F465839
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 579 | 249 | 1158 | 631 |
Family's Representative Sequence
| Representative Sequence | 3300026118|Ga0207675_100081603|Ga0207675_1000816032 |
| Length | 698 |
| Sequence | VISLPITRHRFWQLVVDGVLVAAAWYLAFRLRFDPKIPPYYHTMFTRTIWIVLLIQLSVFILFGFYNRWWRYVSTRDMWGAGRGVTVACLVSSVVVYFANPVAGVRLPRSVAIMDWLLLLAFVAGARMLARTLMERPTARGLVARGREVIVVGAGDAAQLIIKELLKSPSLGYTPIGLVDDDPRKKNLRVHNVRVLGTTEELSRILHENRPDEVLIAIPHADTAAVRAVVRTLEPFKVPIKTLPNLREIIDGRVDVAQIRGLAFEDLLVRAPVGLDRGPLKRLIAGRRVMVTGAGGSIGSELCRQIAQLKPAALVMLDRYENTLHAIRVELDAREHVFGVIPVIGDVTDASRVNALLAEHQPEIIFHAAAHKHVPLMEENPCEAVKNNVGGTRVLAQSADAFGVDHFIMISTDKAVNPTSIMGASKRIAELVVQAQAAGSGTTFSIVRFGNVLGSNGSVVPHFMEQIRRGGPVTVTDPEIRRFFMLIPEAVQLVLHAAAQAENGATYVLEMGEQVKLLDMARNLIRLSGFIPDEDIKIVFTGLRPGEKLYEELVGAGEDASASSVEKVLCVRSRASVDPEMLTRVKALLSEALRGRTVAVLAAIKELVGTFQDADGSTAAGPEPLAPXXXXASGVNSHDEQPCPECGTGRAHRSRARSAHEGAAPVEVLQPPDWATLDSDAKLRPVERRQNFSPRNLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 32 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 33 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 34 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 39 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 42 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 94 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 95 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 96 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 98 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 99 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 100 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 101 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 103 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 104 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 105 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 106 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 107 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 108 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 109 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 110 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 111 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 112 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 113 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 114 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 115 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 118 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 119 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 120 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 121 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 122 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 123 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 124 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 125 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 126 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 127 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 128 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 129 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 130 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 131 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 132 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 133 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 134 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 135 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 136 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 137 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 138 