F465879
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 579 | 271 | 1158 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300050516|nmdc:mga0sz30_71987_c1|nmdc:mga0sz30_71987_c1_763_1470 |
| Length | 235 |
| Sequence | MRAGRALLRVLRQAQHEWVDSKGAAGMADTLALVDYGAGNLRSVANALKAAGAGNVVVTADPNVVRTADRIVLPGVGAFRSCIESLFAVSGLVEAMEERVQVGGAPFLGICVGMQLLADRGIEFGTTEGLGWIGGEVRVIEPADPSIKVPHMGWNDVSLGRHDRSGGLIEPGEAYFLHSYHFVPEDGHDIAAMSDHGGGIVAAVARDNILGVQFHPEKSQSYGLALLARFLEWKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 52 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 62 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 71 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 83 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 129 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 130 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 131 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 132 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 133 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 134 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 135 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 136 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 137 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 138 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 139 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 140 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 141 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 142 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 143 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 144 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 145 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 146 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 148 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 149 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 150 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 151 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 152 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 153 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 154 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 188 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 189 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 190 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 191 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 192 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 193 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 196 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 197 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 198 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 199 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 200 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 201 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 202 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 203 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 204 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 205 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 206 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 207 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 208 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 209 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 210 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 211 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 216 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 217 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 218 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 220 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 221 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 222 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 224 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 225 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 226 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 227 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 228 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 229 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 231 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 232 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 233 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 234 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 235 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 236 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 237 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 238 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 239 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 240 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 241 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 242 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 243 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 244 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 245 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 246 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 247 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 248 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 249 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 250 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 251 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 252 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 253 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 254 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 255 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 256 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 257 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 258 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 259 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 260 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 261 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 262 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 263 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 264 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 265 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 266 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 267 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 268 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 269 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 270 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 271 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.85 |
| Metatranscriptomes | 0.17 |
| Isolates | 3.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.74 |
| Nodule | 0 |
| Rhizoplane | 5.53 |
| Rhizosphere | 71.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga0sz30_71987_c1 | 3300050516 | Bacteria | 1489 |
| 2 | SwRhRL2b_contig_3660702 | 2162886007 | Bacteria | 11509 |
| 3 | SwRhRL2b_contig_52241 | 2162886007 | Bacteria | 2295 |
| 4 | SwRhRL2b_contig_818409 | 2162886007 | Bacteria | 1676 |
| 5 | SwRhRL2b_contig_86134 | 2162886007 | Bacteria | 2531 |
| 6 | JGI24751J29686_10000959 | 3300002459 | Bacteria | 6387 |
| 7 | Ga0055530_10013236 | 3300003791 | Bacteria | 2824 |
| 8 | Ga0065704_10000192 | 3300005289 | Bacteria | 216848 |
| 9 | Ga0065704_10000914 | 3300005289 | Bacteria | 11453 |
| 10 | Ga0065704_10002639 | 3300005289 | Bacteria | 6825 |
| 11 | Ga0065704_10077790 | 3300005289 | Bacteria | 4619 |
| 12 | Ga0065707_10084356 | 3300005295 | Bacteria | 7311 |
| 13 | Ga0065707_10096811 | 3300005295 | Bacteria | 3231 |
| 14 | Ga0065707_10104842 | 3300005295 | Bacteria | 2676 |
| 15 | Ga0070658_10000068 | 3300005327 | Bacteria | 102788 |
| 16 | Ga0070658_10085409 | 3300005327 | Bacteria | 2595 |
| 17 | Ga0070658_10150714 | 3300005327 | Bacteria | 1947 |
