F465879

General Info

Members Datasets Scaffolds Average Seq Length
579 271 1158 207

Family's Representative Sequence

Representative Sequence 3300050516|nmdc:mga0sz30_71987_c1|nmdc:mga0sz30_71987_c1_763_1470
Length 235
Sequence MRAGRALLRVLRQAQHEWVDSKGAAGMADTLALVDYGAGNLRSVANALKAAGAGNVVVTADPNVVRTADRIVLPGVGAFRSCIESLFAVSGLVEAMEERVQVGGAPFLGICVGMQLLADRGIEFGTTEGLGWIGGEVRVIEPADPSIKVPHMGWNDVSLGRHDRSGGLIEPGEAYFLHSYHFVPEDGHDIAAMSDHGGGIVAAVARDNILGVQFHPEKSQSYGLALLARFLEWKP

Samples

Sample ID Description Type Environment
1 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
71 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
131 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
132 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
149 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
150 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
151 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
155 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
159 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
181 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
184 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
216 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
217 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
218 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
219 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
220 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
221 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
231 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
232 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
233 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
234 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
235 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
236 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
237 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
238 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
239 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
240 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
243 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
244 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
245 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
246 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
247 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
248 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
249 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
250 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
251 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
252 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
253 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
254 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
255 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
256 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
257 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
258 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
259 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
260 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
261 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
262 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
263 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
264 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
265 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
266 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
267 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
268 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
269 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
270 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
271 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.85
Metatranscriptomes 0.17
Isolates 3.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.74
Nodule 0
Rhizoplane 5.53
Rhizosphere 71.85
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0sz30_71987_c1 3300050516 Bacteria 1489
2 SwRhRL2b_contig_3660702 2162886007 Bacteria 11509
3 SwRhRL2b_contig_52241 2162886007 Bacteria 2295
4 SwRhRL2b_contig_818409 2162886007 Bacteria 1676
5 SwRhRL2b_contig_86134 2162886007 Bacteria 2531
6 JGI24751J29686_10000959 3300002459 Bacteria 6387
7 Ga0055530_10013236 3300003791 Bacteria 2824
8 Ga0065704_10000192 3300005289 Bacteria 216848
9 Ga0065704_10000914 3300005289 Bacteria 11453
10 Ga0065704_10002639 3300005289 Bacteria 6825
11 Ga0065704_10077790 3300005289 Bacteria 4619
12 Ga0065707_10084356 3300005295 Bacteria 7311
13 Ga0065707_10096811 3300005295 Bacteria 3231
14 Ga0065707_10104842 3300005295 Bacteria 2676
15 Ga0070658_10000068 3300005327 Bacteria 102788
16 Ga0070658_10085409 3300005327 Bacteria 2595
17 Ga0070658_10150714 3300005327 Bacteria 1947
18 Ga0070658_10155541 3300005327 Bacteria 1917
19 Ga0070658_10189447 3300005327 Bacteria 1733
20 Ga0070658_10225292 3300005327 Bacteria 1586
21 Ga0070676_10202387 3300005328 Bacteria 1302
22 Ga0070670_100193875 3300005331 Bacteria 1765
23 Ga0070670_100557345 3300005331 Bacteria 1023
24 Ga0070666_10021059 3300005335 Bacteria 4222
25 Ga0070666_10048564 3300005335 Bacteria 2852
26 Ga0070666_10384913 3300005335 Bacteria 1007
27 Ga0070680_100001683 3300005336 Bacteria 16198
28 Ga0070682_100076327 3300005337 Bacteria 2157
29 Ga0070660_100002033 3300005339 Bacteria 13954
30 Ga0070660_100023602 3300005339 Bacteria 4557
31 Ga0070660_100329392 3300005339 Bacteria 1255
32 Ga0070660_100333879 3300005339 Bacteria 1247
33 Ga0070661_100001882 3300005344 Bacteria 14532
34 Ga0070692_10069787 3300005345 Bacteria 1870
35 Ga0070668_100000041 3300005347 Bacteria 78742
36 Ga0070668_100008132 3300005347 Bacteria 7792
37 Ga0070668_100093257 3300005347 Bacteria 2376
38 Ga0070669_100000184 3300005353 Bacteria 54362
39 Ga0070669_100000472 3300005353 Bacteria 30562