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 139 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 140 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 141 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 190 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 191 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 192 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 193 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 194 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 195 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 198 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 199 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 200 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 201 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 202 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 203 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 242 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 245 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 246 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 247 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 248 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 249 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.14 |
| Metatranscriptomes | 0.17 |
| Isolates | 0.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.17 |
| Nodule | 0 |
| Rhizoplane | 14.16 |
| Rhizosphere | 85.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207675_100081603 | 3300026118 | Bacteria | 3032 |
| 2 | JGI25407J50210_10000296 | 3300003373 | Bacteria | 9040 |
| 3 | Ga0070683_100009621 | 3300005329 | Bacteria | 8274 |
| 4 | Ga0070683_100010636 | 3300005329 | Bacteria | 7909 |
| 5 | Ga0070683_100044242 | 3300005329 | Bacteria | 4106 |
| 6 | Ga0070680_100014560 | 3300005336 | Bacteria | 6152 |
| 7 | Ga0070680_100085339 | 3300005336 | Bacteria | 2608 |
| 8 | Ga0070682_100010759 | 3300005337 | Bacteria | 5203 |
| 9 | Ga0070692_10027603 | 3300005345 | Bacteria | 2815 |
| 10 | Ga0070692_10054506 | 3300005345 | Bacteria | 2088 |
| 11 | Ga0070674_100009597 | 3300005356 | Bacteria | 5801 |
| 12 | Ga0070674_100035285 | 3300005356 | Bacteria | 3348 |
| 13 | Ga0070674_100087382 | 3300005356 | Bacteria | 2241 |
| 14 | Ga0070673_100003722 | 3300005364 | Bacteria | 9556 |
| 15 | Ga0070688_100045641 | 3300005365 | Bacteria | 2708 |
| 16 | Ga0070667_100006289 | 3300005367 | Bacteria | 9869 |
| 17 | Ga0070703_10007165 | 3300005406 | Bacteria | 3131 |
| 18 | Ga0070714_100003825 | 3300005435 | Bacteria | 11307 |
| 19 | Ga0070714_100009995 | 3300005435 | Bacteria | 7483 |
| 20 | Ga0070714_100019611 | 3300005435 | Bacteria | 5513 |
| 21 | Ga0070714_100056431 | 3300005435 | Bacteria | 3359 |
| 22 | Ga0070714_100144371 | 3300005435 | Bacteria | 2139 |
| 23 | Ga0070713_100010133 | 3300005436 | Bacteria | 6798 |
| 24 | Ga0070713_100017556 | 3300005436 | Bacteria | 5415 |
| 25 | Ga0070713_100029792 | 3300005436 | Bacteria | 4326 |
| 26 | Ga0070713_100035926 | 3300005436 | Bacteria | 3994 |
| 27 | Ga0070713_100079900 | 3300005436 | Bacteria | 2787 |
| 28 | Ga0070694_100000416 | 3300005444 | Bacteria | 23229 |
| 29 | Ga0070708_100014798 | 3300005445 | Bacteria | 6430 |
| 30 | Ga0070708_100102497 | 3300005445 | Bacteria | 2622 |
| 31 | Ga0070678_100025008 | 3300005456 | Bacteria | 4009 |
| 32 | Ga0070706_100065063 | 3300005467 | Bacteria | 3371 |
| 33 | Ga0070707_100002701 | 3300005468 | Bacteria | 16872 |
| 34 | Ga0070707_100008868 | 3300005468 | Bacteria | 9325 |
| 35 | Ga0070707_100139049 | 3300005468 | Bacteria | 2363 |
| 36 | Ga0070698_100019860 | 3300005471 | Bacteria | 7048 |