| 18 | Ga0070658_10155541 | 3300005327 | Bacteria | 1917 |
| 19 | Ga0070658_10189447 | 3300005327 | Bacteria | 1733 |
| 20 | Ga0070658_10225292 | 3300005327 | Bacteria | 1586 |
| 21 | Ga0070676_10202387 | 3300005328 | Bacteria | 1302 |
| 22 | Ga0070670_100193875 | 3300005331 | Bacteria | 1765 |
| 23 | Ga0070670_100557345 | 3300005331 | Bacteria | 1023 |
| 24 | Ga0070666_10021059 | 3300005335 | Bacteria | 4222 |
| 25 | Ga0070666_10048564 | 3300005335 | Bacteria | 2852 |
| 26 | Ga0070666_10384913 | 3300005335 | Bacteria | 1007 |
| 27 | Ga0070680_100001683 | 3300005336 | Bacteria | 16198 |
| 28 | Ga0070682_100076327 | 3300005337 | Bacteria | 2157 |
| 29 | Ga0070660_100002033 | 3300005339 | Bacteria | 13954 |
| 30 | Ga0070660_100023602 | 3300005339 | Bacteria | 4557 |
| 31 | Ga0070660_100329392 | 3300005339 | Bacteria | 1255 |
| 32 | Ga0070660_100333879 | 3300005339 | Bacteria | 1247 |
| 33 | Ga0070661_100001882 | 3300005344 | Bacteria | 14532 |
| 34 | Ga0070692_10069787 | 3300005345 | Bacteria | 1870 |
| 35 | Ga0070668_100000041 | 3300005347 | Bacteria | 78742 |
| 36 | Ga0070668_100008132 | 3300005347 | Bacteria | 7792 |
| 37 | Ga0070668_100093257 | 3300005347 | Bacteria | 2376 |
| 38 | Ga0070669_100000184 | 3300005353 | Bacteria | 54362 |
| 39 | Ga0070669_100000472 | 3300005353 | Bacteria | 30562 |
| 40 | Ga0070669_100005445 | 3300005353 | Bacteria | 9185 |
| 41 | Ga0070669_100014945 | 3300005353 | Bacteria | 5532 |
| 42 | Ga0070669_100055560 | 3300005353 | Bacteria | 2901 |
| 43 | Ga0070671_100000067 | 3300005355 | Bacteria | 70750 |
| 44 | Ga0070671_100002891 | 3300005355 | Bacteria | 13371 |
| 45 | Ga0070671_100003218 | 3300005355 | Bacteria | 12731 |
| 46 | Ga0070659_100081282 | 3300005366 | Bacteria | 2588 |
| 47 | Ga0070659_100146554 | 3300005366 | Bacteria | 1924 |
| 48 | Ga0070659_100212798 | 3300005366 | Bacteria | 1593 |
| 49 | Ga0070667_100000058 | 3300005367 | Bacteria | 148071 |
| 50 | Ga0070667_100003664 | 3300005367 | Bacteria | 13079 |
| 51 | Ga0070667_100016472 | 3300005367 | Bacteria | 6117 |
| 52 | Ga0070667_100417529 | 3300005367 | Bacteria | 1223 |
| 53 | Ga0070714_100584935 | 3300005435 | Bacteria | 1071 |
| 54 | Ga0070705_100077235 | 3300005440 | Bacteria | 2033 |
| 55 | Ga0070708_100456732 | 3300005445 | Bacteria | 1205 |
| 56 | Ga0070663_100482421 | 3300005455 | Bacteria | 1027 |
| 57 | Ga0070663_100674221 | 3300005455 | Bacteria | 876 |
| 58 | Ga0070678_100213532 | 3300005456 | Bacteria | 1600 |
| 59 | Ga0070662_100001446 | 3300005457 | Bacteria | 14637 |
| 60 | Ga0070662_100089396 | 3300005457 | Bacteria | 2310 |
| 61 | Ga0070662_100233072 | 3300005457 | Bacteria | 1473 |
| 62 | Ga0070681_10008385 | 3300005458 | Bacteria | 10120 |
| 63 | Ga0070685_10060467 | 3300005466 | Bacteria | 2215 |
| 64 | Ga0070706_100012712 | 3300005467 | Bacteria | 7789 |
| 65 | Ga0070707_100000042 | 3300005468 | Bacteria | 109324 |
| 66 | Ga0070698_100076640 | 3300005471 | Bacteria | 3345 |
| 67 | Ga0070699_100161579 | 3300005518 | Bacteria | 1982 |
| 68 | Ga0070679_100005037 | 3300005530 | Bacteria | 12195 |
| 69 | Ga0070679_100151775 | 3300005530 | Bacteria | 2293 |
| 70 | Ga0070684_100090919 | 3300005535 | Bacteria | 2715 |
| 71 | Ga0070684_100124594 | 3300005535 | Bacteria | 2320 |
| 72 | Ga0070697_100073278 | 3300005536 | Bacteria | 2811 |
| 73 | Ga0070697_100178460 | 3300005536 | Bacteria | 1800 |
| 74 | Ga0068853_100000329 | 3300005539 | Bacteria | 33239 |
| 75 | Ga0068853_100002549 | 3300005539 | Bacteria | 13684 |
| 76 | Ga0068853_100039895 | 3300005539 | Bacteria | 4005 |
| 77 | Ga0068853_100171816 | 3300005539 | Bacteria | 1961 |
| 78 | Ga0068853_100299492 | 3300005539 | Bacteria | 1486 |
| 79 | Ga0070686_100095853 | 3300005544 | Bacteria | 1994 |
| 80 | Ga0070665_100007174 | 3300005548 | Bacteria | 11332 |
| 81 | Ga0070665_100010368 | 3300005548 | Bacteria | 9429 |
| 82 | Ga0070665_100289943 | 3300005548 | Bacteria | 1639 |
| 83 | Ga0068855_100018885 | 3300005563 | Bacteria | 8287 |
| 84 | Ga0068855_100028086 | 3300005563 | Bacteria | 6729 |
| 85 | Ga0068855_100034692 | 3300005563 | Bacteria | 6013 |
| 86 | Ga0068855_100057353 | 3300005563 | Bacteria | 4565 |
| 87 | Ga0068855_100194078 | 3300005563 | Bacteria | 2288 |
| 88 | Ga0068855_100289830 | 3300005563 | Bacteria | 1815 |
| 89 | Ga0070664_100016772 | 3300005564 | Bacteria | 6010 |
| 90 | Ga0068857_100013486 | 3300005577 | Bacteria | 7119 |
| 91 | Ga0068857_100059453 | 3300005577 | Bacteria | 3395 |
| 92 | Ga0068857_100112239 | 3300005577 | Bacteria | 2451 |
| 93 | Ga0068857_100162242 | 3300005577 | Bacteria | 2028 |
| 94 | Ga0068854_100018657 | 3300005578 | Bacteria | 4661 |
| 95 | Ga0068856_100007858 | 3300005614 | Bacteria | 10417 |
| 96 | Ga0068856_100239996 | 3300005614 | Bacteria | 1828 |
| 97 | Ga0068852_100000358 | 3300005616 | Bacteria | 30765 |
| 98 | Ga0068852_100038220 | 3300005616 | Bacteria | 4032 |
| 99 | Ga0068852_100052082 | 3300005616 | Bacteria | 3517 |
| 100 | Ga0068852_100724675 | 3300005616 | Bacteria | 1005 |
| 101 | Ga0068859_100003997 | 3300005617 | Bacteria | 15032 |
| 102 | Ga0068859_100180814 | 3300005617 | Bacteria | 2192 |
| 103 | Ga0068859_100373655 | 3300005617 | Bacteria | 1521 |
| 104 | Ga0068864_100032465 | 3300005618 | Bacteria | 4436 |
| 105 | Ga0068864_100346051 | 3300005618 | Bacteria | 1402 |
| 106 | Ga0068863_100000031 | 3300005841 | Bacteria | 175602 |
| 107 | Ga0068863_100000103 | 3300005841 | Bacteria | 91380 |
| 108 | Ga0068863_100007418 | 3300005841 | Bacteria | 10732 |
| 109 | Ga0068858_100001121 | 3300005842 | Bacteria | 27733 |
| 110 | Ga0068858_100031111 | 3300005842 | Bacteria | 4956 |
| 111 | Ga0068858_100443443 | 3300005842 | Bacteria | 1250 |
| 112 | Ga0068858_100550402 | 3300005842 | Bacteria | 1117 |
| 113 | Ga0068858_100635117 | 3300005842 | Bacteria | 1037 |
| 114 | Ga0068860_100000093 | 3300005843 | Bacteria | 150034 |
| 115 | Ga0068860_100035617 | 3300005843 | Bacteria | 4773 |
| 116 | Ga0068860_100046702 | 3300005843 | Bacteria | 4129 |
| 117 | Ga0068860_100061302 | 3300005843 | Bacteria | 3574 |
| 118 | Ga0068860_100091656 | 3300005843 | Bacteria | 2895 |
| 119 | Ga0068860_100135237 | 3300005843 | Bacteria | 2367 |
| 120 | Ga0068860_100703928 | 3300005843 | Bacteria | 1020 |
| 121 | Ga0068862_100097950 | 3300005844 | Bacteria | 2561 |
| 122 | Ga0068862_100101316 | 3300005844 | Bacteria | 2519 |
| 123 | Ga0075365_10037603 | 3300006038 | Bacteria | 3143 |
| 124 | Ga0075368_10000835 | 3300006042 | Bacteria | 9508 |
| 125 | Ga0075363_100006123 | 3300006048 | Bacteria | 5432 |
| 126 | Ga0075363_100018034 | 3300006048 | Bacteria | 3510 |
| 127 | Ga0075364_10004453 | 3300006051 | Bacteria | 8061 |
| 128 | Ga0075364_10022381 | 3300006051 | Bacteria | 3991 |
| 129 | Ga0075362_10000011 | 3300006177 | Bacteria | 108953 |
| 130 | Ga0075362_10004038 | 3300006177 | Bacteria | 5226 |
| 131 | Ga0075362_10004729 | 3300006177 | Bacteria | 4917 |
| 132 | Ga0075367_10014378 | 3300006178 | Bacteria | 4285 |
| 133 | Ga0075367_10152480 | 3300006178 | Bacteria | 1435 |
| 134 | Ga0075369_10002638 | 3300006186 | Bacteria | 6418 |
| 135 | Ga0075369_10111158 | 3300006186 | Bacteria | 1235 |
| 136 | Ga0075366_10000190 | 3300006195 | Bacteria | 27138 |
| 137 | Ga0075366_10015707 | 3300006195 | Bacteria | 4345 |
| 138 | Ga0075366_10316520 | 3300006195 | Bacteria | 956 |
| 139 | Ga0075366_10394375 | 3300006195 | Bacteria | 852 |
| 140 | Ga0075370_10000004 | 3300006353 | Bacteria | 121166 |
| 141 | Ga0075370_10002503 | 3300006353 | Bacteria | 8532 |
| 142 | Ga0075370_10137081 | 3300006353 | Bacteria | 1430 |
| 143 | Ga0097620_100003997 | 3300006931 | Bacteria | 15032 |
| 144 | Ga0097620_100180814 | 3300006931 | Bacteria | 2192 |
| 145 | Ga0097620_100373623 | 3300006931 | Bacteria | 1521 |
| 146 | Ga0099794_10011899 | 3300007265 | Bacteria | 3740 |
