070696_100143746
707 Ga0070696_100144115
708 Ga0070696_100207026
709 Ga0070696_100305483
710 Ga0070696_100485609
711 Ga0070696_100672054
712 Ga0070696_101804083
713 Ga0070693_100033935
714 Ga0070693_100134067
715 Ga0070693_100210996
716 Ga0070693_100326635
717 Ga0070693_100504692
718 Ga0070693_100742149
719 Ga0070665_100382436
720 Ga0070665_101055142
721 Ga0070704_100041904
722 Ga0070704_100054659
723 Ga0070704_100306310
724 Ga0070704_101064707
725 Ga0070664_100163148
726 Ga0070664_100222650
727 Ga0070664_100248625
728 Ga0068854_100093737
729 Ga0068854_100255941
730 Ga0068854_101046950
731 Ga0068854_101461602
732 Ga0068856_101746397
733 Ga0070702_100027052
734 Ga0070702_100313102
735 Ga0070702_100529064
736 Ga0070702_100658897
737 Ga0068852_100197824
738 Ga0068852_100398849
739 Ga0068852_100792368
740 Ga0068852_101692325
741 Ga0068859_100024046
742 Ga0068859_100143985
743 Ga0068859_100307905
744 Ga0068859_100403454
745 Ga0068859_100403716
746 Ga0068859_100497988
747 Ga0068859_101361699
748 Ga0068864_100004529
749 Ga0068864_100399485
750 Ga0068864_100433393
751 Ga0068864_100567260
752 Ga0068864_100770564
753 Ga0068864_100775973
754 Ga0068866_11079247
755 Ga0068861_100001904
756 Ga0068861_100144510
757 Ga0068861_100154530
758 Ga0068861_100241449
759 Ga0068861_100514888
760 Ga0068861_101236915
761 Ga0068861_101332570
762 Ga0068851_10008515
763 Ga0068870_10703847
764 Ga0068863_100465714
765 Ga0068858_100080481
766 Ga0068858_100082508
767 Ga0068858_100134597
768 Ga0068858_101288422
769 Ga0068860_100210396
770 Ga0068860_100339335
771 Ga0068860_100583719
772 Ga0068862_100033971
773 Ga0068862_100099617
774 Ga0068862_100314937
775 Ga0068862_100783545
776 Ga0068862_101002504
777 Ga0081540_1173862
778 Ga0081539_10002342
779 Ga0081539_10004393
780 Ga0081539_10070859
781 Ga0081539_10075533
782 Ga0070716_100331794
783 Ga0070716_100450948
784 Ga0097621_100017592
785 Ga0068871_100001909
786 Ga0068871_100036283
787 Ga0068871_100197082
788 Ga0075430_100055130
789 Ga0075430_100621207
790 Ga0075433_10033574
791 Ga0075433_10043971
792 Ga0075433_10051339
793 Ga0075433_10181208
794 Ga0075433_10247838
795 Ga0075434_100441479
796 Ga0075434_100615594
797 Ga0075434_100887781
798 Ga0075434_101126640
799 Ga0075434_101933465
800 Ga0097620_100024045
801 Ga0097620_100143985
802 Ga0097620_100184841
803 Ga0097620_100307904
804 Ga0097620_100403451
805 Ga0097620_100403742
806 Ga0097620_100497952
807 Ga0097620_101361757
808 Ga0075435_100016172
809 Ga0075435_100132520
810 Ga0105251_10161360
811 Ga0105251_10342400
812 Ga0105250_10573889
813 Ga0105240_10300065
814 Ga0105240_11258340
815 Ga0111539_10001823
816 Ga0111539_11353795
817 Ga0105245_10107553
818 Ga0105245_10818839
819 Ga0105245_10977711