40 Ga0070669_100005445 3300005353 Bacteria 9185
41 Ga0070669_100014945 3300005353 Bacteria 5532
42 Ga0070669_100055560 3300005353 Bacteria 2901
43 Ga0070671_100000067 3300005355 Bacteria 70750
44 Ga0070671_100002891 3300005355 Bacteria 13371
45 Ga0070671_100003218 3300005355 Bacteria 12731
46 Ga0070659_100081282 3300005366 Bacteria 2588
47 Ga0070659_100146554 3300005366 Bacteria 1924
48 Ga0070659_100212798 3300005366 Bacteria 1593
49 Ga0070667_100000058 3300005367 Bacteria 148071
50 Ga0070667_100003664 3300005367 Bacteria 13079
51 Ga0070667_100016472 3300005367 Bacteria 6117
52 Ga0070667_100417529 3300005367 Bacteria 1223
53 Ga0070714_100584935 3300005435 Bacteria 1071
54 Ga0070705_100077235 3300005440 Bacteria 2033
55 Ga0070708_100456732 3300005445 Bacteria 1205
56 Ga0070663_100482421 3300005455 Bacteria 1027
57 Ga0070663_100674221 3300005455 Bacteria 876
58 Ga0070678_100213532 3300005456 Bacteria 1600
59 Ga0070662_100001446 3300005457 Bacteria 14637
60 Ga0070662_100089396 3300005457 Bacteria 2310
61 Ga0070662_100233072 3300005457 Bacteria 1473
62 Ga0070681_10008385 3300005458 Bacteria 10120
63 Ga0070685_10060467 3300005466 Bacteria 2215
64 Ga0070706_100012712 3300005467 Bacteria 7789
65 Ga0070707_100000042 3300005468 Bacteria 109324
66 Ga0070698_100076640 3300005471 Bacteria 3345
67 Ga0070699_100161579 3300005518 Bacteria 1982
68 Ga0070679_100005037 3300005530 Bacteria 12195
69 Ga0070679_100151775 3300005530 Bacteria 2293
70 Ga0070684_100090919 3300005535 Bacteria 2715
71 Ga0070684_100124594 3300005535 Bacteria 2320
72 Ga0070697_100073278 3300005536 Bacteria 2811
73 Ga0070697_100178460 3300005536 Bacteria 1800
74 Ga0068853_100000329 3300005539 Bacteria 33239
75 Ga0068853_100002549 3300005539 Bacteria 13684
76 Ga0068853_100039895 3300005539 Bacteria 4005
77 Ga0068853_100171816 3300005539 Bacteria 1961
78 Ga0068853_100299492 3300005539 Bacteria 1486
79 Ga0070686_100095853 3300005544 Bacteria 1994
80 Ga0070665_100007174 3300005548 Bacteria 11332
81 Ga0070665_100010368 3300005548 Bacteria 9429
82 Ga0070665_100289943 3300005548 Bacteria 1639
83 Ga0068855_100018885 3300005563 Bacteria 8287
84 Ga0068855_100028086 3300005563 Bacteria 6729
85 Ga0068855_100034692 3300005563 Bacteria 6013
86 Ga0068855_100057353 3300005563 Bacteria 4565
87 Ga0068855_100194078 3300005563 Bacteria 2288
88 Ga0068855_100289830 3300005563 Bacteria 1815
89 Ga0070664_100016772 3300005564 Bacteria 6010
90 Ga0068857_100013486 3300005577 Bacteria 7119
91 Ga0068857_100059453 3300005577 Bacteria 3395
92 Ga0068857_100112239 3300005577 Bacteria 2451
93 Ga0068857_100162242 3300005577 Bacteria 2028
94 Ga0068854_100018657 3300005578 Bacteria 4661
95 Ga0068856_100007858 3300005614 Bacteria 10417
96 Ga0068856_100239996 3300005614 Bacteria 1828
97 Ga0068852_100000358 3300005616 Bacteria 30765
98 Ga0068852_100038220 3300005616 Bacteria 4032
99 Ga0068852_100052082 3300005616 Bacteria 3517
100 Ga0068852_100724675 3300005616 Bacteria 1005
101 Ga0068859_100003997 3300005617 Bacteria 15032
102 Ga0068859_100180814 3300005617 Bacteria 2192
103 Ga0068859_100373655 3300005617 Bacteria 1521
104 Ga0068864_100032465 3300005618 Bacteria 4436
105 Ga0068864_100346051 3300005618 Bacteria 1402
106 Ga0068863_100000031 3300005841 Bacteria 175602
107 Ga0068863_100000103 3300005841 Bacteria 91380
108 Ga0068863_100007418 3300005841 Bacteria 10732
109 Ga0068858_100001121 3300005842 Bacteria 27733
110 Ga0068858_100031111 3300005842 Bacteria 4956
111 Ga0068858_100443443 3300005842 Bacteria 1250
112 Ga0068858_100550402 3300005842 Bacteria 1117
113 Ga0068858_100635117 3300005842 Bacteria 1037
114 Ga0068860_100000093 3300005843 Bacteria 150034
115 Ga0068860_100035617 3300005843 Bacteria 4773
116 Ga0068860_100046702 3300005843 Bacteria 4129
117 Ga0068860_100061302 3300005843 Bacteria 3574
118 Ga0068860_100091656 3300005843 Bacteria 2895
119 Ga0068860_100135237 3300005843 Bacteria 2367
120 Ga0068860_100703928 3300005843 Bacteria 1020
121 Ga0068862_100097950 3300005844 Bacteria 2561
122 Ga0068862_100101316 3300005844 Bacteria 2519
123 Ga0075365_10037603 3300006038 Bacteria 3143
124 Ga0075368_10000835 3300006042 Bacteria 9508
125 Ga0075363_100006123 3300006048 Bacteria 5432
126 Ga0075363_100018034 3300006048 Bacteria 3510
127 Ga0075364_10004453 3300006051 Bacteria 8061
128 Ga0075364_10022381 3300006051 Bacteria 3991
129 Ga0075362_10000011 3300006177 Bacteria 108953
130 Ga0075362_10004038 3300006177 Bacteria 5226
131 Ga0075362_10004729 3300006177 Bacteria 4917
132 Ga0075367_10014378 3300006178 Bacteria 4285
133 Ga0075367_10152480 3300006178 Bacteria 1435
134 Ga0075369_10002638 3300006186 Bacteria 6418
135 Ga0075369_10111158 3300006186 Bacteria 1235
136 Ga0075366_10000190 3300006195 Bacteria 27138
137 Ga0075366_10015707 3300006195 Bacteria 4345
138 Ga0075366_10316520 3300006195 Bacteria 956
139 Ga0075366_10394375 3300006195 Bacteria 852
140 Ga0075370_10000004 3300006353 Bacteria 121166
141 Ga0075370_10002503 3300006353 Bacteria 8532
142 Ga0075370_10137081 3300006353 Bacteria 1430
143 Ga0097620_100003997 3300006931 Bacteria 15032
144 Ga0097620_100180814 3300006931 Bacteria 2192
145 Ga0097620_100373623 3300006931 Bacteria 1521
146 Ga0099794_10011899 3300007265 Bacteria 3740
147 Ga0099794_10014520 3300007265 Unclassified 3452
148 Ga0105251_10035786 3300009011 Bacteria 2447
149 Ga0105251_10050762 3300009011 Bacteria 1980
150 Ga0105250_10008399 3300009092 Bacteria 4387
151 Ga0105240_10002141 3300009093 Bacteria 32242
152 Ga0105240_10452565 3300009093 Bacteria 1436
153 Ga0105240_10932673 3300009093 Bacteria 932
154 Ga0111539_10152453 3300009094 Bacteria 2705
155 Ga0111539_11421027 3300009094 Bacteria 805
156 Ga0105243_10099759 3300009148 Bacteria 2408
157 Ga0105248_10033589 3300009177 Bacteria 5732
158 Ga0105248_10096944 3300009177 Bacteria 3322
159 Ga0105248_10256296 3300009177 Bacteria 1969