| 147 | Ga0099794_10014520 | 3300007265 | Unclassified | 3452 |
| 148 | Ga0105251_10035786 | 3300009011 | Bacteria | 2447 |
| 149 | Ga0105251_10050762 | 3300009011 | Bacteria | 1980 |
| 150 | Ga0105250_10008399 | 3300009092 | Bacteria | 4387 |
| 151 | Ga0105240_10002141 | 3300009093 | Bacteria | 32242 |
| 152 | Ga0105240_10452565 | 3300009093 | Bacteria | 1436 |
| 153 | Ga0105240_10932673 | 3300009093 | Bacteria | 932 |
| 154 | Ga0111539_10152453 | 3300009094 | Bacteria | 2705 |
| 155 | Ga0111539_11421027 | 3300009094 | Bacteria | 805 |
| 156 | Ga0105243_10099759 | 3300009148 | Bacteria | 2408 |
| 157 | Ga0105248_10033589 | 3300009177 | Bacteria | 5732 |
| 158 | Ga0105248_10096944 | 3300009177 | Bacteria | 3322 |
| 159 | Ga0105248_10256296 | 3300009177 | Bacteria | 1969 |
| 160 | Ga0105248_10415483 | 3300009177 | Bacteria | 1515 |
| 161 | Ga0105248_11094038 | 3300009177 | Bacteria | 901 |
| 162 | Ga0105248_11568092 | 3300009177 | Bacteria | 746 |
| 163 | Ga0105238_10010117 | 3300009551 | Bacteria | 9456 |
| 164 | Ga0105249_10115235 | 3300009553 | Bacteria | 2546 |
| 165 | Ga0105249_10121602 | 3300009553 | Bacteria | 2481 |
| 166 | Ga0105249_10459933 | 3300009553 | Bacteria | 1312 |
| 167 | Ga0105148_100060 | 3300009978 | Bacteria | 17151 |
| 168 | Ga0105147_104180 | 3300009982 | Bacteria | 1209 |
| 169 | Ga0105239_10421696 | 3300010375 | Bacteria | 1512 |
| 170 | Ga0105239_10522507 | 3300010375 | Bacteria | 1350 |
| 171 | Ga0105239_11020556 | 3300010375 | Bacteria | 951 |
| 172 | Ga0105239_11845567 | 3300010375 | Bacteria | 701 |
| 173 | Ga0105246_10000137 | 3300011119 | Bacteria | 34064 |
| 174 | Ga0157371_10009329 | 3300013102 | Bacteria | 7734 |
| 175 | Ga0157370_10004189 | 3300013104 | Bacteria | 16690 |
| 176 | Ga0157370_10417698 | 3300013104 | Bacteria | 1234 |
| 177 | Ga0157369_10001072 | 3300013105 | Bacteria | 34302 |
| 178 | Ga0163162_10031991 | 3300013306 | Bacteria | 5222 |
| 179 | Ga0163162_10673407 | 3300013306 | Bacteria | 1157 |
| 180 | Ga0163162_10940341 | 3300013306 | Bacteria | 976 |
| 181 | Ga0157372_10004382 | 3300013307 | Bacteria | 15061 |
| 182 | Ga0157372_10183700 | 3300013307 | Bacteria | 2421 |
| 183 | Ga0157375_10402448 | 3300013308 | Bacteria | 1535 |
| 184 | Ga0157375_10901442 | 3300013308 | Bacteria | 1028 |
| 185 | Ga0157380_10088829 | 3300014326 | Bacteria | 2544 |
| 186 | Ga0157380_10182155 | 3300014326 | Bacteria | 1847 |
| 187 | Ga0157380_10650669 | 3300014326 | Bacteria | 1051 |
| 188 | Ga0157380_10891058 | 3300014326 | Bacteria | 915 |
| 189 | Ga0163161_10001177 | 3300017792 | Bacteria | 19637 |
| 190 | Ga0163161_10047745 | 3300017792 | Bacteria | 3091 |
| 191 | Ga0163161_10316574 | 3300017792 | Bacteria | 1232 |
| 192 | Ga0213876_10359334 | 3300021384 | Bacteria | 775 |
| 193 | Ga0209050_1001280 | 3300025298 | Bacteria | 28715 |
| 194 | Ga0207696_1008680 | 3300025711 | Bacteria | 3856 |
| 195 | Ga0207713_1040572 | 3300025735 | Bacteria | 1951 |
| 196 | Ga0207680_10010066 | 3300025903 | Bacteria | 4716 |
| 197 | Ga0207680_10094564 | 3300025903 | Bacteria | 1908 |
| 198 | Ga0207647_10006567 | 3300025904 | Bacteria | 8449 |
| 199 | Ga0207705_10000124 | 3300025909 | Bacteria | 85292 |
| 200 | Ga0207705_10003314 | 3300025909 | Bacteria | 12245 |
| 201 | Ga0207705_10091534 | 3300025909 | Bacteria | 2228 |
| 202 | Ga0207684_10020904 | 3300025910 | Bacteria | 5590 |
| 203 | Ga0207707_10006462 | 3300025912 | Bacteria | 10235 |
| 204 | Ga0207695_10001916 | 3300025913 | Bacteria | 32377 |
| 205 | Ga0207660_10009502 | 3300025917 | Bacteria | 6293 |
| 206 | Ga0207660_10320922 | 3300025917 | Bacteria | 1237 |
| 207 | Ga0207657_10001711 | 3300025919 | Bacteria | 23648 |
| 208 | Ga0207657_10006696 | 3300025919 | Bacteria | 11910 |
| 209 | Ga0207657_10561081 | 3300025919 | Bacteria | 892 |
| 210 | Ga0207652_10001853 | 3300025921 | Bacteria | 18346 |
| 211 | Ga0207652_10016241 | 3300025921 | Bacteria | 6074 |
| 212 | Ga0207652_10021309 | 3300025921 | Bacteria | 5349 |
| 213 | Ga0207652_10321868 | 3300025921 | Bacteria | 1396 |
| 214 | Ga0207646_10000030 | 3300025922 | Bacteria | 219473 |
| 215 | Ga0207681_10000140 | 3300025923 | Bacteria | 60064 |
| 216 | Ga0207681_10000248 | 3300025923 | Bacteria | 41061 |
| 217 | Ga0207681_10002575 | 3300025923 | Bacteria | 11500 |
| 218 | Ga0207681_10006272 | 3300025923 | Bacteria | 7300 |
| 219 | Ga0207681_10049218 | 3300025923 | Bacteria | 2848 |
| 220 | Ga0207694_10161875 | 3300025924 | Bacteria | 1808 |
| 221 | Ga0207650_10128670 | 3300025925 | Bacteria | 1979 |
| 222 | Ga0207659_10915213 | 3300025926 | Bacteria | 754 |
| 223 | Ga0207664_10498883 | 3300025929 | Bacteria | 1090 |
| 224 | Ga0207644_10000004 | 3300025931 | Bacteria | 566613 |
| 225 | Ga0207644_10000293 | 3300025931 | Bacteria | 32998 |
| 226 | Ga0207690_10000640 | 3300025932 | Bacteria | 22410 |
| 227 | Ga0207690_10161671 | 3300025932 | Bacteria | 1670 |
| 228 | Ga0207690_10554577 | 3300025932 | Bacteria | 934 |
| 229 | Ga0207690_10697503 | 3300025932 | Bacteria | 834 |
| 230 | Ga0207706_10003725 | 3300025933 | Bacteria | 14537 |
| 231 | Ga0207706_10007699 | 3300025933 | Bacteria | 9944 |
| 232 | Ga0207706_10056647 | 3300025933 | Bacteria | 3455 |
| 233 | Ga0207709_10239234 | 3300025935 | Bacteria | 1320 |
| 234 | Ga0207711_10018482 | 3300025941 | Bacteria | 5796 |
| 235 | Ga0207711_10027237 | 3300025941 | Bacteria | 4801 |
| 236 | Ga0207711_10038155 | 3300025941 | Bacteria | 4084 |
| 237 | Ga0207711_10338175 | 3300025941 | Bacteria | 1393 |
| 238 | Ga0207661_10028324 | 3300025944 | Bacteria | 4289 |
| 239 | Ga0207661_10350614 | 3300025944 | Bacteria | 1332 |
| 240 | Ga0207661_10375748 | 3300025944 | Bacteria | 1286 |
| 241 | Ga0207679_10170889 | 3300025945 | Bacteria | 1789 |
| 242 | Ga0207667_10004486 | 3300025949 | Bacteria | 17094 |
| 243 | Ga0207667_10021439 | 3300025949 | Bacteria | 7159 |
| 244 | Ga0207667_10103165 | 3300025949 | Bacteria | 2942 |
| 245 | Ga0207667_10234866 | 3300025949 | Bacteria | 1877 |
| 246 | Ga0207667_10379314 | 3300025949 | Bacteria | 1441 |
| 247 | Ga0207712_10057156 | 3300025961 | Bacteria | 2751 |
| 248 | Ga0207712_10116075 | 3300025961 | Bacteria | 2016 |
| 249 | Ga0207712_10725910 | 3300025961 | Bacteria | 869 |
| 250 | Ga0207668_10000038 | 3300025972 | Bacteria | 112486 |
| 251 | Ga0207668_10004934 | 3300025972 | Bacteria | 7846 |
| 252 | Ga0207668_10160088 | 3300025972 | Bacteria | 1753 |
| 253 | Ga0207668_10293211 | 3300025972 | Bacteria | 1339 |
| 254 | Ga0207640_10000964 | 3300025981 | Bacteria | 15982 |
| 255 | Ga0207640_10586688 | 3300025981 | Bacteria | 941 |
| 256 | Ga0207640_10787004 | 3300025981 | Bacteria | 823 |
| 257 | Ga0207658_10000037 | 3300025986 | Bacteria | 148087 |
| 258 | Ga0207658_10000742 | 3300025986 | Bacteria | 28124 |
| 259 | Ga0207658_10005790 | 3300025986 | Bacteria | 8456 |
| 260 | Ga0207658_10098240 | 3300025986 | Bacteria | 2287 |
| 261 | Ga0207658_10174205 | 3300025986 | Bacteria | 1775 |
| 262 | Ga0207703_10002695 | 3300026035 | Bacteria | 15231 |
| 263 | Ga0207703_10027359 | 3300026035 | Bacteria | 4491 |
| 264 | Ga0207703_10484734 | 3300026035 | Bacteria | 1159 |
| 265 | Ga0207703_10514741 | 3300026035 | Bacteria | 1125 |
| 266 | Ga0207639_10001072 | 3300026041 | Bacteria | 18552 |
| 267 | Ga0207639_10003417 | 3300026041 | Bacteria | 10681 |
| 268 | Ga0207639_11048751 | 3300026041 | Bacteria | 764 |
| 269 | Ga0207678_10030552 | 3300026067 | Bacteria | 4702 |
| 270 | Ga0207678_10079055 | 3300026067 | Bacteria | 2816 |
| 271 | Ga0207702_10081347 | 3300026078 | Bacteria | 2813 |
| 272 | Ga0207702_10103396 | 3300026078 | Bacteria | 2519 |
| 273 | Ga0207641_10000050 | 3300026088 | Bacteria | 175954 |
| 274 | Ga0207641_10000113 | 3300026088 | Bacteria | 119188 |
| 275 | Ga0207641_10008467 | 3300026088 | Bacteria | 8502 |