820 Ga0105247_10123280
821 Ga0105247_10137278
822 Ga0105247_10144514
823 Ga0105247_10658241
824 Ga0114129_10064807
825 Ga0114129_10069702
826 Ga0114129_10278498
827 Ga0114129_10700387
828 Ga0114129_10963610
829 Ga0114129_11504096
830 Ga0105243_10011430
831 Ga0105243_10322980
832 Ga0105243_10407347
833 Ga0105243_10733494
834 Ga0105241_10035070
835 Ga0105241_10063614
836 Ga0105241_10266175
837 Ga0105241_10397042
838 Ga0105241_11641976
839 Ga0105242_10056873
840 Ga0105242_10122988
841 Ga0105242_10292767
842 Ga0105248_10019709
843 Ga0105248_10028533
844 Ga0105248_10160607
845 Ga0105248_12271242
846 Ga0105248_12712821
847 Ga0105237_10001434
848 Ga0105237_10500895
849 Ga0105238_10011882
850 Ga0105238_10030158
851 Ga0105238_10722790
852 Ga0105249_10001229
853 Ga0105249_10125739
854 Ga0105249_10511411
855 Ga0105249_11600805
856 Ga0105249_12583828
857 Ga0099796_10139109
858 Ga0105239_10353643
859 Ga0105239_10641896
860 Ga0105239_11920674
861 Ga0105246_10031226
862 Ga0105246_10181580
863 Ga0105246_11998260
864 Ga0105246_12558889
865 Ga0157373_10013832
866 Ga0157371_10458817
867 Ga0157369_11488043
868 Ga0157374_10075238
869 Ga0157374_11471512
870 Ga0157378_10020300
871 Ga0157378_10030276
872 Ga0157378_10050659
873 Ga0157378_11152038
874 Ga0157378_11677113
875 Ga0163162_10000019
876 Ga0163162_10023529
877 Ga0163162_10133383
878 Ga0163162_10162670
879 Ga0163162_10675394
880 Ga0163162_11089538
881 Ga0163162_11247563
882 Ga0163162_11858633
883 Ga0157372_10979898
884 Ga0157372_11067866
885 Ga0157375_10009610
886 Ga0157375_10062927
887 Ga0157375_10393929
888 Ga0157375_10678576
889 Ga0157375_10699404
890 Ga0163163_10020704
891 Ga0163163_10194771
892 Ga0163163_11027780
893 Ga0157380_10008700
894 Ga0157380_10115772
895 Ga0157380_10235444
896 Ga0157380_10370627
897 Ga0157380_11044134
898 Ga0157380_11979982
899 Ga0157377_10199385
900 Ga0157377_10345992
901 Ga0157377_10365358
902 Ga0157377_11486313
903 Ga0157379_10074973
904 Ga0157379_10265326
905 Ga0157376_10181928
906 Ga0157376_10285560
907 Ga0163161_11001607
908 Ga0213876_10000347
909 Ga0213875_10499735
910 Ga0207656_10178270
911 Ga0207653_10019958
912 Ga0207710_10031686
913 Ga0207710_10063320
914 Ga0207710_10325009
915 Ga0207680_10109073
916 Ga0207647_10015664
917 Ga0207699_10223421
918 Ga0207645_10459942
919 Ga0207643_10006279
920 Ga0207643_10155588
921 Ga0207684_10001881
922 Ga0207684_10040919
923 Ga0207684_10891395
924 Ga0207654_10076341
925 Ga0207654_10331054
926 Ga0207707_10000031
927 Ga0207707_10192908
928 Ga0207707_10937404
929 Ga0207671_10000811
930 Ga0207671_10503249
931 Ga0207660_10001234
932 Ga0207660_10848542
933 Ga0207662_10122821
934 Ga0207662_10190723
935 Ga0207662_10206484
936 Ga0207662_10393375