| 37 | Ga0070699_100058465 | 3300005518 | Bacteria | 3340 |
| 38 | Ga0070679_100010400 | 3300005530 | Bacteria | 8826 |
| 39 | Ga0070679_100014711 | 3300005530 | Bacteria | 7521 |
| 40 | Ga0070679_100045991 | 3300005530 | Bacteria | 4349 |
| 41 | Ga0070684_100015765 | 3300005535 | Bacteria | 6168 |
| 42 | Ga0070684_100023556 | 3300005535 | Bacteria | 5153 |
| 43 | Ga0070697_100069212 | 3300005536 | Bacteria | 2890 |
| 44 | Ga0070686_100062960 | 3300005544 | Bacteria | 2401 |
| 45 | Ga0070665_100054615 | 3300005548 | Bacteria | 4006 |
| 46 | Ga0068855_100022559 | 3300005563 | Bacteria | 7543 |
| 47 | Ga0068855_100167402 | 3300005563 | Bacteria | 2491 |
| 48 | Ga0068855_100240847 | 3300005563 | Bacteria | 2021 |
| 49 | Ga0070664_100034803 | 3300005564 | Bacteria | 4227 |
| 50 | Ga0068857_100004546 | 3300005577 | Bacteria | 11736 |
| 51 | Ga0068856_100006776 | 3300005614 | Bacteria | 11210 |
| 52 | Ga0068864_100015164 | 3300005618 | Bacteria | 6409 |
| 53 | Ga0068870_10002990 | 3300005840 | Bacteria | 7120 |
| 54 | Ga0068870_10012320 | 3300005840 | Bacteria | 3994 |
| 55 | Ga0081455_10003628 | 3300005937 | Bacteria | 17682 |
| 56 | Ga0081455_10010008 | 3300005937 | Bacteria | 9692 |
| 57 | Ga0081455_10010129 | 3300005937 | Bacteria | 9605 |
| 58 | Ga0081455_10021363 | 3300005937 | Bacteria | 6073 |
| 59 | Ga0081538_10000055 | 3300005981 | Bacteria | 106524 |
| 60 | Ga0081538_10000181 | 3300005981 | Bacteria | 68890 |
| 61 | Ga0081538_10006367 | 3300005981 | Bacteria | 10413 |
| 62 | Ga0081538_10043478 | 3300005981 | Bacteria | 2820 |
| 63 | Ga0081540_1002875 | 3300005983 | Bacteria | 13917 |
| 64 | Ga0081540_1028792 | 3300005983 | Bacteria | 3109 |
| 65 | Ga0070717_10002526 | 3300006028 | Bacteria | 12887 |
| 66 | Ga0070717_10019040 | 3300006028 | Bacteria | 5376 |
| 67 | Ga0070712_100043874 | 3300006175 | Bacteria | 3080 |
| 68 | Ga0075428_100055161 | 3300006844 | Bacteria | 4354 |
| 69 | Ga0075428_100059347 | 3300006844 | Bacteria | 4189 |
| 70 | Ga0075433_10008591 | 3300006852 | Bacteria | 8148 |
| 71 | Ga0075433_10013027 | 3300006852 | Bacteria | 6743 |
| 72 | Ga0075433_10035084 | 3300006852 | Bacteria | 4311 |
| 73 | Ga0075433_10078043 | 3300006852 | Bacteria | 2918 |
| 74 | Ga0075433_10126158 | 3300006852 | Bacteria | 2273 |
| 75 | Ga0075434_100002112 | 3300006871 | Bacteria | 17300 |
| 76 | Ga0075434_100048603 | 3300006871 | Bacteria | 4209 |
| 77 | Ga0075434_100108830 | 3300006871 | Bacteria | 2781 |
| 78 | Ga0068865_100084618 | 3300006881 | Bacteria | 2286 |
| 79 | Ga0075436_100004922 | 3300006914 | Bacteria | 9179 |
| 80 | Ga0075436_100017849 | 3300006914 | Bacteria | 4858 |
| 81 | Ga0075435_100007173 | 3300007076 | Bacteria | 7927 |
| 82 | Ga0075435_100069122 | 3300007076 | Bacteria | 2879 |
| 83 | Ga0075435_100116080 | 3300007076 | Bacteria | 2229 |
| 84 | Ga0105240_10084629 | 3300009093 | Bacteria | 3888 |
| 85 | Ga0105240_10147933 | 3300009093 | Bacteria | 2801 |
| 86 | Ga0111539_10047122 | 3300009094 | Bacteria | 5153 |
| 87 | Ga0111539_10055644 | 3300009094 | Bacteria | 4703 |
| 88 | Ga0111539_10072803 | 3300009094 | Bacteria | 4052 |
| 89 | Ga0105245_10004292 | 3300009098 | Bacteria | 12636 |
| 90 | Ga0105245_10040830 | 3300009098 | Bacteria | 4135 |
| 91 | Ga0105245_10071367 | 3300009098 | Bacteria | 3154 |
| 92 | Ga0105247_10009428 | 3300009101 | Bacteria | 5926 |
| 93 | Ga0114129_10021204 | 3300009147 | Bacteria | 9229 |
| 94 | Ga0114129_10035154 | 3300009147 | Bacteria | 7080 |
| 95 | Ga0114129_10189480 | 3300009147 | Bacteria | 2794 |
| 96 | Ga0105243_10000083 | 3300009148 | Bacteria | 107982 |