| 276 | Ga0207676_10001272 | 3300026095 | Bacteria | 18754 |
| 277 | Ga0207676_10024807 | 3300026095 | Bacteria | 4442 |
| 278 | Ga0207676_10696163 | 3300026095 | Bacteria | 984 |
| 279 | Ga0207674_10020610 | 3300026116 | Bacteria | 7118 |
| 280 | Ga0207674_10035934 | 3300026116 | Bacteria | 5167 |
| 281 | Ga0207674_10067171 | 3300026116 | Bacteria | 3610 |
| 282 | Ga0207674_10215126 | 3300026116 | Bacteria | 1870 |
| 283 | Ga0207683_10549773 | 3300026121 | Bacteria | 1067 |
| 284 | Ga0207698_10000067 | 3300026142 | Bacteria | 70181 |
| 285 | Ga0207698_10002681 | 3300026142 | Bacteria | 10586 |
| 286 | Ga0207698_10088237 | 3300026142 | Bacteria | 2529 |
| 287 | Ga0207698_10443438 | 3300026142 | Bacteria | 1251 |
| 288 | Ga0209813_10000310 | 3300027866 | Bacteria | 13171 |
| 289 | Ga0207428_10455132 | 3300027907 | Bacteria | 933 |
| 290 | Ga0268266_10000471 | 3300028379 | Bacteria | 58314 |
| 291 | Ga0268266_10002389 | 3300028379 | Bacteria | 20264 |
| 292 | Ga0268266_10019776 | 3300028379 | Bacteria | 5738 |
| 293 | Ga0268266_10149488 | 3300028379 | Bacteria | 2104 |
| 294 | Ga0268266_10226568 | 3300028379 | Bacteria | 1720 |
| 295 | Ga0268265_10034787 | 3300028380 | Bacteria | 3675 |
| 296 | Ga0268265_10075235 | 3300028380 | Bacteria | 2644 |
| 297 | Ga0268265_10086256 | 3300028380 | Bacteria | 2494 |
| 298 | Ga0268265_10352755 | 3300028380 | Bacteria | 1344 |
| 299 | Ga0268264_10000067 | 3300028381 | Bacteria | 284445 |
| 300 | Ga0268264_10019865 | 3300028381 | Bacteria | 5489 |
| 301 | Ga0268264_10025173 | 3300028381 | Bacteria | 4862 |
| 302 | Ga0268264_10065385 | 3300028381 | Bacteria | 3064 |
| 303 | Ga0265331_10011734 | 3300031250 | Bacteria | 4788 |
| 304 | Ga0265327_10072739 | 3300031251 | Bacteria | 1716 |
| 305 | Ga0307408_100560435 | 3300031548 | Bacteria | 1009 |
| 306 | Ga0307508_10049043 | 3300031616 | Bacteria | 3761 |
| 307 | Ga0316576_10066962 | 3300031727 | Bacteria | 2643 |
| 308 | Ga0316578_10037571 | 3300031728 | Bacteria | 2790 |
| 309 | Ga0307405_10154538 | 3300031731 | Bacteria | 1617 |
| 310 | Ga0307405_10180613 | 3300031731 | Bacteria | 1515 |
| 311 | Ga0307405_10249689 | 3300031731 | Bacteria | 1319 |
| 312 | Ga0307405_10280409 | 3300031731 | Bacteria | 1254 |
| 313 | Ga0307405_10518924 | 3300031731 | Bacteria | 958 |
| 314 | Ga0316577_10191609 | 3300031733 | Bacteria | 1155 |
| 315 | Ga0307413_10004455 | 3300031824 | Bacteria | 6099 |
| 316 | Ga0307413_10241458 | 3300031824 | Bacteria | 1334 |
| 317 | Ga0307413_10667714 | 3300031824 | Bacteria | 859 |
| 318 | Ga0307410_10688933 | 3300031852 | Bacteria | 860 |
| 319 | Ga0307406_10035169 | 3300031901 | Bacteria | 3079 |
| 320 | Ga0307407_10069510 | 3300031903 | Bacteria | 2090 |
| 321 | Ga0307407_10111002 | 3300031903 | Bacteria | 1721 |
| 322 | Ga0307412_10010943 | 3300031911 | Bacteria | 5238 |
| 323 | Ga0307412_10012788 | 3300031911 | Bacteria | 4900 |
| 324 | Ga0307412_10116247 | 3300031911 | Bacteria | 1919 |
| 325 | Ga0307412_10124550 | 3300031911 | Bacteria | 1861 |
| 326 | Ga0307412_10127901 | 3300031911 | Bacteria | 1840 |
| 327 | Ga0307412_10201990 | 3300031911 | Bacteria | 1510 |
| 328 | Ga0307412_10263890 | 3300031911 | Bacteria | 1344 |
| 329 | Ga0307409_100013413 | 3300031995 | Bacteria | 5274 |
| 330 | Ga0307409_100135747 | 3300031995 | Bacteria | 2111 |
| 331 | Ga0307409_100649484 | 3300031995 | Bacteria | 1049 |
| 332 | Ga0307409_100816693 | 3300031995 | Bacteria | 941 |
| 333 | Ga0307416_100026372 | 3300032002 | Bacteria | 4281 |
| 334 | Ga0307416_100051704 | 3300032002 | Bacteria | 3284 |
| 335 | Ga0307416_100085761 | 3300032002 | Bacteria | 2681 |
| 336 | Ga0307416_100171076 | 3300032002 | Bacteria | 2022 |
| 337 | Ga0307416_100964419 | 3300032002 | Bacteria | 955 |
| 338 | Ga0307414_10223372 | 3300032004 | Bacteria | 1548 |
| 339 | Ga0307414_10289246 | 3300032004 | Bacteria | 1381 |
| 340 | Ga0307414_10310869 | 3300032004 | Bacteria | 1337 |
| 341 | Ga0307414_10374365 | 3300032004 | Bacteria | 1229 |
| 342 | Ga0307414_10416092 | 3300032004 | Bacteria | 1171 |
| 343 | Ga0307411_10052013 | 3300032005 | Bacteria | 2676 |
| 344 | Ga0307411_10064585 | 3300032005 | Bacteria | 2451 |
| 345 | Ga0307415_100065570 | 3300032126 | Bacteria | 2531 |
| 346 | Ga0307415_100164675 | 3300032126 | Bacteria | 1723 |
| 347 | Ga0307415_100606850 | 3300032126 | Bacteria | 975 |
| 348 | Ga0316583_10009059 | 3300032133 | Bacteria | 3589 |
| 349 | Ga0373935_0310962 | 3300035692 | Bacteria | 1116 |
| 350 | Ga0316584_0001254 | 3300036712 | Bacteria | 15002 |
| 351 | Ga0316584_0278705 | 3300036712 | Bacteria | 1215 |
| 352 | Ga0451841_1142172 | 3300041498 | Bacteria | 960 |
| 353 | Ga0439443_000582 | 3300042003 | Bacteria | 3392 |
| 354 | Ga0439462_0002205 | 3300042015 | Bacteria | 4493 |
| 355 | Ga0450912_000634 | 3300042116 | Bacteria | 1829 |
| 356 | Ga0451577_0029760 | 3300042876 | Bacteria | 4935 |
| 357 | Ga0451577_0058037 | 3300042876 | Bacteria | 3450 |
| 358 | Ga0451577_0265959 | 3300042876 | Bacteria | 1553 |
| 359 | Ga0451576_0000041 | 3300045051 | Bacteria | 343432 |
| 360 | Ga0451576_0149612 | 3300045051 | Bacteria | 2435 |
| 361 | Ga0495617_006059 | 3300046452 | Bacteria | 4261 |
| 362 | Ga0495627_000036 | 3300046453 | Bacteria | 205589 |
| 363 | Ga0495627_000090 | 3300046453 | Bacteria | 109622 |
| 364 | Ga0495627_000287 | 3300046453 | Bacteria | 50673 |
| 365 | Ga0495638_0000018 | 3300046460 | Bacteria | 389696 |
| 366 | Ga0495638_0012417 | 3300046460 | Bacteria | 5840 |
| 367 | Ga0495638_0021887 | 3300046460 | Bacteria | 4203 |
| 368 | Ga0495638_0035364 | 3300046460 | Bacteria | 3185 |
| 369 | Ga0495650_0000684 | 3300046471 | Bacteria | 43971 |
| 370 | Ga0495650_0001816 | 3300046471 | Bacteria | 19170 |
| 371 | Ga0495605_0147159 | 3300046474 | Bacteria | 1053 |
| 372 | Ga0495596_0000514 | 3300046500 | Bacteria | 24581 |
| 373 | Ga0495583_0000252 | 3300046506 | Bacteria | 88617 |
| 374 | Ga0495606_0028851 | 3300046507 | Bacteria | 3907 |
| 375 | Ga0495610_0000015 | 3300046512 | Bacteria | 391489 |
| 376 | Ga0495610_0000079 | 3300046512 | Bacteria | 115816 |
| 377 | Ga0495610_0006491 | 3300046512 | Bacteria | 8036 |
| 378 | Ga0495610_0049243 | 3300046512 | Bacteria | 2064 |
| 379 | Ga0495616_0000010 | 3300046513 | Bacteria | 224378 |
| 380 | Ga0495616_0055978 | 3300046513 | Bacteria | 1950 |
| 381 | Ga0495616_0078964 | 3300046513 | Bacteria | 1578 |
| 382 | Ga0495620_0013186 | 3300046515 | Bacteria | 4240 |
| 383 | Ga0495632_0000095 | 3300046519 | Bacteria | 89499 |
| 384 | Ga0495632_0000668 | 3300046519 | Bacteria | 31348 |
| 385 | Ga0495632_0001502 | 3300046519 | Bacteria | 19288 |
| 386 | Ga0495637_0015335 | 3300046520 | Bacteria | 3595 |
| 387 | Ga0495643_0000038 | 3300046522 | Bacteria | 236010 |
| 388 | Ga0495643_0110037 | 3300046522 | Bacteria | 1401 |
| 389 | Ga0495648_0000018 | 3300046524 | Bacteria | 282490 |
| 390 | Ga0495648_0050809 | 3300046524 | Bacteria | 2530 |
| 391 | Ga0495648_0121687 | 3300046524 | Bacteria | 1402 |
| 392 | Ga0495663_0000028 | 3300046525 | Bacteria | 89526 |
| 393 | Ga0495663_0105460 | 3300046525 | Bacteria | 932 |
| 394 | Ga0495654_0085627 | 3300046530 | Bacteria | 1470 |
| 395 | Ga0495621_0021524 | 3300046539 | Bacteria | 2126 |
| 396 | Ga0495597_0099982 | 3300046542 | Bacteria | 1224 |
| 397 | Ga0495633_0000340 | 3300046558 | Bacteria | 52440 |
| 398 | Ga0495633_0003319 | 3300046558 | Bacteria | 10807 |
| 399 | Ga0495633_0014337 | 3300046558 | Bacteria | 4148 |
| 400 | Ga0495633_0083397 | 3300046558 | Bacteria | 1487 |
| 401 | Ga0495668_0004472 | 3300046616 | Bacteria | 9913 |
| 402 | Ga0495668_0115234 | 3300046616 | Bacteria | 1470 |
| 403 | Ga0495625_0035505 | 3300046660 | Bacteria | 3674 |
| 404 | Ga0495670_0060810 | 3300046691 | Bacteria | 1898 |
| 405 | Ga0495670_0118043 | 3300046691 | Bacteria | 1377 |
| 406 | Ga0495671_0000011 | 3300046692 | Bacteria | 365582 |