160 Ga0105248_10415483 3300009177 Bacteria 1515
161 Ga0105248_11094038 3300009177 Bacteria 901
162 Ga0105248_11568092 3300009177 Bacteria 746
163 Ga0105238_10010117 3300009551 Bacteria 9456
164 Ga0105249_10115235 3300009553 Bacteria 2546
165 Ga0105249_10121602 3300009553 Bacteria 2481
166 Ga0105249_10459933 3300009553 Bacteria 1312
167 Ga0105148_100060 3300009978 Bacteria 17151
168 Ga0105147_104180 3300009982 Bacteria 1209
169 Ga0105239_10421696 3300010375 Bacteria 1512
170 Ga0105239_10522507 3300010375 Bacteria 1350
171 Ga0105239_11020556 3300010375 Bacteria 951
172 Ga0105239_11845567 3300010375 Bacteria 701
173 Ga0105246_10000137 3300011119 Bacteria 34064
174 Ga0157371_10009329 3300013102 Bacteria 7734
175 Ga0157370_10004189 3300013104 Bacteria 16690
176 Ga0157370_10417698 3300013104 Bacteria 1234
177 Ga0157369_10001072 3300013105 Bacteria 34302
178 Ga0163162_10031991 3300013306 Bacteria 5222
179 Ga0163162_10673407 3300013306 Bacteria 1157
180 Ga0163162_10940341 3300013306 Bacteria 976
181 Ga0157372_10004382 3300013307 Bacteria 15061
182 Ga0157372_10183700 3300013307 Bacteria 2421
183 Ga0157375_10402448 3300013308 Bacteria 1535
184 Ga0157375_10901442 3300013308 Bacteria 1028
185 Ga0157380_10088829 3300014326 Bacteria 2544
186 Ga0157380_10182155 3300014326 Bacteria 1847
187 Ga0157380_10650669 3300014326 Bacteria 1051
188 Ga0157380_10891058 3300014326 Bacteria 915
189 Ga0163161_10001177 3300017792 Bacteria 19637
190 Ga0163161_10047745 3300017792 Bacteria 3091
191 Ga0163161_10316574 3300017792 Bacteria 1232
192 Ga0213876_10359334 3300021384 Bacteria 775
193 Ga0209050_1001280 3300025298 Bacteria 28715
194 Ga0207696_1008680 3300025711 Bacteria 3856
195 Ga0207713_1040572 3300025735 Bacteria 1951
196 Ga0207680_10010066 3300025903 Bacteria 4716
197 Ga0207680_10094564 3300025903 Bacteria 1908
198 Ga0207647_10006567 3300025904 Bacteria 8449
199 Ga0207705_10000124 3300025909 Bacteria 85292
200 Ga0207705_10003314 3300025909 Bacteria 12245
201 Ga0207705_10091534 3300025909 Bacteria 2228
202 Ga0207684_10020904 3300025910 Bacteria 5590
203 Ga0207707_10006462 3300025912 Bacteria 10235
204 Ga0207695_10001916 3300025913 Bacteria 32377
205 Ga0207660_10009502 3300025917 Bacteria 6293
206 Ga0207660_10320922 3300025917 Bacteria 1237
207 Ga0207657_10001711 3300025919 Bacteria 23648
208 Ga0207657_10006696 3300025919 Bacteria 11910
209 Ga0207657_10561081 3300025919 Bacteria 892
210 Ga0207652_10001853 3300025921 Bacteria 18346
211 Ga0207652_10016241 3300025921 Bacteria 6074
212 Ga0207652_10021309 3300025921 Bacteria 5349
213 Ga0207652_10321868 3300025921 Bacteria 1396
214 Ga0207646_10000030 3300025922 Bacteria 219473
215 Ga0207681_10000140 3300025923 Bacteria 60064
216 Ga0207681_10000248 3300025923 Bacteria 41061
217 Ga0207681_10002575 3300025923 Bacteria 11500
218 Ga0207681_10006272 3300025923 Bacteria 7300
219 Ga0207681_10049218 3300025923 Bacteria 2848
220 Ga0207694_10161875 3300025924 Bacteria 1808
221 Ga0207650_10128670 3300025925 Bacteria 1979
222 Ga0207659_10915213 3300025926 Bacteria 754
223 Ga0207664_10498883 3300025929 Bacteria 1090
224 Ga0207644_10000004 3300025931 Bacteria 566613
225 Ga0207644_10000293 3300025931 Bacteria 32998
226 Ga0207690_10000640 3300025932 Bacteria 22410
227 Ga0207690_10161671 3300025932 Bacteria 1670
228 Ga0207690_10554577 3300025932 Bacteria 934
229 Ga0207690_10697503 3300025932 Bacteria 834
230 Ga0207706_10003725 3300025933 Bacteria 14537
231 Ga0207706_10007699 3300025933 Bacteria 9944
232 Ga0207706_10056647 3300025933 Bacteria 3455
233 Ga0207709_10239234 3300025935 Bacteria 1320
234 Ga0207711_10018482 3300025941 Bacteria 5796
235 Ga0207711_10027237 3300025941 Bacteria 4801
236 Ga0207711_10038155 3300025941 Bacteria 4084
237 Ga0207711_10338175 3300025941 Bacteria 1393
238 Ga0207661_10028324 3300025944 Bacteria 4289
239 Ga0207661_10350614 3300025944 Bacteria 1332
240 Ga0207661_10375748 3300025944 Bacteria 1286
241 Ga0207679_10170889 3300025945 Bacteria 1789
242 Ga0207667_10004486 3300025949 Bacteria 17094
243 Ga0207667_10021439 3300025949 Bacteria 7159
244 Ga0207667_10103165 3300025949 Bacteria 2942
245 Ga0207667_10234866 3300025949 Bacteria 1877
246 Ga0207667_10379314 3300025949 Bacteria 1441
247 Ga0207712_10057156 3300025961 Bacteria 2751
248 Ga0207712_10116075 3300025961 Bacteria 2016
249 Ga0207712_10725910 3300025961 Bacteria 869
250 Ga0207668_10000038 3300025972 Bacteria 112486
251 Ga0207668_10004934 3300025972 Bacteria 7846
252 Ga0207668_10160088 3300025972 Bacteria 1753
253 Ga0207668_10293211 3300025972 Bacteria 1339
254 Ga0207640_10000964 3300025981 Bacteria 15982
255 Ga0207640_10586688 3300025981 Bacteria 941
256 Ga0207640_10787004 3300025981 Bacteria 823
257 Ga0207658_10000037 3300025986 Bacteria 148087
258 Ga0207658_10000742 3300025986 Bacteria 28124
259 Ga0207658_10005790 3300025986 Bacteria 8456
260 Ga0207658_10098240 3300025986 Bacteria 2287
261 Ga0207658_10174205 3300025986 Bacteria 1775
262 Ga0207703_10002695 3300026035 Bacteria 15231
263 Ga0207703_10027359 3300026035 Bacteria 4491
264 Ga0207703_10484734 3300026035 Bacteria 1159
265 Ga0207703_10514741 3300026035 Bacteria 1125
266 Ga0207639_10001072 3300026041 Bacteria 18552
267 Ga0207639_10003417 3300026041 Bacteria 10681
268 Ga0207639_11048751 3300026041 Bacteria 764
269 Ga0207678_10030552 3300026067 Bacteria 4702
270 Ga0207678_10079055 3300026067 Bacteria 2816
271 Ga0207702_10081347 3300026078 Bacteria 2813
272 Ga0207702_10103396 3300026078 Bacteria 2519
273 Ga0207641_10000050 3300026088 Bacteria 175954
274 Ga0207641_10000113 3300026088 Bacteria 119188
275 Ga0207641_10008467 3300026088 Bacteria 8502
276 Ga0207676_10001272 3300026095 Bacteria 18754
277 Ga0207676_10024807 3300026095 Bacteria 4442
278 Ga0207676_10696163 3300026095 Bacteria 984
279 Ga0207674_10020610 3300026116 Bacteria 7118
280 Ga0207674_10035934 3300026116 Bacteria 5167