937 Ga0207657_10955849
938 Ga0207652_10000375
939 Ga0207646_10249531
940 Ga0207646_10314691
941 Ga0207681_10253256
942 Ga0207681_11154721
943 Ga0207694_10034482
944 Ga0207650_10250331
945 Ga0207650_10548210
946 Ga0207659_10470395
947 Ga0207659_10499066
948 Ga0207690_10135093
949 Ga0207706_10032728
950 Ga0207706_10632477
951 Ga0207686_10192817
952 Ga0207686_10308664
953 Ga0207709_10006281
954 Ga0207709_10076738
955 Ga0207709_10323524
956 Ga0207669_10568673
957 Ga0207665_10105064
958 Ga0207665_10403481
959 Ga0207665_10409483
960 Ga0207711_10008322
961 Ga0207711_10013894
962 Ga0207711_10307606
963 Ga0207711_10358714
964 Ga0207689_10062501
965 Ga0207689_10087394
966 Ga0207689_10183300
967 Ga0207689_10524525
968 Ga0207679_10128729
969 Ga0207679_10297997
970 Ga0207667_11529601
971 Ga0207651_10037589
972 Ga0207651_10160042
973 Ga0207651_10575489
974 Ga0207651_11486943
975 Ga0207712_10001474
976 Ga0207712_10046986
977 Ga0207712_10213545
978 Ga0207712_10483313
979 Ga0207668_10011040
980 Ga0207640_10113218
981 Ga0207640_10251664
982 Ga0207640_10260655
983 Ga0207640_10639614
984 Ga0207640_10866587
985 Ga0207658_10375441
986 Ga0207677_10130763
987 Ga0207703_10103754
988 Ga0207703_10124429
989 Ga0207703_11349868
990 Ga0207639_10182984
991 Ga0207639_10274854
992 Ga0207639_10391747
993 Ga0207708_10002514
994 Ga0207708_10212493
995 Ga0207708_10282198
996 Ga0207708_10353628
997 Ga0207708_10996665
998 Ga0207702_10350703
999 Ga0207702_11229726
1000 Ga0207702_11583770
1001 Ga0207641_10176243
1002 Ga0207641_10349290
1003 Ga0207641_11283461
1004 Ga0207641_11764389
1005 Ga0207648_10091699
1006 Ga0207648_10103735
1007 Ga0207648_10106315
1008 Ga0207648_10186742
1009 Ga0207676_10025927
1010 Ga0207676_10071443
1011 Ga0207676_10115993
1012 Ga0207676_10379516
1013 Ga0207676_10485746
1014 Ga0207676_11414267
1015 Ga0207676_11513937
1016 Ga0207676_11671668
1017 Ga0207676_12261855
1018 Ga0207674_10902546
1019 Ga0207675_100008601
1020 Ga0207675_100150357
1021 Ga0207675_100209985
1022 Ga0207675_101479811
1023 Ga0207683_10965720
1024 Ga0207698_10246864
1025 Ga0207698_10618570
1026 Ga0207698_11654657
1027 Ga0207428_10049148
1028 Ga0207428_10360926
1029 Ga0268266_10132071
1030 Ga0268265_10039453
1031 Ga0268265_10062034
1032 Ga0268265_10132703
1033 Ga0268265_10475296
1034 Ga0268265_10818555
1035 Ga0268264_10059606
1036 Ga0268264_10193232
1037 Ga0268264_10322599
1038 Ga0268264_10587404
1039 Ga0307515_10109793
1040 Ga0316176_1030826
1041 Ga0307408_100425260
1042 Ga0307405_10039635
1043 Ga0307410_10332430
1044 Ga0307406_10190182
1045 Ga0307416_100280694
1046 Ga0307411_10120873
1047 Ga0373951_0001129
1048 Ga0373952_0246203
1049 Ga0373941_0118591
1050 Ga0373962_0247647
1051 Ga0395899_0194253