| 407 | Ga0495671_0000027 | 3300046692 | Bacteria | 236011 |
| 408 | Ga0495636_0351247 | 3300047318 | Bacteria | 696 |
| 409 | Ga0495672_0055696 | 3300047320 | Bacteria | 2306 |
| 410 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 411 | Ga0495681_0000048 | 3300047470 | Bacteria | 110216 |
| 412 | Ga0495681_0015420 | 3300047470 | Bacteria | 4323 |
| 413 | Ga0495686_0088975 | 3300047472 | Bacteria | 1876 |
| 414 | Ga0495615_0000085 | 3300048090 | Bacteria | 27694 |
| 415 | Ga0495615_0006709 | 3300048090 | Bacteria | 2150 |
| 416 | Ga0495626_0000301 | 3300048091 | Bacteria | 52582 |
| 417 | Ga0496100_0042720 | 3300048903 | Bacteria | 2896 |
| 418 | Ga0496101_0422656 | 3300048904 | Bacteria | 1050 |
| 419 | Ga0496102_0000267 | 3300048905 | Bacteria | 66761 |
| 420 | Ga0496102_0095938 | 3300048905 | Bacteria | 2749 |
| 421 | Ga0496102_0379665 | 3300048905 | Bacteria | 1330 |
| 422 | Ga0496102_0407299 | 3300048905 | Bacteria | 1278 |
| 423 | Ga0496103_0000139 | 3300048906 | Bacteria | 75158 |
| 424 | Ga0496103_0185796 | 3300048906 | Bacteria | 1336 |
| 425 | Ga0496104_0001996 | 3300048907 | Bacteria | 17709 |
| 426 | Ga0496104_0115660 | 3300048907 | Bacteria | 2573 |
| 427 | Ga0496105_0000099 | 3300048908 | Bacteria | 59095 |
| 428 | Ga0496105_0000931 | 3300048908 | Bacteria | 19939 |
| 429 | Ga0496105_0103808 | 3300048908 | Bacteria | 2348 |
| 430 | Ga0496105_0370236 | 3300048908 | Bacteria | 1142 |
| 431 | Ga0496106_0005710 | 3300048909 | Bacteria | 9205 |
| 432 | Ga0496107_0005493 | 3300048910 | Bacteria | 8674 |
| 433 | Ga0496108_0001061 | 3300048911 | Bacteria | 21446 |
| 434 | Ga0496108_0062185 | 3300048911 | Bacteria | 3144 |
| 435 | Ga0496108_0267144 | 3300048911 | Bacteria | 1489 |
| 436 | Ga0496108_0647801 | 3300048911 | Bacteria | 918 |
| 437 | Ga0496109_0006311 | 3300048912 | Bacteria | 9982 |
| 438 | Ga0496109_0144936 | 3300048912 | Bacteria | 2221 |
| 439 | Ga0496109_0516695 | 3300048912 | Bacteria | 1127 |
| 440 | Ga0496110_0035237 | 3300048913 | Bacteria | 4341 |
| 441 | Ga0496110_0209844 | 3300048913 | Bacteria | 1770 |
| 442 | Ga0496111_0197413 | 3300048914 | Bacteria | 1496 |
| 443 | Ga0496112_0075216 | 3300048915 | Bacteria | 3340 |
| 444 | Ga0496113_0002241 | 3300048916 | Bacteria | 11153 |
| 445 | Ga0496113_0004509 | 3300048916 | Bacteria | 8576 |
| 446 | Ga0496113_0151215 | 3300048916 | Bacteria | 1831 |
| 447 | Ga0496114_0037945 | 3300048917 | Bacteria | 3986 |
| 448 | Ga0496114_0049349 | 3300048917 | Bacteria | 3502 |
| 449 | Ga0496116_0000284 | 3300048919 | Bacteria | 86342 |
| 450 | Ga0496116_0017593 | 3300048919 | Bacteria | 5540 |
| 451 | Ga0496116_0179780 | 3300048919 | Bacteria | 1134 |
| 452 | Ga0496116_0199057 | 3300048919 | Bacteria | 1050 |
| 453 | Ga0496117_0008650 | 3300048920 | Bacteria | 9634 |
| 454 | Ga0496117_0011000 | 3300048920 | Bacteria | 8147 |
| 455 | Ga0496118_0002469 | 3300048921 | Bacteria | 24817 |
| 456 | Ga0496118_0009747 | 3300048921 | Bacteria | 9635 |
| 457 | Ga0496118_0011449 | 3300048921 | Bacteria | 8656 |
| 458 | Ga0496118_0023847 | 3300048921 | Bacteria | 5301 |
| 459 | Ga0496118_0027158 | 3300048921 | Bacteria | 4852 |
| 460 | Ga0496119_0004210 | 3300048922 | Bacteria | 14446 |
| 461 | Ga0496119_0034803 | 3300048922 | Bacteria | 3309 |
| 462 | Ga0496120_0003080 | 3300048923 | Bacteria | 15717 |
| 463 | Ga0496120_0062824 | 3300048923 | Bacteria | 2068 |
| 464 | Ga0496121_0000070 | 3300048924 | Bacteria | 249187 |
| 465 | Ga0496121_0000196 | 3300048924 | Bacteria | 135812 |
| 466 | Ga0496121_0000349 | 3300048924 | Bacteria | 96428 |
| 467 | Ga0496121_0009274 | 3300048924 | Bacteria | 11352 |
| 468 | Ga0496121_0013822 | 3300048924 | Bacteria | 8640 |
| 469 | Ga0496121_0044160 | 3300048924 | Bacteria | 3849 |
| 470 | Ga0496122_0005423 | 3300048925 | Bacteria | 15204 |
| 471 | Ga0496122_0014411 | 3300048925 | Bacteria | 7647 |
| 472 | Ga0496122_0014622 | 3300048925 | Bacteria | 7574 |
| 473 | Ga0496122_0020731 | 3300048925 | Bacteria | 5920 |
| 474 | Ga0496122_0122617 | 3300048925 | Bacteria | 1672 |
| 475 | Ga0496123_0002007 | 3300048926 | Bacteria | 26274 |
| 476 | Ga0496123_0002479 | 3300048926 | Bacteria | 22782 |
| 477 | Ga0496123_0002794 | 3300048926 | Bacteria | 20744 |
| 478 | Ga0496123_0020758 | 3300048926 | Bacteria | 5128 |
| 479 | Ga0496124_0001485 | 3300048927 | Bacteria | 34464 |
| 480 | Ga0496124_0001730 | 3300048927 | Bacteria | 30704 |
| 481 | Ga0496124_0012138 | 3300048927 | Bacteria | 8537 |
| 482 | Ga0496124_0050666 | 3300048927 | Bacteria | 3537 |
| 483 | Ga0496124_0216079 | 3300048927 | Bacteria | 1446 |
| 484 | Ga0496125_0004923 | 3300048928 | Bacteria | 15118 |
| 485 | Ga0496125_0039262 | 3300048928 | Bacteria | 4079 |
| 486 | Ga0496125_0047887 | 3300048928 | Bacteria | 3569 |
| 487 | Ga0496125_0051774 | 3300048928 | Bacteria | 3382 |
| 488 | Ga0496125_0061297 | 3300048928 | Bacteria | 3017 |
| 489 | Ga0496125_0283150 | 3300048928 | Bacteria | 1025 |
| 490 | Ga0496126_0000619 | 3300048929 | Bacteria | 66827 |
| 491 | Ga0496126_0001049 | 3300048929 | Bacteria | 46719 |
| 492 | Ga0496126_0013243 | 3300048929 | Bacteria | 8408 |
| 493 | Ga0496126_0065901 | 3300048929 | Bacteria | 3239 |
| 494 | Ga0496126_0074592 | 3300048929 | Bacteria | 3012 |
| 495 | Ga0496126_0094469 | 3300048929 | Bacteria | 2624 |
| 496 | Ga0496126_0125435 | 3300048929 | Bacteria | 2222 |
| 497 | Ga0501335_000497 | 3300049551 | Bacteria | 2548 |
| 498 | Ga0501034_0424627 | 3300049571 | Bacteria | 1250 |
| 499 | Ga0501046_0541374 | 3300049580 | Bacteria | 831 |
| 500 | Ga0501047_0247065 | 3300049581 | Bacteria | 1633 |
| 501 | Ga0501206_029386 | 3300049653 | Bacteria | 812 |
| 502 | Ga0501211_006895 | 3300049658 | Bacteria | 1119 |
| 503 | Ga0501223_000042 | 3300049663 | Bacteria | 44258 |
| 504 | Ga0501224_004106 | 3300049664 | Bacteria | 2054 |
| 505 | Ga0501246_003170 | 3300049676 | Bacteria | 1320 |
| 506 | Ga0501225_0000520 | 3300049705 | Bacteria | 12018 |
| 507 | Ga0501225_0018318 | 3300049705 | Bacteria | 1941 |
| 508 | Ga0501245_043415 | 3300049708 | Bacteria | 779 |
| 509 | Ga0501044_0158081 | 3300049823 | Bacteria | 2245 |
| 510 | Ga0501044_0352785 | 3300049823 | Bacteria | 1390 |
| 511 | Ga0501044_1007331 | 3300049823 | Bacteria | 705 |
| 512 | nmdc:mga03683_2313_c1 | 3300050489 | Bacteria | 5901 |
| 513 | nmdc:mga03683_31_c1 | 3300050489 | Bacteria | 69502 |
| 514 | nmdc:mga03683_68461_c1 | 3300050489 | Bacteria | 1513 |
| 515 | nmdc:mga00v17_19037_c1 | 3300050491 | Bacteria | 3912 |
| 516 | nmdc:mga00v17_4522_c1 | 3300050491 | Bacteria | 7242 |
| 517 | nmdc:mga00v17_526732_c1 | 3300050491 | Bacteria | 765 |
| 518 | nmdc:mga0k408_18_c1 | 3300050493 | Bacteria | 112318 |
| 519 | nmdc:mga0k408_20416_c1 | 3300050493 | Bacteria | 3710 |
| 520 | nmdc:mga0k408_50046_c1 | 3300050493 | Bacteria | 2419 |
| 521 | nmdc:mga06z11_21176_c1 | 3300050494 | Bacteria | 3018 |
| 522 | nmdc:mga06z11_71730_c1 | 3300050494 | Bacteria | 1834 |
| 523 | nmdc:mga04h51_641_c1 | 3300050495 | Bacteria | 8181 |
| 524 | nmdc:mga07m45_1083_c1 | 3300050496 | Bacteria | 12127 |
| 525 | nmdc:mga07m45_19_c1 | 3300050496 | Bacteria | 133476 |
| 526 | nmdc:mga07m45_7_c1 | 3300050496 | Bacteria | 223540 |
| 527 | nmdc:mga07m45_96284_c1 | 3300050496 | Bacteria | 1698 |
| 528 | nmdc:mga08y16_246001_c1 | 3300050511 | Bacteria | 1848 |
| 529 | nmdc:mga0sz30_1125_c2 | 3300050516 | Bacteria | 7973 |
| 530 | nmdc:mga0sz30_21843_c1 | 3300050516 | Bacteria | 2593 |
| 531 | nmdc:mga0sz30_4304_c1 | 3300050516 | Bacteria | 5137 |
| 532 | nmdc:mga0sz30_79002_c1 | 3300050516 | Bacteria | 1422 |
| 533 | Ga0500643_000005 | 3300053087 | Bacteria | 539775 |
| 534 | Ga0500643_000578 | 3300053087 | Bacteria | 25456 |
| 535 | Ga0500647_0053005 | 3300053091 | Bacteria | 1952 |
| 536 | Ga0500593_048024 | 3300053117 | Bacteria | 1899 |