281 Ga0207674_10067171 3300026116 Bacteria 3610
282 Ga0207674_10215126 3300026116 Bacteria 1870
283 Ga0207683_10549773 3300026121 Bacteria 1067
284 Ga0207698_10000067 3300026142 Bacteria 70181
285 Ga0207698_10002681 3300026142 Bacteria 10586
286 Ga0207698_10088237 3300026142 Bacteria 2529
287 Ga0207698_10443438 3300026142 Bacteria 1251
288 Ga0209813_10000310 3300027866 Bacteria 13171
289 Ga0207428_10455132 3300027907 Bacteria 933
290 Ga0268266_10000471 3300028379 Bacteria 58314
291 Ga0268266_10002389 3300028379 Bacteria 20264
292 Ga0268266_10019776 3300028379 Bacteria 5738
293 Ga0268266_10149488 3300028379 Bacteria 2104
294 Ga0268266_10226568 3300028379 Bacteria 1720
295 Ga0268265_10034787 3300028380 Bacteria 3675
296 Ga0268265_10075235 3300028380 Bacteria 2644
297 Ga0268265_10086256 3300028380 Bacteria 2494
298 Ga0268265_10352755 3300028380 Bacteria 1344
299 Ga0268264_10000067 3300028381 Bacteria 284445
300 Ga0268264_10019865 3300028381 Bacteria 5489
301 Ga0268264_10025173 3300028381 Bacteria 4862
302 Ga0268264_10065385 3300028381 Bacteria 3064
303 Ga0265331_10011734 3300031250 Bacteria 4788
304 Ga0265327_10072739 3300031251 Bacteria 1716
305 Ga0307408_100560435 3300031548 Bacteria 1009
306 Ga0307508_10049043 3300031616 Bacteria 3761
307 Ga0316576_10066962 3300031727 Bacteria 2643
308 Ga0316578_10037571 3300031728 Bacteria 2790
309 Ga0307405_10154538 3300031731 Bacteria 1617
310 Ga0307405_10180613 3300031731 Bacteria 1515
311 Ga0307405_10249689 3300031731 Bacteria 1319
312 Ga0307405_10280409 3300031731 Bacteria 1254
313 Ga0307405_10518924 3300031731 Bacteria 958
314 Ga0316577_10191609 3300031733 Bacteria 1155
315 Ga0307413_10004455 3300031824 Bacteria 6099
316 Ga0307413_10241458 3300031824 Bacteria 1334
317 Ga0307413_10667714 3300031824 Bacteria 859
318 Ga0307410_10688933 3300031852 Bacteria 860
319 Ga0307406_10035169 3300031901 Bacteria 3079
320 Ga0307407_10069510 3300031903 Bacteria 2090
321 Ga0307407_10111002 3300031903 Bacteria 1721
322 Ga0307412_10010943 3300031911 Bacteria 5238
323 Ga0307412_10012788 3300031911 Bacteria 4900
324 Ga0307412_10116247 3300031911 Bacteria 1919
325 Ga0307412_10124550 3300031911 Bacteria 1861
326 Ga0307412_10127901 3300031911 Bacteria 1840
327 Ga0307412_10201990 3300031911 Bacteria 1510
328 Ga0307412_10263890 3300031911 Bacteria 1344
329 Ga0307409_100013413 3300031995 Bacteria 5274
330 Ga0307409_100135747 3300031995 Bacteria 2111
331 Ga0307409_100649484 3300031995 Bacteria 1049
332 Ga0307409_100816693 3300031995 Bacteria 941
333 Ga0307416_100026372 3300032002 Bacteria 4281
334 Ga0307416_100051704 3300032002 Bacteria 3284
335 Ga0307416_100085761 3300032002 Bacteria 2681
336 Ga0307416_100171076 3300032002 Bacteria 2022
337 Ga0307416_100964419 3300032002 Bacteria 955
338 Ga0307414_10223372 3300032004 Bacteria 1548
339 Ga0307414_10289246 3300032004 Bacteria 1381
340 Ga0307414_10310869 3300032004 Bacteria 1337
341 Ga0307414_10374365 3300032004 Bacteria 1229
342 Ga0307414_10416092 3300032004 Bacteria 1171
343 Ga0307411_10052013 3300032005 Bacteria 2676
344 Ga0307411_10064585 3300032005 Bacteria 2451
345 Ga0307415_100065570 3300032126 Bacteria 2531
346 Ga0307415_100164675 3300032126 Bacteria 1723
347 Ga0307415_100606850 3300032126 Bacteria 975
348 Ga0316583_10009059 3300032133 Bacteria 3589
349 Ga0373935_0310962 3300035692 Bacteria 1116
350 Ga0316584_0001254 3300036712 Bacteria 15002
351 Ga0316584_0278705 3300036712 Bacteria 1215
352 Ga0451841_1142172 3300041498 Bacteria 960
353 Ga0439443_000582 3300042003 Bacteria 3392
354 Ga0439462_0002205 3300042015 Bacteria 4493
355 Ga0450912_000634 3300042116 Bacteria 1829
356 Ga0451577_0029760 3300042876 Bacteria 4935
357 Ga0451577_0058037 3300042876 Bacteria 3450
358 Ga0451577_0265959 3300042876 Bacteria 1553
359 Ga0451576_0000041 3300045051 Bacteria 343432
360 Ga0451576_0149612 3300045051 Bacteria 2435
361 Ga0495617_006059 3300046452 Bacteria 4261
362 Ga0495627_000036 3300046453 Bacteria 205589
363 Ga0495627_000090 3300046453 Bacteria 109622
364 Ga0495627_000287 3300046453 Bacteria 50673
365 Ga0495638_0000018 3300046460 Bacteria 389696
366 Ga0495638_0012417 3300046460 Bacteria 5840
367 Ga0495638_0021887 3300046460 Bacteria 4203
368 Ga0495638_0035364 3300046460 Bacteria 3185
369 Ga0495650_0000684 3300046471 Bacteria 43971
370 Ga0495650_0001816 3300046471 Bacteria 19170
371 Ga0495605_0147159 3300046474 Bacteria 1053
372 Ga0495596_0000514 3300046500 Bacteria 24581
373 Ga0495583_0000252 3300046506 Bacteria 88617
374 Ga0495606_0028851 3300046507 Bacteria 3907
375 Ga0495610_0000015 3300046512 Bacteria 391489
376 Ga0495610_0000079 3300046512 Bacteria 115816
377 Ga0495610_0006491 3300046512 Bacteria 8036
378 Ga0495610_0049243 3300046512 Bacteria 2064
379 Ga0495616_0000010 3300046513 Bacteria 224378
380 Ga0495616_0055978 3300046513 Bacteria 1950
381 Ga0495616_0078964 3300046513 Bacteria 1578
382 Ga0495620_0013186 3300046515 Bacteria 4240
383 Ga0495632_0000095 3300046519 Bacteria 89499
384 Ga0495632_0000668 3300046519 Bacteria 31348
385 Ga0495632_0001502 3300046519 Bacteria 19288
386 Ga0495637_0015335 3300046520 Bacteria 3595
387 Ga0495643_0000038 3300046522 Bacteria 236010
388 Ga0495643_0110037 3300046522 Bacteria 1401
389 Ga0495648_0000018 3300046524 Bacteria 282490
390 Ga0495648_0050809 3300046524 Bacteria 2530
391 Ga0495648_0121687 3300046524 Bacteria 1402
392 Ga0495663_0000028 3300046525 Bacteria 89526
393 Ga0495663_0105460 3300046525 Bacteria 932
394 Ga0495654_0085627 3300046530 Bacteria 1470
395 Ga0495621_0021524 3300046539 Bacteria 2126
396 Ga0495597_0099982 3300046542 Bacteria 1224
397 Ga0495633_0000340 3300046558 Bacteria 52440
398 Ga0495633_0003319 3300046558 Bacteria 10807
399 Ga0495633_0014337 3300046558 Bacteria 4148
400 Ga0495633_0083397 3300046558 Bacteria 1487
401 Ga0495668_0004472 3300046616 Bacteria 9913