1052 Ga0395899_0323154
1053 Ga0395900_0913029
1054 Ga0395900_0951387
1055 Ga0395900_1054915
1056 Ga0395898_0354551
1057 Ga0395898_0491375
1058 Ga0395898_0802059
1059 Ga0436364_1550876
1060 Ga0395901_0201022
1061 Ga0395901_1690584
1062 Ga0436365_0020615
1063 Ga0436365_0140303
1064 Ga0436365_0289912
1065 Ga0436365_1744743
1066 Ga0436363_0925920
1067 Ga0436362_0504210
1068 Ga0439457_132091
1069 Ga0439446_0330921
1070 Ga0439458_0004208
1071 Ga0466967_0684007
1072 Ga0495632_0067000
1073 Ga0496102_0218552
1074 Ga0496102_1234876
1075 Ga0496103_0388292
1076 Ga0496104_0348118
1077 Ga0496104_0687375
1078 Ga0496106_0186915
1079 Ga0496106_0469340
1080 Ga0496106_1395003
1081 Ga0496107_0547382
1082 Ga0496107_1088496
1083 Ga0496108_0211898
1084 Ga0496109_0109999
1085 Ga0496110_0119702
1086 Ga0496112_0226962
1087 Ga0496112_0278115
1088 Ga0496112_0578432
1089 Ga0496112_1293995
1090 Ga0496112_1607381
1091 Ga0496113_0501944
1092 Ga0496113_0616463
1093 Ga0501291_003975
1094 Ga0501295_004796
1095 Ga0501298_001740
1096 Ga0501298_004063
1097 Ga0501299_001323
1098 Ga0501299_001815
1099 Ga0501038_0006145
1100 Ga0501040_1136160
1101 Ga0501198_072906
1102 Ga0501202_003677
1103 Ga0501207_008749
1104 Ga0501207_050135
1105 Ga0501211_009628
1106 Ga0501216_005730
1107 Ga0501223_037156
1108 Ga0501227_014994
1109 Ga0501233_019905
1110 Ga0501235_036822
1111 Ga0501238_021635
1112 Ga0501242_085460
1113 Ga0501243_005817
1114 Ga0501247_026093
1115 Ga0501249_192856
1116 Ga0501251_008572
1117 Ga0501251_079976
1118 Ga0501253_070883
1119 Ga0501261_037148
1120 Ga0501221_019872
1121 Ga0501225_0011823
1122 Ga0501234_016122
1123 Ga0501263_060799
1124 Ga0501266_012190
1125 Ga0501268_026626
1126 Ga0501272_052344
1127 Ga0501274_002510
1128 Ga0501276_008466
1129 Ga0501279_030862
1130 Ga0501279_080390
1131 Ga0501283_000230
1132 nmdc:mga05p37_145608_c1
1133 nmdc:mga05p37_1494031_c1
1134 nmdc:mga05p37_441503_c1
1135 nmdc:mga05p37_636216_c1
1136 nmdc:mga05p37_987028_c1
1137 nmdc:mga09592_150865_c1
1138 nmdc:mga09592_663007_c1
1139 nmdc:mga0qj67_562911_c1
1140 nmdc:mga0qj67_693531_c1
1141 nmdc:mga06r32_1085969_c1
1142 nmdc:mga06r32_253693_c1
1143 nmdc:mga08y16_1430858_c1
1144 nmdc:mga08y16_81051_c1
1145 nmdc:mga0n895_130984_c1
1146 nmdc:mga0n895_171226_c1
1147 nmdc:mga0n895_434512_c1
1148 nmdc:mga0n895_864783_c1
1149 nmdc:mga0rr50_271206_c1
1150 nmdc:mga0rr50_43611_c1
1151 nmdc:mga08x19_12365_c1
1152 nmdc:mga0a205_1392202_c1
1153 nmdc:mga0a205_301261_c1
1154 nmdc:mga0a205_432285_c1
1155 nmdc:mga0a205_46636_c1
1156 nmdc:mga0a205_51702_c1
1157 nmdc:mga0a205_68520_c1
1158 nmdc:mga0a205_802922_c1
1159 Ga0587070_222444
1160 Ga0587077_117651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

39

131

0.89

Map