| 537 | Ga0500607_000395 | 3300053121 | Bacteria | 41884 |
| 538 | Ga0500607_000854 | 3300053121 | Bacteria | 29366 |
| 539 | Ga0500608_001181 | 3300053122 | Bacteria | 9303 |
| 540 | Ga0500618_072525 | 3300053125 | Bacteria | 772 |
| 541 | Ga0500559_0001264 | 3300053136 | Bacteria | 14808 |
| 542 | Ga0500559_0005461 | 3300053136 | Bacteria | 5846 |
| 543 | Ga0500559_0014781 | 3300053136 | Bacteria | 3297 |
| 544 | Ga0500559_0018606 | 3300053136 | Bacteria | 2935 |
| 545 | Ga0500564_004287 | 3300053138 | Bacteria | 5686 |
| 546 | Ga0500588_0103261 | 3300053146 | Bacteria | 985 |
| 547 | Ga0500590_000464 | 3300053148 | Bacteria | 13814 |
| 548 | Ga0500604_0002273 | 3300053151 | Bacteria | 5257 |
| 549 | Ga0500616_0006349 | 3300053153 | Bacteria | 7758 |
| 550 | Ga0500622_0000901 | 3300053156 | Bacteria | 25291 |
| 551 | Ga0500624_000009 | 3300053157 | Bacteria | 178763 |
| 552 | Ga0500627_0013461 | 3300053158 | Bacteria | 3103 |
| 553 | Ga0500567_008334 | 3300053723 | Bacteria | 4901 |
| 554 | Ga0500625_000009 | 3300053729 | Bacteria | 159296 |
| 555 | Ga0500645_019583 | 3300053730 | Bacteria | 2104 |
| 556 | Ga0500661_006212 | 3300055283 | Bacteria | 2225 |
| 557 | 2643951896 | 2643221588 | Bacteria | 3692460 |
| 558 | 2738709872 | 2738541275 | Bacteria | 4830863 |
| 559 | 2738848297 | 2738541301 | Bacteria | 4834102 |
| 560 | 2738864026 | 2738541304 | Bacteria | 4833665 |
| 561 | 2739296544 | 2738543022 | Bacteria | 4835059 |
| 562 | 2739358222 | 2738543033 | Bacteria | 4833336 |
| 563 | 2739649282 | 2739367664 | Bacteria | 4114334 |
| 564 | 2740027755 | 2739367865 | Bacteria | 4114482 |
| 565 | 2778123846 | 2775507255 | Bacteria | 3945731 |
| 566 | 2809064824 | 2808606401 | Bacteria | 4586670 |
| 567 | 2809080791 | 2808606404 | Bacteria | 4652788 |
| 568 | 2809085156 | 2808606405 | Bacteria | 4586632 |
| 569 | 2819552898 | 2818991438 | Bacteria | 5793701 |
| 570 | 2880521854 | 2880518877 | Bacteria | 5012590 |
| 571 | 2882806848 | 2882806704 | Bacteria | 3007728 |
| 572 | 2895884356 | 2895880812 | Bacteria | 11255272 |
| 573 | 2896185584 | 2896184354 | Bacteria | 3258548 |
| 574 | 2896256438 | 2896253425 | Bacteria | 3418029 |
| 575 | 2919142492 | 2919138771 | Bacteria | 5281312 |
| 576 | 2919711341 | 2919709256 | Bacteria | 4318106 |
| 577 | 2928101420 | 2928100450 | Bacteria | 4837635 |
| 578 | 2928960168 | 2928959182 | Bacteria | 4725774 |
| 579 | 8054306878 | 8054302542 | Bacteria | 5698134 |
| 580 | nmdc:mga0sz30_71987_c1 | |||
| 581 | SwRhRL2b_contig_3660702 | |||
| 582 | SwRhRL2b_contig_52241 | |||
| 583 | SwRhRL2b_contig_818409 | |||
| 584 | SwRhRL2b_contig_86134 | |||
| 585 | JGI24751J29686_10000959 | |||
| 586 | Ga0055530_10013236 | |||
| 587 | Ga0065704_10000192 | |||
| 588 | Ga0065704_10000914 | |||
| 589 | Ga0065704_10002639 | |||
| 590 | Ga0065704_10077790 | |||
| 591 | Ga0065707_10084356 | |||
| 592 | Ga0065707_10096811 | |||
| 593 | Ga0065707_10104842 | |||
| 594 | Ga0070658_10000068 | |||
| 595 | Ga0070658_10085409 | |||
| 596 | Ga0070658_10150714 | |||
| 597 | Ga0070658_10155541 | |||
| 598 | Ga0070658_10189447 | |||
| 599 | Ga0070658_10225292 | |||
| 600 | Ga0070676_10202387 | |||
| 601 | Ga0070670_100193875 | |||
| 602 | Ga0070670_100557345 | |||
| 603 | Ga0070666_10021059 | |||
| 604 | Ga0070666_10048564 | |||
| 605 | Ga0070666_10384913 | |||
| 606 | Ga0070680_100001683 | |||
| 607 | Ga0070682_100076327 | |||
| 608 | Ga0070660_100002033 | |||
| 609 | Ga0070660_100023602 | |||
| 610 | Ga0070660_100329392 | |||
| 611 | Ga0070660_100333879 | |||
| 612 | Ga0070661_100001882 | |||
| 613 | Ga0070692_10069787 | |||
| 614 | Ga0070668_100000041 | |||
| 615 | Ga0070668_100008132 | |||
| 616 | Ga0070668_100093257 | |||
| 617 | Ga0070669_100000184 | |||
| 618 | Ga0070669_100000472 | |||
| 619 | Ga0070669_100005445 | |||
| 620 | Ga0070669_100014945 | |||
| 621 | Ga0070669_100055560 | |||
| 622 | Ga0070671_100000067 | |||
| 623 | Ga0070671_100002891 | |||
| 624 | Ga0070671_100003218 | |||
| 625 | Ga0070659_100081282 | |||
| 626 | Ga0070659_100146554 | |||
| 627 | Ga0070659_100212798 | |||
| 628 | Ga0070667_100000058 | |||
| 629 | Ga0070667_100003664 | |||
| 630 | Ga0070667_100016472 | |||
| 631 | Ga0070667_100417529 | |||
| 632 | Ga0070714_100584935 | |||
| 633 | Ga0070705_100077235 | |||
| 634 | Ga0070708_100456732 | |||
| 635 | Ga0070663_100482421 | |||
| 636 | Ga0070663_100674221 | |||
| 637 | Ga0070678_100213532 | |||
| 638 | Ga0070662_100001446 | |||
| 639 | Ga0070662_100089396 | |||
| 640 | Ga0070662_100233072 | |||
| 641 | Ga0070681_10008385 | |||
| 642 | Ga0070685_10060467 | |||
| 643 | Ga0070706_100012712 | |||
| 644 | Ga0070707_100000042 | |||
| 645 | Ga0070698_100076640 | |||
| 646 | Ga0070699_100161579 | |||
| 647 | Ga0070679_100005037 | |||
| 648 | Ga0070679_100151775 | |||
| 649 | Ga0070684_100090919 | |||
| 650 | Ga0070684_100124594 | |||
| 651 | Ga0070697_100073278 | |||
| 652 | Ga0070697_100178460 | |||
| 653 | Ga0068853_100000329 | |||
| 654 | Ga0068853_100002549 | |||
| 655 | Ga0068853_100039895 | |||
| 656 | Ga0068853_100171816 | |||
| 657 | Ga0068853_100299492 | |||
| 658 | Ga0070686_100095853 | |||
| 659 | Ga0070665_100007174 | |||
| 660 | Ga0070665_100010368 | |||
| 661 | Ga0070665_100289943 | |||
| 662 | Ga0068855_100018885 | |||
| 663 | Ga0068855_100028086 | |||
| 664 | Ga0068855_100034692 | |||
| 665 | Ga0068855_100057353 | |||
| 666 | Ga0068855_100194078 | |||
| 667 | Ga0068855_100289830 | |||
| 668 | Ga0070664_100016772 | |||
| 669 | Ga0068857_100013486 | |||
| 670 | Ga0068857_100059453 | |||
| 671 | Ga0068857_100112239 | |||
| 672 | Ga0068857_100162242 | |||
| 673 | Ga0068854_100018657 | |||
| 674 | Ga0068856_100007858 | |||
| 675 | Ga0068856_100239996 | |||
| 676 | Ga0068852_100000358 | |||
| 677 | Ga0068852_100038220 | |||
| 678 | Ga0068852_100052082 | |||
| 679 | Ga0068852_100724675 | |||
| 680 | Ga0068859_100003997 | |||
| 681 | Ga0068859_100180814 | |||
| 682 | Ga0068859_100373655 | |||
| 683 | Ga0068864_100032465 | |||
| 684 | Ga0068864_100346051 | |||
| 685 | Ga0068863_100000031 | |||
| 686 | Ga0068863_100000103 | |||
| 687 | Ga0068863_100007418 | |||
| 688 | Ga0068858_100001121 | |||
| 689 | Ga0068858_100031111 | |||
| 690 | Ga0068858_100443443 | |||
| 691 | Ga0068858_100550402 | |||
| 692 | Ga0068858_100635117 | |||
| 693 | Ga0068860_100000093 | |||
| 694 | Ga0068860_100035617 | |||
| 695 | Ga0068860_100046702 | |||
| 696 | Ga0068860_100061302 | |||
| 697 | Ga0068860_100091656 | |||
| 698 | Ga0068860_100135237 | |||
| 699 | Ga0068860_100703928 | |||
| 700 | Ga0068862_100097950 | |||
| 701 | Ga0068862_100101316 | |||
| 702 | Ga0075365_10037603 | |||
| 703 | Ga0075368_10000835 | |||
| 704 | Ga0075363_100006123 | |||
| 705 | Ga0075363_100018034 | |||
| 706 | Ga0075364_10004453 | |||
| 707 | Ga0075364_10022381 | |||
| 708 | Ga0075362_10000011 | |||
| 709 | Ga0075362_10004038 | |||
| 710 | Ga0075362_10004729 | |||
| 711 | Ga0075367_10014378 | |||
| 712 | Ga0075367_10152480 | |||
| 713 | Ga0075369_10002638 | |||
| 714 | Ga0075369_10111158 | |||
| 715 | Ga0075366_10000190 | |||
| 716 | Ga0075366_10015707 | |||
| 717 | Ga0075366_10316520 | |||
| 718 | Ga0075366_10394375 | |||
| 719 | Ga0075370_10000004 | |||
| 720 | Ga0075370_10002503 | |||
| 721 | Ga0075370_10137081 | |||
| 722 | Ga0097620_100003997 | |||
| 723 | Ga0097620_100180814 | |||
| 724 | Ga0097620_100373623 | |||
| 725 | Ga0099794_10011899 | |||
| 726 | Ga0099794_10014520 | |||
| 727 | Ga0105251_10035786 | |||
| 728 | Ga0105251_10050762 | |||
| 729 | Ga0105250_10008399 | |||
| 730 | Ga0105240_10002141 | |||
| 731 | Ga0105240_10452565 | |||
| 732 | Ga0105240_10932673 | |||
| 733 | Ga0111539_10152453 | |||
| 734 | Ga0111539_11421027 | |||
| 735 | Ga0105243_10099759 | |||
| 736 | Ga0105248_10033589 | |||