402 Ga0495668_0115234 3300046616 Bacteria 1470
403 Ga0495625_0035505 3300046660 Bacteria 3674
404 Ga0495670_0060810 3300046691 Bacteria 1898
405 Ga0495670_0118043 3300046691 Bacteria 1377
406 Ga0495671_0000011 3300046692 Bacteria 365582
407 Ga0495671_0000027 3300046692 Bacteria 236011
408 Ga0495636_0351247 3300047318 Bacteria 696
409 Ga0495672_0055696 3300047320 Bacteria 2306
410 Ga0495673_0000013 3300047469 Bacteria 612902
411 Ga0495681_0000048 3300047470 Bacteria 110216
412 Ga0495681_0015420 3300047470 Bacteria 4323
413 Ga0495686_0088975 3300047472 Bacteria 1876
414 Ga0495615_0000085 3300048090 Bacteria 27694
415 Ga0495615_0006709 3300048090 Bacteria 2150
416 Ga0495626_0000301 3300048091 Bacteria 52582
417 Ga0496100_0042720 3300048903 Bacteria 2896
418 Ga0496101_0422656 3300048904 Bacteria 1050
419 Ga0496102_0000267 3300048905 Bacteria 66761
420 Ga0496102_0095938 3300048905 Bacteria 2749
421 Ga0496102_0379665 3300048905 Bacteria 1330
422 Ga0496102_0407299 3300048905 Bacteria 1278
423 Ga0496103_0000139 3300048906 Bacteria 75158
424 Ga0496103_0185796 3300048906 Bacteria 1336
425 Ga0496104_0001996 3300048907 Bacteria 17709
426 Ga0496104_0115660 3300048907 Bacteria 2573
427 Ga0496105_0000099 3300048908 Bacteria 59095
428 Ga0496105_0000931 3300048908 Bacteria 19939
429 Ga0496105_0103808 3300048908 Bacteria 2348
430 Ga0496105_0370236 3300048908 Bacteria 1142
431 Ga0496106_0005710 3300048909 Bacteria 9205
432 Ga0496107_0005493 3300048910 Bacteria 8674
433 Ga0496108_0001061 3300048911 Bacteria 21446
434 Ga0496108_0062185 3300048911 Bacteria 3144
435 Ga0496108_0267144 3300048911 Bacteria 1489
436 Ga0496108_0647801 3300048911 Bacteria 918
437 Ga0496109_0006311 3300048912 Bacteria 9982
438 Ga0496109_0144936 3300048912 Bacteria 2221
439 Ga0496109_0516695 3300048912 Bacteria 1127
440 Ga0496110_0035237 3300048913 Bacteria 4341
441 Ga0496110_0209844 3300048913 Bacteria 1770
442 Ga0496111_0197413 3300048914 Bacteria 1496
443 Ga0496112_0075216 3300048915 Bacteria 3340
444 Ga0496113_0002241 3300048916 Bacteria 11153
445 Ga0496113_0004509 3300048916 Bacteria 8576
446 Ga0496113_0151215 3300048916 Bacteria 1831
447 Ga0496114_0037945 3300048917 Bacteria 3986
448 Ga0496114_0049349 3300048917 Bacteria 3502
449 Ga0496116_0000284 3300048919 Bacteria 86342
450 Ga0496116_0017593 3300048919 Bacteria 5540
451 Ga0496116_0179780 3300048919 Bacteria 1134
452 Ga0496116_0199057 3300048919 Bacteria 1050
453 Ga0496117_0008650 3300048920 Bacteria 9634
454 Ga0496117_0011000 3300048920 Bacteria 8147
455 Ga0496118_0002469 3300048921 Bacteria 24817
456 Ga0496118_0009747 3300048921 Bacteria 9635
457 Ga0496118_0011449 3300048921 Bacteria 8656
458 Ga0496118_0023847 3300048921 Bacteria 5301
459 Ga0496118_0027158 3300048921 Bacteria 4852
460 Ga0496119_0004210 3300048922 Bacteria 14446
461 Ga0496119_0034803 3300048922 Bacteria 3309
462 Ga0496120_0003080 3300048923 Bacteria 15717
463 Ga0496120_0062824 3300048923 Bacteria 2068
464 Ga0496121_0000070 3300048924 Bacteria 249187
465 Ga0496121_0000196 3300048924 Bacteria 135812
466 Ga0496121_0000349 3300048924 Bacteria 96428
467 Ga0496121_0009274 3300048924 Bacteria 11352
468 Ga0496121_0013822 3300048924 Bacteria 8640
469 Ga0496121_0044160 3300048924 Bacteria 3849
470 Ga0496122_0005423 3300048925 Bacteria 15204
471 Ga0496122_0014411 3300048925 Bacteria 7647
472 Ga0496122_0014622 3300048925 Bacteria 7574
473 Ga0496122_0020731 3300048925 Bacteria 5920
474 Ga0496122_0122617 3300048925 Bacteria 1672
475 Ga0496123_0002007 3300048926 Bacteria 26274
476 Ga0496123_0002479 3300048926 Bacteria 22782
477 Ga0496123_0002794 3300048926 Bacteria 20744
478 Ga0496123_0020758 3300048926 Bacteria 5128
479 Ga0496124_0001485 3300048927 Bacteria 34464
480 Ga0496124_0001730 3300048927 Bacteria 30704
481 Ga0496124_0012138 3300048927 Bacteria 8537
482 Ga0496124_0050666 3300048927 Bacteria 3537
483 Ga0496124_0216079 3300048927 Bacteria 1446
484 Ga0496125_0004923 3300048928 Bacteria 15118
485 Ga0496125_0039262 3300048928 Bacteria 4079
486 Ga0496125_0047887 3300048928 Bacteria 3569
487 Ga0496125_0051774 3300048928 Bacteria 3382
488 Ga0496125_0061297 3300048928 Bacteria 3017
489 Ga0496125_0283150 3300048928 Bacteria 1025
490 Ga0496126_0000619 3300048929 Bacteria 66827
491 Ga0496126_0001049 3300048929 Bacteria 46719
492 Ga0496126_0013243 3300048929 Bacteria 8408
493 Ga0496126_0065901 3300048929 Bacteria 3239
494 Ga0496126_0074592 3300048929 Bacteria 3012
495 Ga0496126_0094469 3300048929 Bacteria 2624
496 Ga0496126_0125435 3300048929 Bacteria 2222
497 Ga0501335_000497 3300049551 Bacteria 2548
498 Ga0501034_0424627 3300049571 Bacteria 1250
499 Ga0501046_0541374 3300049580 Bacteria 831
500 Ga0501047_0247065 3300049581 Bacteria 1633
501 Ga0501206_029386 3300049653 Bacteria 812
502 Ga0501211_006895 3300049658 Bacteria 1119
503 Ga0501223_000042 3300049663 Bacteria 44258
504 Ga0501224_004106 3300049664 Bacteria 2054
505 Ga0501246_003170 3300049676 Bacteria 1320
506 Ga0501225_0000520 3300049705 Bacteria 12018
507 Ga0501225_0018318 3300049705 Bacteria 1941
508 Ga0501245_043415 3300049708 Bacteria 779
509 Ga0501044_0158081 3300049823 Bacteria 2245
510 Ga0501044_0352785 3300049823 Bacteria 1390
511 Ga0501044_1007331 3300049823 Bacteria 705
512 nmdc:mga03683_2313_c1 3300050489 Bacteria 5901
513 nmdc:mga03683_31_c1 3300050489 Bacteria 69502
514 nmdc:mga03683_68461_c1 3300050489 Bacteria 1513
515 nmdc:mga00v17_19037_c1 3300050491 Bacteria 3912
516 nmdc:mga00v17_4522_c1 3300050491 Bacteria 7242
517 nmdc:mga00v17_526732_c1 3300050491 Bacteria 765
518 nmdc:mga0k408_18_c1 3300050493 Bacteria 112318
519 nmdc:mga0k408_20416_c1 3300050493 Bacteria 3710
520 nmdc:mga0k408_50046_c1 3300050493 Bacteria 2419
521 nmdc:mga06z11_21176_c1 3300050494 Bacteria 3018
522 nmdc:mga06z11_71730_c1 3300050494 Bacteria 1834
523 nmdc:mga04h51_641_c1 3300050495 Bacteria 8181