| 97 | Ga0105241_10073862 | 3300009174 | Bacteria | 2654 |
| 98 | Ga0105242_10000027 | 3300009176 | Bacteria | 106530 |
| 99 | Ga0105242_10053783 | 3300009176 | Bacteria | 3289 |
| 100 | Ga0105248_10170393 | 3300009177 | Bacteria | 2454 |
| 101 | Ga0105249_10011417 | 3300009553 | Bacteria | 7802 |
| 102 | Ga0105249_10087980 | 3300009553 | Bacteria | 2900 |
| 103 | Ga0105239_10098829 | 3300010375 | Bacteria | 3226 |
| 104 | Ga0105246_10003787 | 3300011119 | Bacteria | 9165 |
| 105 | Ga0157370_10019388 | 3300013104 | Bacteria | 6824 |
| 106 | Ga0157369_10024655 | 3300013105 | Bacteria | 6687 |
| 107 | Ga0157369_10029594 | 3300013105 | Bacteria | 6050 |
| 108 | Ga0157369_10110545 | 3300013105 | Bacteria | 2922 |
| 109 | Ga0157374_10099403 | 3300013296 | Bacteria | 2787 |
| 110 | Ga0163162_10050053 | 3300013306 | Bacteria | 4190 |
| 111 | Ga0163162_10129908 | 3300013306 | Bacteria | 2627 |
| 112 | Ga0157375_10214504 | 3300013308 | Bacteria | 2082 |
| 113 | Ga0163163_10014926 | 3300014325 | Bacteria | 7157 |
| 114 | Ga0157376_10103127 | 3300014969 | Bacteria | 2497 |
| 115 | Ga0206356_10569481 | 3300020070 | Bacteria | 4588 |
| 116 | Ga0207653_10006974 | 3300025885 | Bacteria | 3524 |
| 117 | Ga0207710_10032220 | 3300025900 | Bacteria | 2295 |
| 118 | Ga0207688_10000901 | 3300025901 | Bacteria | 14998 |
| 119 | Ga0207643_10013338 | 3300025908 | Bacteria | 4448 |
| 120 | Ga0207643_10024388 | 3300025908 | Bacteria | 3338 |
| 121 | Ga0207643_10035811 | 3300025908 | Bacteria | 2784 |
| 122 | Ga0207705_10032551 | 3300025909 | Bacteria | 3726 |
| 123 | Ga0207693_10000797 | 3300025915 | Bacteria | 28134 |
| 124 | Ga0207693_10026933 | 3300025915 | Bacteria | 4547 |
| 125 | Ga0207693_10072793 | 3300025915 | Bacteria | 2690 |
| 126 | Ga0207663_10022595 | 3300025916 | Bacteria | 3598 |
| 127 | Ga0207663_10027758 | 3300025916 | Bacteria | 3304 |
| 128 | Ga0207660_10020386 | 3300025917 | Bacteria | 4447 |
| 129 | Ga0207660_10053506 | 3300025917 | Bacteria | 2878 |
| 130 | Ga0207657_10000299 | 3300025919 | Bacteria | 52815 |
| 131 | Ga0207652_10025421 | 3300025921 | Bacteria | 4923 |
| 132 | Ga0207646_10004651 | 3300025922 | Bacteria | 14812 |
| 133 | Ga0207646_10099144 | 3300025922 | Bacteria | 2611 |
| 134 | Ga0207694_10037299 | 3300025924 | Bacteria | 3733 |
| 135 | Ga0207650_10004030 | 3300025925 | Bacteria | 10046 |
| 136 | Ga0207687_10004012 | 3300025927 | Bacteria | 9864 |
| 137 | Ga0207687_10051028 | 3300025927 | Bacteria | 2882 |
| 138 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 139 | Ga0207700_10005890 | 3300025928 | Bacteria | 7370 |
| 140 | Ga0207700_10007847 | 3300025928 | Bacteria | 6563 |
| 141 | Ga0207700_10009821 | 3300025928 | Bacteria | 6001 |
| 142 | Ga0207664_10010013 | 3300025929 | Bacteria | 6681 |
| 143 | Ga0207664_10021677 | 3300025929 | Bacteria | 4784 |
| 144 | Ga0207664_10028774 | 3300025929 | Bacteria | 4226 |
| 145 | Ga0207706_10010925 | 3300025933 | Bacteria | 8280 |
| 146 | Ga0207686_10000004 | 3300025934 | Bacteria | 349251 |
| 147 | Ga0207686_10031438 | 3300025934 | Bacteria | 3152 |
| 148 | Ga0207709_10000028 | 3300025935 | Bacteria | 334429 |
| 149 | Ga0207704_10011912 | 3300025938 | Bacteria | 4301 |
| 150 | Ga0207704_10032542 | 3300025938 | Bacteria | 2952 |
| 151 | Ga0207665_10001701 | 3300025939 | Bacteria | 14795 |
| 152 | Ga0207665_10005324 | 3300025939 | Bacteria | 8599 |
| 153 | Ga0207691_10108059 | 3300025940 | Bacteria | 2476 |
| 154 | Ga0207661_10005180 | 3300025944 | Bacteria | 9163 |
| 155 | Ga0207661_10025701 | 3300025944 | Bacteria | 4479 |
| 156 | Ga0207668_10093861 | 3300025972 | Bacteria | 2212 |