| 737 | Ga0105248_10096944 | |||
| 738 | Ga0105248_10256296 | |||
| 739 | Ga0105248_10415483 | |||
| 740 | Ga0105248_11094038 | |||
| 741 | Ga0105248_11568092 | |||
| 742 | Ga0105238_10010117 | |||
| 743 | Ga0105249_10115235 | |||
| 744 | Ga0105249_10121602 | |||
| 745 | Ga0105249_10459933 | |||
| 746 | Ga0105148_100060 | |||
| 747 | Ga0105147_104180 | |||
| 748 | Ga0105239_10421696 | |||
| 749 | Ga0105239_10522507 | |||
| 750 | Ga0105239_11020556 | |||
| 751 | Ga0105239_11845567 | |||
| 752 | Ga0105246_10000137 | |||
| 753 | Ga0157371_10009329 | |||
| 754 | Ga0157370_10004189 | |||
| 755 | Ga0157370_10417698 | |||
| 756 | Ga0157369_10001072 | |||
| 757 | Ga0163162_10031991 | |||
| 758 | Ga0163162_10673407 | |||
| 759 | Ga0163162_10940341 | |||
| 760 | Ga0157372_10004382 | |||
| 761 | Ga0157372_10183700 | |||
| 762 | Ga0157375_10402448 | |||
| 763 | Ga0157375_10901442 | |||
| 764 | Ga0157380_10088829 | |||
| 765 | Ga0157380_10182155 | |||
| 766 | Ga0157380_10650669 | |||
| 767 | Ga0157380_10891058 | |||
| 768 | Ga0163161_10001177 | |||
| 769 | Ga0163161_10047745 | |||
| 770 | Ga0163161_10316574 | |||
| 771 | Ga0213876_10359334 | |||
| 772 | Ga0209050_1001280 | |||
| 773 | Ga0207696_1008680 | |||
| 774 | Ga0207713_1040572 | |||
| 775 | Ga0207680_10010066 | |||
| 776 | Ga0207680_10094564 | |||
| 777 | Ga0207647_10006567 | |||
| 778 | Ga0207705_10000124 | |||
| 779 | Ga0207705_10003314 | |||
| 780 | Ga0207705_10091534 | |||
| 781 | Ga0207684_10020904 | |||
| 782 | Ga0207707_10006462 | |||
| 783 | Ga0207695_10001916 | |||
| 784 | Ga0207660_10009502 | |||
| 785 | Ga0207660_10320922 | |||
| 786 | Ga0207657_10001711 | |||
| 787 | Ga0207657_10006696 | |||
| 788 | Ga0207657_10561081 | |||
| 789 | Ga0207652_10001853 | |||
| 790 | Ga0207652_10016241 | |||
| 791 | Ga0207652_10021309 | |||
| 792 | Ga0207652_10321868 | |||
| 793 | Ga0207646_10000030 | |||
| 794 | Ga0207681_10000140 | |||
| 795 | Ga0207681_10000248 | |||
| 796 | Ga0207681_10002575 | |||
| 797 | Ga0207681_10006272 | |||
| 798 | Ga0207681_10049218 | |||
| 799 | Ga0207694_10161875 | |||
| 800 | Ga0207650_10128670 | |||
| 801 | Ga0207659_10915213 | |||
| 802 | Ga0207664_10498883 | |||
| 803 | Ga0207644_10000004 | |||
| 804 | Ga0207644_10000293 | |||
| 805 | Ga0207690_10000640 | |||
| 806 | Ga0207690_10161671 | |||
| 807 | Ga0207690_10554577 | |||
| 808 | Ga0207690_10697503 | |||
| 809 | Ga0207706_10003725 | |||
| 810 | Ga0207706_10007699 | |||
| 811 | Ga0207706_10056647 | |||
| 812 | Ga0207709_10239234 | |||
| 813 | Ga0207711_10018482 | |||
| 814 | Ga0207711_10027237 | |||
| 815 | Ga0207711_10038155 | |||
| 816 | Ga0207711_10338175 | |||
| 817 | Ga0207661_10028324 | |||
| 818 | Ga0207661_10350614 | |||
| 819 | Ga0207661_10375748 | |||
| 820 | Ga0207679_10170889 | |||
| 821 | Ga0207667_10004486 | |||
| 822 | Ga0207667_10021439 | |||
| 823 | Ga0207667_10103165 | |||
| 824 | Ga0207667_10234866 | |||
| 825 | Ga0207667_10379314 | |||
| 826 | Ga0207712_10057156 | |||
| 827 | Ga0207712_10116075 | |||
| 828 | Ga0207712_10725910 | |||
| 829 | Ga0207668_10000038 | |||
| 830 | Ga0207668_10004934 | |||
| 831 | Ga0207668_10160088 | |||
| 832 | Ga0207668_10293211 | |||
| 833 | Ga0207640_10000964 | |||
| 834 | Ga0207640_10586688 | |||
| 835 | Ga0207640_10787004 | |||
| 836 | Ga0207658_10000037 | |||
| 837 | Ga0207658_10000742 | |||
| 838 | Ga0207658_10005790 | |||
| 839 | Ga0207658_10098240 | |||
| 840 | Ga0207658_10174205 | |||
| 841 | Ga0207703_10002695 | |||
| 842 | Ga0207703_10027359 | |||
| 843 | Ga0207703_10484734 | |||
| 844 | Ga0207703_10514741 | |||
| 845 | Ga0207639_10001072 | |||
| 846 | Ga0207639_10003417 | |||
| 847 | Ga0207639_11048751 | |||
| 848 | Ga0207678_10030552 | |||
| 849 | Ga0207678_10079055 | |||
| 850 | Ga0207702_10081347 | |||
| 851 | Ga0207702_10103396 | |||
| 852 | Ga0207641_10000050 | |||
| 853 | Ga0207641_10000113 | |||
| 854 | Ga0207641_10008467 | |||
| 855 | Ga0207676_10001272 | |||
| 856 | Ga0207676_10024807 | |||
| 857 | Ga0207676_10696163 | |||
| 858 | Ga0207674_10020610 | |||
| 859 | Ga0207674_10035934 | |||
| 860 | Ga0207674_10067171 | |||
| 861 | Ga0207674_10215126 | |||
| 862 | Ga0207683_10549773 | |||
| 863 | Ga0207698_10000067 | |||
| 864 | Ga0207698_10002681 | |||
| 865 | Ga0207698_10088237 | |||
| 866 | Ga0207698_10443438 | |||
| 867 | Ga0209813_10000310 | |||
| 868 | Ga0207428_10455132 | |||
| 869 | Ga0268266_10000471 | |||
| 870 | Ga0268266_10002389 | |||
| 871 | Ga0268266_10019776 | |||
| 872 | Ga0268266_10149488 | |||
| 873 | Ga0268266_10226568 | |||
| 874 | Ga0268265_10034787 | |||
| 875 | Ga0268265_10075235 | |||
| 876 | Ga0268265_10086256 | |||
| 877 | Ga0268265_10352755 | |||
| 878 | Ga0268264_10000067 | |||
| 879 | Ga0268264_10019865 | |||
| 880 | Ga0268264_10025173 | |||
| 881 | Ga0268264_10065385 | |||
| 882 | Ga0265331_10011734 | |||
| 883 | Ga0265327_10072739 | |||
| 884 | Ga0307408_100560435 | |||
| 885 | Ga0307508_10049043 | |||
| 886 | Ga0316576_10066962 | |||
| 887 | Ga0316578_10037571 | |||
| 888 | Ga0307405_10154538 | |||
| 889 | Ga0307405_10180613 | |||
| 890 | Ga0307405_10249689 | |||
| 891 | Ga0307405_10280409 | |||
| 892 | Ga0307405_10518924 | |||
| 893 | Ga0316577_10191609 | |||
| 894 | Ga0307413_10004455 | |||
| 895 | Ga0307413_10241458 | |||
| 896 | Ga0307413_10667714 | |||
| 897 | Ga0307410_10688933 | |||
| 898 | Ga0307406_10035169 | |||
| 899 | Ga0307407_10069510 | |||
| 900 | Ga0307407_10111002 | |||
| 901 | Ga0307412_10010943 | |||
| 902 | Ga0307412_10012788 | |||
| 903 | Ga0307412_10116247 | |||
| 904 | Ga0307412_10124550 | |||
| 905 | Ga0307412_10127901 | |||
| 906 | Ga0307412_10201990 | |||
| 907 | Ga0307412_10263890 | |||
| 908 | Ga0307409_100013413 | |||
| 909 | Ga0307409_100135747 | |||
| 910 | Ga0307409_100649484 | |||
| 911 | Ga0307409_100816693 | |||
| 912 | Ga0307416_100026372 | |||
| 913 | Ga0307416_100051704 | |||
| 914 | Ga0307416_100085761 | |||
| 915 | Ga0307416_100171076 | |||
| 916 | Ga0307416_100964419 | |||
| 917 | Ga0307414_10223372 | |||
| 918 | Ga0307414_10289246 | |||
| 919 | Ga0307414_10310869 | |||
| 920 | Ga0307414_10374365 | |||
| 921 | Ga0307414_10416092 | |||
| 922 | Ga0307411_10052013 | |||
| 923 | Ga0307411_10064585 | |||
| 924 | Ga0307415_100065570 | |||
| 925 | Ga0307415_100164675 | |||
| 926 | Ga0307415_100606850 | |||
| 927 | Ga0316583_10009059 | |||
| 928 | Ga0373935_0310962 | |||
| 929 | Ga0316584_0001254 | |||
| 930 | Ga0316584_0278705 | |||
| 931 | Ga0451841_1142172 | |||
| 932 | Ga0439443_000582 | |||
| 933 | Ga0439462_0002205 | |||
| 934 | Ga0450912_000634 | |||
| 935 | Ga0451577_0029760 | |||
| 936 | Ga0451577_0058037 | |||
| 937 | Ga0451577_0265959 | |||
| 938 | Ga0451576_0000041 | |||
| 939 | Ga0451576_0149612 | |||
| 940 | Ga0495617_006059 | |||
| 941 | Ga0495627_000036 | |||
| 942 | Ga0495627_000090 | |||
| 943 | Ga0495627_000287 | |||
| 944 | Ga0495638_0000018 | |||
| 945 | Ga0495638_0012417 | |||
| 946 | Ga0495638_0021887 | |||
| 947 | Ga0495638_0035364 | |||
| 948 | Ga0495650_0000684 | |||
| 949 | Ga0495650_0001816 | |||
| 950 | Ga0495605_0147159 | |||
| 951 | Ga0495596_0000514 | |||
| 952 | Ga0495583_0000252 | |||
| 953 | Ga0495606_0028851 | |||
| 954 | Ga0495610_0000015 | |||
| 955 | Ga0495610_0000079 | |||
| 956 | Ga0495610_0006491 | |||
| 957 | Ga0495610_0049243 | |||
| 958 | Ga0495616_0000010 | |||
| 959 | Ga0495616_0055978 | |||
| 960 | Ga0495616_0078964 | |||
| 961 | Ga0495620_0013186 | |||
| 962 | Ga0495632_0000095 | |||
| 963 | Ga0495632_0000668 | |||
| 964 | Ga0495632_0001502 | |||
| 965 | Ga0495637_0015335 | |||
| 966 | Ga0495643_0000038 | |||
| 967 | Ga0495643_0110037 | |||
| 968 | Ga0495648_0000018 | |||
| 969 | Ga0495648_0050809 | |||
| 970 | Ga0495648_0121687 | |||
| 971 | Ga0495663_0000028 | |||
| 972 | Ga0495663_0105460 | |||
| 973 | Ga0495654_0085627 | |||
| 974 | Ga0495621_0021524 | |||