524 nmdc:mga07m45_1083_c1 3300050496 Bacteria 12127
525 nmdc:mga07m45_19_c1 3300050496 Bacteria 133476
526 nmdc:mga07m45_7_c1 3300050496 Bacteria 223540
527 nmdc:mga07m45_96284_c1 3300050496 Bacteria 1698
528 nmdc:mga08y16_246001_c1 3300050511 Bacteria 1848
529 nmdc:mga0sz30_1125_c2 3300050516 Bacteria 7973
530 nmdc:mga0sz30_21843_c1 3300050516 Bacteria 2593
531 nmdc:mga0sz30_4304_c1 3300050516 Bacteria 5137
532 nmdc:mga0sz30_79002_c1 3300050516 Bacteria 1422
533 Ga0500643_000005 3300053087 Bacteria 539775
534 Ga0500643_000578 3300053087 Bacteria 25456
535 Ga0500647_0053005 3300053091 Bacteria 1952
536 Ga0500593_048024 3300053117 Bacteria 1899
537 Ga0500607_000395 3300053121 Bacteria 41884
538 Ga0500607_000854 3300053121 Bacteria 29366
539 Ga0500608_001181 3300053122 Bacteria 9303
540 Ga0500618_072525 3300053125 Bacteria 772
541 Ga0500559_0001264 3300053136 Bacteria 14808
542 Ga0500559_0005461 3300053136 Bacteria 5846
543 Ga0500559_0014781 3300053136 Bacteria 3297
544 Ga0500559_0018606 3300053136 Bacteria 2935
545 Ga0500564_004287 3300053138 Bacteria 5686
546 Ga0500588_0103261 3300053146 Bacteria 985
547 Ga0500590_000464 3300053148 Bacteria 13814
548 Ga0500604_0002273 3300053151 Bacteria 5257
549 Ga0500616_0006349 3300053153 Bacteria 7758
550 Ga0500622_0000901 3300053156 Bacteria 25291
551 Ga0500624_000009 3300053157 Bacteria 178763
552 Ga0500627_0013461 3300053158 Bacteria 3103
553 Ga0500567_008334 3300053723 Bacteria 4901
554 Ga0500625_000009 3300053729 Bacteria 159296
555 Ga0500645_019583 3300053730 Bacteria 2104
556 Ga0500661_006212 3300055283 Bacteria 2225
557 2643951896 2643221588 Bacteria 3692460
558 2738709872 2738541275 Bacteria 4830863
559 2738848297 2738541301 Bacteria 4834102
560 2738864026 2738541304 Bacteria 4833665
561 2739296544 2738543022 Bacteria 4835059
562 2739358222 2738543033 Bacteria 4833336
563 2739649282 2739367664 Bacteria 4114334
564 2740027755 2739367865 Bacteria 4114482
565 2778123846 2775507255 Bacteria 3945731
566 2809064824 2808606401 Bacteria 4586670
567 2809080791 2808606404 Bacteria 4652788
568 2809085156 2808606405 Bacteria 4586632
569 2819552898 2818991438 Bacteria 5793701
570 2880521854 2880518877 Bacteria 5012590
571 2882806848 2882806704 Bacteria 3007728
572 2895884356 2895880812 Bacteria 11255272
573 2896185584 2896184354 Bacteria 3258548
574 2896256438 2896253425 Bacteria 3418029
575 2919142492 2919138771 Bacteria 5281312
576 2919711341 2919709256 Bacteria 4318106
577 2928101420 2928100450 Bacteria 4837635
578 2928960168 2928959182 Bacteria 4725774
579 8054306878 8054302542 Bacteria 5698134
580 nmdc:mga0sz30_71987_c1
581 SwRhRL2b_contig_3660702
582 SwRhRL2b_contig_52241
583 SwRhRL2b_contig_818409
584 SwRhRL2b_contig_86134
585 JGI24751J29686_10000959
586 Ga0055530_10013236
587 Ga0065704_10000192
588 Ga0065704_10000914
589 Ga0065704_10002639
590 Ga0065704_10077790
591 Ga0065707_10084356
592 Ga0065707_10096811
593 Ga0065707_10104842
594 Ga0070658_10000068
595 Ga0070658_10085409
596 Ga0070658_10150714
597 Ga0070658_10155541
598 Ga0070658_10189447
599 Ga0070658_10225292
600 Ga0070676_10202387
601 Ga0070670_100193875
602 Ga0070670_100557345
603 Ga0070666_10021059
604 Ga0070666_10048564
605 Ga0070666_10384913
606 Ga0070680_100001683
607 Ga0070682_100076327
608 Ga0070660_100002033
609 Ga0070660_100023602
610 Ga0070660_100329392
611 Ga0070660_100333879
612 Ga0070661_100001882
613 Ga0070692_10069787
614 Ga0070668_100000041
615 Ga0070668_100008132
616 Ga0070668_100093257
617 Ga0070669_100000184
618 Ga0070669_100000472
619 Ga0070669_100005445
620 Ga0070669_100014945
621 Ga0070669_100055560
622 Ga0070671_100000067
623 Ga0070671_100002891
624 Ga0070671_100003218
625 Ga0070659_100081282
626 Ga0070659_100146554
627 Ga0070659_100212798
628 Ga0070667_100000058
629 Ga0070667_100003664
630 Ga0070667_100016472
631 Ga0070667_100417529
632 Ga0070714_100584935
633 Ga0070705_100077235
634 Ga0070708_100456732
635 Ga0070663_100482421
636 Ga0070663_100674221
637 Ga0070678_100213532
638 Ga0070662_100001446
639 Ga0070662_100089396
640 Ga0070662_100233072
641 Ga0070681_10008385
642 Ga0070685_10060467
643 Ga0070706_100012712
644 Ga0070707_100000042
645 Ga0070698_100076640
646 Ga0070699_100161579
647 Ga0070679_100005037
648 Ga0070679_100151775
649 Ga0070684_100090919
650 Ga0070684_100124594
651 Ga0070697_100073278
652 Ga0070697_100178460
653 Ga0068853_100000329
654 Ga0068853_100002549
655 Ga0068853_100039895
656 Ga0068853_100171816
657 Ga0068853_100299492
658 Ga0070686_100095853
659 Ga0070665_100007174
660 Ga0070665_100010368
661 Ga0070665_100289943
662 Ga0068855_100018885
663 Ga0068855_100028086
664 Ga0068855_100034692
665 Ga0068855_100057353
666 Ga0068855_100194078
667 Ga0068855_100289830
668 Ga0070664_100016772
669 Ga0068857_100013486
670 Ga0068857_100059453
671 Ga0068857_100112239
672 Ga0068857_100162242
673 Ga0068854_100018657
674 Ga0068856_100007858
675 Ga0068856_100239996
676 Ga0068852_100000358
677 Ga0068852_100038220
678 Ga0068852_100052082
679 Ga0068852_100724675
680 Ga0068859_100003997
681 Ga0068859_100180814
682 Ga0068859_100373655
683 Ga0068864_100032465
684 Ga0068864_100346051
685 Ga0068863_100000031
686 Ga0068863_100000103
687 Ga0068863_100007418
688 Ga0068858_100001121
689 Ga0068858_100031111
690 Ga0068858_100443443
691 Ga0068858_100550402
692 Ga0068858_100635117
693 Ga0068860_100000093
694 Ga0068860_100035617
695 Ga0068860_100046702
696 Ga0068860_100061302
697 Ga0068860_100091656
698 Ga0068860_100135237
699 Ga0068860_100703928
700 Ga0068862_100097950
701 Ga0068862_100101316
702 Ga0075365_10037603
703 Ga0075368_10000835
704 Ga0075363_100006123
705 Ga0075363_100018034
706 Ga0075364_10004453
707 Ga0075364_10022381
708 Ga0075362_10000011
709 Ga0075362_10004038
710 Ga0075362_10004729
711 Ga0075367_10014378
712 Ga0075367_10152480
713 Ga0075369_10002638
714 Ga0075369_10111158
715 Ga0075366_10000190
716 Ga0075366_10015707
717 Ga0075366_10316520
718 Ga0075366_10394375
719 Ga0075370_10000004
720 Ga0075370_10002503
721 Ga0075370_10137081
722 Ga0097620_100003997
723 Ga0097620_100180814
724 Ga0097620_100373623
725 Ga0099794_10011899
726 Ga0099794_10014520
727 Ga0105251_10035786
728 Ga0105251_10050762
729 Ga0105250_10008399
730 Ga0105240_10002141
731 Ga0105240_10452565
732 Ga0105240_10932673
733 Ga0111539_10152453
734 Ga0111539_11421027
735 Ga0105243_10099759
736 Ga0105248_10033589
737 Ga0105248_10096944
738 Ga0105248_10256296
739 Ga0105248_10415483
740 Ga0105248_11094038
741 Ga0105248_11568092
742 Ga0105238_10010117
743 Ga0105249_10115235
744 Ga0105249_10121602
745 Ga0105249_10459933
746 Ga0105148_100060
747 Ga0105147_104180
748 Ga0105239_10421696
749 Ga0105239_10522507
750 Ga0105239_11020556
751 Ga0105239_11845567
752 Ga0105246_10000137
753 Ga0157371_10009329
754 Ga0157370_10004189
755 Ga0157370_10417698
756 Ga0157369_10001072
757 Ga0163162_10031991
758 Ga0163162_10673407
759 Ga0163162_10940341
760 Ga0157372_10004382
761 Ga0157372_10183700
762 Ga0157375_10402448
763 Ga0157375_10901442
764 Ga0157380_10088829
765 Ga0157380_10182155
766 Ga0157380_10650669
767 Ga0157380_10891058
768 Ga0163161_10001177
769 Ga0163161_10047745
770 Ga0163161_10316574
771 Ga0213876_10359334
772 Ga0209050_1001280
773 Ga0207696_1008680
774 Ga0207713_1040572
775 Ga0207680_10010066
776 Ga0207680_10094564
777 Ga0207647_10006567
778 Ga0207705_10000124
779 Ga0207705_10003314
780 Ga0207705_10091534
781 Ga0207684_10020904
782 Ga0207707_10006462
783 Ga0207695_10001916
784 Ga0207660_10009502
785 Ga0207660_10320922
786 Ga0207657_10001711
787 Ga0207657_10006696
788 Ga0207657_10561081
789 Ga0207652_10001853
790 Ga0207652_10016241
791 Ga0207652_10021309
792 Ga0207652_10321868
793 Ga0207646_10000030
794 Ga0207681_10000140
795 Ga0207681_10000248
796 Ga0207681_10002575
797 Ga0207681_10006272
798 Ga0207681_10049218
799 Ga0207694_10161875
800 Ga0207650_10128670
801 Ga0207659_10915213
802 Ga0207664_10498883
803 Ga0207644_10000004
804 Ga0207644_10000293
805 Ga0207690_10000640
806 Ga0207690_10161671
807 Ga0207690_10554577
808 Ga0207690_10697503
809 Ga0207706_10003725
810 Ga0207706_10007699
811 Ga0207706_10056647
812 Ga0207709_10239234
813 Ga0207711_10018482
814 Ga0207711_10027237
815 Ga0207711_10038155
816 Ga0207711_10338175
817 Ga0207661_10028324
818 Ga0207661_10350614
819 Ga0207661_10375748
820 Ga0207679_10170889
821 Ga0207667_10004486
822 Ga0207667_10021439
823 Ga0207667_10103165
824 Ga0207667_10234866
825 Ga0207667_10379314
826 Ga0207712_10057156
827 Ga0207712_10116075
828 Ga0207712_10725910
829 Ga0207668_10000038
830 Ga0207668_10004934
831 Ga0207668_10160088
832 Ga0207668_10293211
833 Ga0207640_10000964
834 Ga0207640_10586688
835 Ga0207640_10787004
836 Ga0207658_10000037
837 Ga0207658_10000742
838 Ga0207658_10005790
839 Ga0207658_10098240
840 Ga0207658_10174205
841 Ga0207703_10002695
842 Ga0207703_10027359
843 Ga0207703_10484734
844 Ga0207703_10514741
845 Ga0207639_10001072
846 Ga0207639_10003417
847 Ga0207639_11048751
848 Ga0207678_10030552
849 Ga0207678_10079055
850 Ga0207702_10081347
851 Ga0207702_10103396
852 Ga0207641_10000050
853 Ga0207641_10000113
854 Ga0207641_10008467
855 Ga0207676_10001272
856 Ga0207676_10024807
857 Ga0207676_10696163
858 Ga0207674_10020610
859 Ga0207674_10035934
860 Ga0207674_10067171
861 Ga0207674_10215126
862 Ga0207683_10549773
863 Ga0207698_10000067
864 Ga0207698_10002681
865 Ga0207698_10088237
866 Ga0207698_10443438
867 Ga0209813_10000310
868 Ga0207428_10455132
869 Ga0268266_10000471
870 Ga0268266_10002389
871 Ga0268266_10019776
872 Ga0268266_10149488
873 Ga0268266_10226568
874 Ga0268265_10034787
875 Ga0268265_10075235
876 Ga0268265_10086256
877 Ga0268265_10352755
878 Ga0268264_10000067
879 Ga0268264_10019865
880 Ga0268264_10025173
881 Ga0268264_10065385
882 Ga0265331_10011734
883 Ga0265327_10072739
884 Ga0307408_100560435
885 Ga0307508_10049043
886 Ga0316576_10066962
887 Ga0316578_10037571
888 Ga0307405_10154538
889 Ga0307405_10180613
890 Ga0307405_10249689
891 Ga0307405_10280409
892 Ga0307405_10518924
893 Ga0316577_10191609
894 Ga0307413_10004455
895 Ga0307413_10241458
896 Ga0307413_10667714
897 Ga0307410_10688933
898 Ga0307406_10035169
899 Ga0307407_10069510
900 Ga0307407_10111002
901 Ga0307412_10010943
902 Ga0307412_10012788
903 Ga0307412_10116247
904 Ga0307412_10124550
905 Ga0307412_10127901
906 Ga0307412_10201990
907 Ga0307412_10263890
908 Ga0307409_100013413
909 Ga0307409_100135747
910 Ga0307409_100649484
911 Ga0307409_100816693
912 Ga0307416_100026372
913 Ga0307416_100051704
914 Ga0307416_100085761
915 Ga0307416_100171076
916 Ga0307416_100964419
917 Ga0307414_10223372
918 Ga0307414_10289246
919 Ga0307414_10310869
920 Ga0307414_10374365
921 Ga0307414_10416092
922 Ga0307411_10052013
923 Ga0307411_10064585
924 Ga0307415_100065570
925 Ga0307415_100164675
926 Ga0307415_100606850
927 Ga0316583_10009059
928 Ga0373935_0310962
929 Ga0316584_0001254
930 Ga0316584_0278705
931 Ga0451841_1142172
932 Ga0439443_000582
933 Ga0439462_0002205
934 Ga0450912_000634
935 Ga0451577_0029760
936 Ga0451577_0058037
937 Ga0451577_0265959
938 Ga0451576_0000041
939 Ga0451576_0149612
940 Ga0495617_006059
941 Ga0495627_000036
942 Ga0495627_000090
943 Ga0495627_000287
944 Ga0495638_0000018
945 Ga0495638_0012417
946 Ga0495638_0021887
947 Ga0495638_0035364
948 Ga0495650_0000684
949 Ga0495650_0001816
950 Ga0495605_0147159
951 Ga0495596_0000514
952 Ga0495583_0000252
953 Ga0495606_0028851
954 Ga0495610_0000015
955 Ga0495610_0000079
956 Ga0495610_0006491
957 Ga0495610_0049243
958 Ga0495616_0000010
959 Ga0495616_0055978
960 Ga0495616_0078964
961 Ga0495620_0013186
962 Ga0495632_0000095
963 Ga0495632_0000668
964 Ga0495632_0001502
965 Ga0495637_0015335
966 Ga0495643_0000038
967 Ga0495643_0110037
968 Ga0495648_0000018
969 Ga0495648_0050809