| 975 | Ga0495597_0099982 | |||
| 976 | Ga0495633_0000340 | |||
| 977 | Ga0495633_0003319 | |||
| 978 | Ga0495633_0014337 | |||
| 979 | Ga0495633_0083397 | |||
| 980 | Ga0495668_0004472 | |||
| 981 | Ga0495668_0115234 | |||
| 982 | Ga0495625_0035505 | |||
| 983 | Ga0495670_0060810 | |||
| 984 | Ga0495670_0118043 | |||
| 985 | Ga0495671_0000011 | |||
| 986 | Ga0495671_0000027 | |||
| 987 | Ga0495636_0351247 | |||
| 988 | Ga0495672_0055696 | |||
| 989 | Ga0495673_0000013 | |||
| 990 | Ga0495681_0000048 | |||
| 991 | Ga0495681_0015420 | |||
| 992 | Ga0495686_0088975 | |||
| 993 | Ga0495615_0000085 | |||
| 994 | Ga0495615_0006709 | |||
| 995 | Ga0495626_0000301 | |||
| 996 | Ga0496100_0042720 | |||
| 997 | Ga0496101_0422656 | |||
| 998 | Ga0496102_0000267 | |||
| 999 | Ga0496102_0095938 | |||
| 1000 | Ga0496102_0379665 | |||
| 1001 | Ga0496102_0407299 | |||
| 1002 | Ga0496103_0000139 | |||
| 1003 | Ga0496103_0185796 | |||
| 1004 | Ga0496104_0001996 | |||
| 1005 | Ga0496104_0115660 | |||
| 1006 | Ga0496105_0000099 | |||
| 1007 | Ga0496105_0000931 | |||
| 1008 | Ga0496105_0103808 | |||
| 1009 | Ga0496105_0370236 | |||
| 1010 | Ga0496106_0005710 | |||
| 1011 | Ga0496107_0005493 | |||
| 1012 | Ga0496108_0001061 | |||
| 1013 | Ga0496108_0062185 | |||
| 1014 | Ga0496108_0267144 | |||
| 1015 | Ga0496108_0647801 | |||
| 1016 | Ga0496109_0006311 | |||
| 1017 | Ga0496109_0144936 | |||
| 1018 | Ga0496109_0516695 | |||
| 1019 | Ga0496110_0035237 | |||
| 1020 | Ga0496110_0209844 | |||
| 1021 | Ga0496111_0197413 | |||
| 1022 | Ga0496112_0075216 | |||
| 1023 | Ga0496113_0002241 | |||
| 1024 | Ga0496113_0004509 | |||
| 1025 | Ga0496113_0151215 | |||
| 1026 | Ga0496114_0037945 | |||
| 1027 | Ga0496114_0049349 | |||
| 1028 | Ga0496116_0000284 | |||
| 1029 | Ga0496116_0017593 | |||
| 1030 | Ga0496116_0179780 | |||
| 1031 | Ga0496116_0199057 | |||
| 1032 | Ga0496117_0008650 | |||
| 1033 | Ga0496117_0011000 | |||
| 1034 | Ga0496118_0002469 | |||
| 1035 | Ga0496118_0009747 | |||
| 1036 | Ga0496118_0011449 | |||
| 1037 | Ga0496118_0023847 | |||
| 1038 | Ga0496118_0027158 | |||
| 1039 | Ga0496119_0004210 | |||
| 1040 | Ga0496119_0034803 | |||
| 1041 | Ga0496120_0003080 | |||
| 1042 | Ga0496120_0062824 | |||
| 1043 | Ga0496121_0000070 | |||
| 1044 | Ga0496121_0000196 | |||
| 1045 | Ga0496121_0000349 | |||
| 1046 | Ga0496121_0009274 | |||
| 1047 | Ga0496121_0013822 | |||
| 1048 | Ga0496121_0044160 | |||
| 1049 | Ga0496122_0005423 | |||
| 1050 | Ga0496122_0014411 | |||
| 1051 | Ga0496122_0014622 | |||
| 1052 | Ga0496122_0020731 | |||
| 1053 | Ga0496122_0122617 | |||
| 1054 | Ga0496123_0002007 | |||
| 1055 | Ga0496123_0002479 | |||
| 1056 | Ga0496123_0002794 | |||
| 1057 | Ga0496123_0020758 | |||
| 1058 | Ga0496124_0001485 | |||
| 1059 | Ga0496124_0001730 | |||
| 1060 | Ga0496124_0012138 | |||
| 1061 | Ga0496124_0050666 | |||
| 1062 | Ga0496124_0216079 | |||
| 1063 | Ga0496125_0004923 | |||
| 1064 | Ga0496125_0039262 | |||
| 1065 | Ga0496125_0047887 | |||
| 1066 | Ga0496125_0051774 | |||
| 1067 | Ga0496125_0061297 | |||
| 1068 | Ga0496125_0283150 | |||
| 1069 | Ga0496126_0000619 | |||
| 1070 | Ga0496126_0001049 | |||
| 1071 | Ga0496126_0013243 | |||
| 1072 | Ga0496126_0065901 | |||
| 1073 | Ga0496126_0074592 | |||
| 1074 | Ga0496126_0094469 | |||
| 1075 | Ga0496126_0125435 | |||
| 1076 | Ga0501335_000497 | |||
| 1077 | Ga0501034_0424627 | |||
| 1078 | Ga0501046_0541374 | |||
| 1079 | Ga0501047_0247065 | |||
| 1080 | Ga0501206_029386 | |||
| 1081 | Ga0501211_006895 | |||
| 1082 | Ga0501223_000042 | |||
| 1083 | Ga0501224_004106 | |||
| 1084 | Ga0501246_003170 | |||
| 1085 | Ga0501225_0000520 | |||
| 1086 | Ga0501225_0018318 | |||
| 1087 | Ga0501245_043415 | |||
| 1088 | Ga0501044_0158081 | |||
| 1089 | Ga0501044_0352785 | |||
| 1090 | Ga0501044_1007331 | |||
| 1091 | nmdc:mga03683_2313_c1 | |||
| 1092 | nmdc:mga03683_31_c1 | |||
| 1093 | nmdc:mga03683_68461_c1 | |||
| 1094 | nmdc:mga00v17_19037_c1 | |||
| 1095 | nmdc:mga00v17_4522_c1 | |||
| 1096 | nmdc:mga00v17_526732_c1 | |||
| 1097 | nmdc:mga0k408_18_c1 | |||
| 1098 | nmdc:mga0k408_20416_c1 | |||
| 1099 | nmdc:mga0k408_50046_c1 | |||
| 1100 | nmdc:mga06z11_21176_c1 | |||
| 1101 | nmdc:mga06z11_71730_c1 | |||
| 1102 | nmdc:mga04h51_641_c1 | |||
| 1103 | nmdc:mga07m45_1083_c1 | |||
| 1104 | nmdc:mga07m45_19_c1 | |||
| 1105 | nmdc:mga07m45_7_c1 | |||
| 1106 | nmdc:mga07m45_96284_c1 | |||
| 1107 | nmdc:mga08y16_246001_c1 | |||
| 1108 | nmdc:mga0sz30_1125_c2 | |||
| 1109 | nmdc:mga0sz30_21843_c1 | |||
| 1110 | nmdc:mga0sz30_4304_c1 | |||
| 1111 | nmdc:mga0sz30_79002_c1 | |||
| 1112 | Ga0500643_000005 | |||
| 1113 | Ga0500643_000578 | |||
| 1114 | Ga0500647_0053005 | |||
| 1115 | Ga0500593_048024 | |||
| 1116 | Ga0500607_000395 | |||
| 1117 | Ga0500607_000854 | |||
| 1118 | Ga0500608_001181 | |||
| 1119 | Ga0500618_072525 | |||
| 1120 | Ga0500559_0001264 | |||
| 1121 | Ga0500559_0005461 | |||
| 1122 | Ga0500559_0014781 | |||
| 1123 | Ga0500559_0018606 | |||
| 1124 | Ga0500564_004287 | |||
| 1125 | Ga0500588_0103261 | |||
| 1126 | Ga0500590_000464 | |||
| 1127 | Ga0500604_0002273 | |||
| 1128 | Ga0500616_0006349 | |||
| 1129 | Ga0500622_0000901 | |||
| 1130 | Ga0500624_000009 | |||
| 1131 | Ga0500627_0013461 | |||
| 1132 | Ga0500567_008334 | |||
| 1133 | Ga0500625_000009 | |||
| 1134 | Ga0500645_019583 | |||
| 1135 | Ga0500661_006212 | |||
| 1136 | 2643951896 | |||
| 1137 | 2738709872 | |||
| 1138 | 2738848297 | |||
| 1139 | 2738864026 | |||
| 1140 | 2739296544 | |||
| 1141 | 2739358222 | |||
| 1142 | 2739649282 | |||
| 1143 | 2740027755 | |||
| 1144 | 2778123846 | |||
| 1145 | 2809064824 | |||
| 1146 | 2809080791 | |||
| 1147 | 2809085156 | |||
| 1148 | 2819552898 | |||
| 1149 | 2880521854 | |||
| 1150 | 2882806848 | |||
| 1151 | 2895884356 | |||
| 1152 | 2896185584 | |||
| 1153 | 2896256438 | |||
| 1154 | 2919142492 | |||
| 1155 | 2919711341 | |||
| 1156 | 2928101420 | |||
| 1157 | 2928960168 | |||
| 1158 | 8054306878 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wjz-assembly1.cif.gz_B | crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity | 0.9142 | 1 | 204 |
| 2wjz-assembly3.cif.gz_D | crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity | 0.9107 | 1 | 204 |
| 4gud-assembly2.cif.gz_B | crystal structure of amidotransferase hish from vibrio cholerae | 0.9083 | 2 | 204 |
| 7ac8-assembly3.cif.gz_F | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9007 | 1 | 204 |
| 4gud-assembly1.cif.gz_A | crystal structure of amidotransferase hish from vibrio cholerae | 0.9 | 1 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FUU1_1_190_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9336 | 3 | 204 | 3.40.50.880 |
| af_Q57929_1_195_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9293 | 3 | 205 | 3.40.50.880 |
| af_Q57929_1_195_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9202 | 3 | 205 | 3.40.50.880 |
| 2wjzB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9142 | 1 | 204 | 3.40.50.880 |
| af_Q2FUU1_1_190_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9055 | 3 | 204 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N0HJH8-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9914 | 2 | 207 |
GO:0000105
GO:0000107 GO:0004359 GO:0005737 GO:0006541 GO:0016829 |
| AF-A0A6I5WUX0-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9886 | 2 | 207 |
GO:0000105
GO:0000107 GO:0004359 GO:0005737 GO:0006541 GO:0016829 |
| AF-A0A844YIT3-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9884 | 2 | 207 |
GO:0000105
GO:0000107 GO:0005737 GO:0006541 GO:0016787 GO:0016829 |
| AF-A0A2W6SFJ3-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9877 | 1 | 207 |
GO:0000105
GO:0000107 GO:0004359 GO:0005737 GO:0006541 GO:0016829 |
| AF-A0A3D0WL32-F1-model_v4 | deleted | 0.9834 | 29 | 207 |
|