970 Ga0495648_0121687
971 Ga0495663_0000028
972 Ga0495663_0105460
973 Ga0495654_0085627
974 Ga0495621_0021524
975 Ga0495597_0099982
976 Ga0495633_0000340
977 Ga0495633_0003319
978 Ga0495633_0014337
979 Ga0495633_0083397
980 Ga0495668_0004472
981 Ga0495668_0115234
982 Ga0495625_0035505
983 Ga0495670_0060810
984 Ga0495670_0118043
985 Ga0495671_0000011
986 Ga0495671_0000027
987 Ga0495636_0351247
988 Ga0495672_0055696
989 Ga0495673_0000013
990 Ga0495681_0000048
991 Ga0495681_0015420
992 Ga0495686_0088975
993 Ga0495615_0000085
994 Ga0495615_0006709
995 Ga0495626_0000301
996 Ga0496100_0042720
997 Ga0496101_0422656
998 Ga0496102_0000267
999 Ga0496102_0095938
1000 Ga0496102_0379665
1001 Ga0496102_0407299
1002 Ga0496103_0000139
1003 Ga0496103_0185796
1004 Ga0496104_0001996
1005 Ga0496104_0115660
1006 Ga0496105_0000099
1007 Ga0496105_0000931
1008 Ga0496105_0103808
1009 Ga0496105_0370236
1010 Ga0496106_0005710
1011 Ga0496107_0005493
1012 Ga0496108_0001061
1013 Ga0496108_0062185
1014 Ga0496108_0267144
1015 Ga0496108_0647801
1016 Ga0496109_0006311
1017 Ga0496109_0144936
1018 Ga0496109_0516695
1019 Ga0496110_0035237
1020 Ga0496110_0209844
1021 Ga0496111_0197413
1022 Ga0496112_0075216
1023 Ga0496113_0002241
1024 Ga0496113_0004509
1025 Ga0496113_0151215
1026 Ga0496114_0037945
1027 Ga0496114_0049349
1028 Ga0496116_0000284
1029 Ga0496116_0017593
1030 Ga0496116_0179780
1031 Ga0496116_0199057
1032 Ga0496117_0008650
1033 Ga0496117_0011000
1034 Ga0496118_0002469
1035 Ga0496118_0009747
1036 Ga0496118_0011449
1037 Ga0496118_0023847
1038 Ga0496118_0027158
1039 Ga0496119_0004210
1040 Ga0496119_0034803
1041 Ga0496120_0003080
1042 Ga0496120_0062824
1043 Ga0496121_0000070
1044 Ga0496121_0000196
1045 Ga0496121_0000349
1046 Ga0496121_0009274
1047 Ga0496121_0013822
1048 Ga0496121_0044160
1049 Ga0496122_0005423
1050 Ga0496122_0014411
1051 Ga0496122_0014622
1052 Ga0496122_0020731
1053 Ga0496122_0122617
1054 Ga0496123_0002007
1055 Ga0496123_0002479
1056 Ga0496123_0002794
1057 Ga0496123_0020758
1058 Ga0496124_0001485
1059 Ga0496124_0001730
1060 Ga0496124_0012138
1061 Ga0496124_0050666
1062 Ga0496124_0216079
1063 Ga0496125_0004923
1064 Ga0496125_0039262
1065 Ga0496125_0047887
1066 Ga0496125_0051774
1067 Ga0496125_0061297
1068 Ga0496125_0283150
1069 Ga0496126_0000619
1070 Ga0496126_0001049
1071 Ga0496126_0013243
1072 Ga0496126_0065901
1073 Ga0496126_0074592
1074 Ga0496126_0094469
1075 Ga0496126_0125435
1076 Ga0501335_000497
1077 Ga0501034_0424627
1078 Ga0501046_0541374
1079 Ga0501047_0247065
1080 Ga0501206_029386
1081 Ga0501211_006895
1082 Ga0501223_000042
1083 Ga0501224_004106
1084 Ga0501246_003170
1085 Ga0501225_0000520
1086 Ga0501225_0018318
1087 Ga0501245_043415
1088 Ga0501044_0158081
1089 Ga0501044_0352785
1090 Ga0501044_1007331
1091 nmdc:mga03683_2313_c1
1092 nmdc:mga03683_31_c1
1093 nmdc:mga03683_68461_c1
1094 nmdc:mga00v17_19037_c1
1095 nmdc:mga00v17_4522_c1
1096 nmdc:mga00v17_526732_c1
1097 nmdc:mga0k408_18_c1
1098 nmdc:mga0k408_20416_c1
1099 nmdc:mga0k408_50046_c1
1100 nmdc:mga06z11_21176_c1
1101 nmdc:mga06z11_71730_c1
1102 nmdc:mga04h51_641_c1
1103 nmdc:mga07m45_1083_c1
1104 nmdc:mga07m45_19_c1
1105 nmdc:mga07m45_7_c1
1106 nmdc:mga07m45_96284_c1
1107 nmdc:mga08y16_246001_c1
1108 nmdc:mga0sz30_1125_c2
1109 nmdc:mga0sz30_21843_c1
1110 nmdc:mga0sz30_4304_c1
1111 nmdc:mga0sz30_79002_c1
1112 Ga0500643_000005
1113 Ga0500643_000578
1114 Ga0500647_0053005
1115 Ga0500593_048024
1116 Ga0500607_000395
1117 Ga0500607_000854
1118 Ga0500608_001181
1119 Ga0500618_072525
1120 Ga0500559_0001264
1121 Ga0500559_0005461
1122 Ga0500559_0014781
1123 Ga0500559_0018606
1124 Ga0500564_004287
1125 Ga0500588_0103261
1126 Ga0500590_000464
1127 Ga0500604_0002273
1128 Ga0500616_0006349
1129 Ga0500622_0000901
1130 Ga0500624_000009
1131 Ga0500627_0013461
1132 Ga0500567_008334
1133 Ga0500625_000009
1134 Ga0500645_019583
1135 Ga0500661_006212
1136 2643951896
1137 2738709872
1138 2738848297
1139 2738864026
1140 2739296544
1141 2739358222
1142 2739649282
1143 2740027755
1144 2778123846
1145 2809064824
1146 2809080791
1147 2809085156
1148 2819552898
1149 2880521854
1150 2882806848
1151 2895884356
1152 2896185584
1153 2896256438
1154 2919142492
1155 2919711341
1156 2928101420
1157 2928960168
1158 8054306878

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

32

233

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wjz-assembly1.cif.gz_B crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity 0.9142 1 204
2wjz-assembly3.cif.gz_D crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity 0.9107 1 204
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.9083 2 204
7ac8-assembly3.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9007 1 204
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9 1 205
ID Description Score Start End Superfamily
af_Q2FUU1_1_190_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9336 3 204 3.40.50.880
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9293 3 205 3.40.50.880
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9202 3 205 3.40.50.880
2wjzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9142 1 204 3.40.50.880
af_Q2FUU1_1_190_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9055 3 204 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2N0HJH8-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9914 2 207 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A6I5WUX0-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9886 2 207 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A844YIT3-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9884 2 207 GO:0000105
GO:0000107
GO:0005737
GO:0006541
GO:0016787
GO:0016829
AF-A0A2W6SFJ3-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9877 1 207 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A3D0WL32-F1-model_v4 deleted 0.9834 29 207

Map