| 157 | Ga0207658_10014786 | 3300025986 | Bacteria | 5348 |
| 158 | Ga0207703_10077018 | 3300026035 | Unclassified | 2768 |
| 159 | Ga0207702_10012256 | 3300026078 | Bacteria | 7135 |
| 160 | Ga0207702_10036853 | 3300026078 | Bacteria | 4091 |
| 161 | Ga0207676_10040336 | 3300026095 | Bacteria | 3578 |
| 162 | Ga0207674_10046096 | 3300026116 | Bacteria | 4478 |
| 163 | Ga0207674_10083612 | 3300026116 | Bacteria | 3191 |
| 164 | Ga0207675_100007997 | 3300026118 | Bacteria | 9964 |
| 165 | Ga0207675_100013600 | 3300026118 | Bacteria | 7597 |
| 166 | Ga0207683_10001788 | 3300026121 | Bacteria | 19030 |
| 167 | Ga0207683_10008439 | 3300026121 | Bacteria | 8817 |
| 168 | Ga0207428_10003917 | 3300027907 | Bacteria | 14275 |
| 169 | Ga0265318_10010744 | 3300028577 | Bacteria | 3975 |
| 170 | Ga0265336_10017647 | 3300028666 | Bacteria | 2322 |
| 171 | Ga0265338_10015807 | 3300028800 | Bacteria | 8263 |
| 172 | Ga0265338_10016270 | 3300028800 | Bacteria | 8104 |
| 173 | Ga0265338_10016377 | 3300028800 | Bacteria | 8073 |
| 174 | Ga0265338_10020387 | 3300028800 | Bacteria | 6975 |
| 175 | Ga0265338_10047022 | 3300028800 | Bacteria | 3946 |
| 176 | Ga0265325_10025132 | 3300031241 | Bacteria | 3235 |
| 177 | Ga0265339_10039248 | 3300031249 | Bacteria | 2637 |
| 178 | Ga0265316_10033459 | 3300031344 | Bacteria | 4186 |
| 179 | Ga0265316_10051288 | 3300031344 | Bacteria | 3241 |
| 180 | Ga0265313_10011651 | 3300031595 | Bacteria | 5448 |
| 181 | Ga0265314_10013147 | 3300031711 | Bacteria | 6706 |
| 182 | Ga0307409_100058648 | 3300031995 | Bacteria | 2991 |
| 183 | Ga0307416_100011036 | 3300032002 | Bacteria | 6002 |
| 184 | Ga0307411_10055163 | 3300032005 | Bacteria | 2613 |
| 185 | Ga0307415_100006503 | 3300032126 | Bacteria | 6313 |
| 186 | Ga0373929_0003377 | 3300035085 | Bacteria | 2882 |
| 187 | Ga0373944_0006286 | 3300035089 | Bacteria | 3149 |
| 188 | Ga0373956_0032062 | 3300035119 | Bacteria | 2305 |
| 189 | Ga0373943_0000713 | 3300035170 | Bacteria | 14523 |
| 190 | Ga0373943_0006172 | 3300035170 | Bacteria | 5379 |
| 191 | Ga0373943_0007113 | 3300035170 | Bacteria | 5021 |
| 192 | Ga0373946_0007094 | 3300035171 | Bacteria | 4090 |
| 193 | Ga0373935_0047664 | 3300035692 | Bacteria | 2710 |
| 194 | Ga0373927_0010890 | 3300035695 | Bacteria | 6057 |
| 195 | Ga0373933_0013384 | 3300035724 | Bacteria | 4546 |
| 196 | Ga0373947_0006646 | 3300035725 | Bacteria | 6711 |
| 197 | Ga0373947_0009996 | 3300035725 | Bacteria | 5447 |
| 198 | Ga0373947_0011041 | 3300035725 | Bacteria | 5184 |
| 199 | Ga0373947_0016652 | 3300035725 | Bacteria | 4223 |
| 200 | Ga0373937_0000921 | 3300036401 | Bacteria | 24951 |
| 201 | Ga0373937_0114843 | 3300036401 | Bacteria | 2506 |
| 202 | Ga0373925_0001342 | 3300037068 | Bacteria | 21503 |
| 203 | Ga0373925_0013743 | 3300037068 | Bacteria | 5859 |
| 204 | Ga0395899_0001897 | 3300037312 | Bacteria | 17264 |
| 205 | Ga0395899_0005633 | 3300037312 | Bacteria | 9721 |
| 206 | Ga0395899_0027349 | 3300037312 | Bacteria | 4301 |
| 207 | Ga0395899_0063600 | 3300037312 | Bacteria | 2714 |
| 208 | Ga0395900_0002741 | 3300037418 | Bacteria | 19239 |
| 209 | Ga0395900_0009667 | 3300037418 | Bacteria | 9887 |
| 210 | Ga0395900_0013511 | 3300037418 | Bacteria | 8343 |
| 211 | Ga0395900_0025542 | 3300037418 | Bacteria | 6047 |
| 212 | Ga0395900_0050434 | 3300037418 | Bacteria | 4287 |
| 213 | Ga0395900_0141341 | 3300037418 | Bacteria | 2465 |
| 214 | Ga0395898_0017713 | 3300037466 | Bacteria | 7270 |
| 215 | Ga0395898_0018356 | 3300037466 | Bacteria | 7133 |
| 216 | Ga0395898_0020873 | 3300037466 | Bacteria | 6647 |
| 217 | Ga0395898_0031774 | 3300037466 | Bacteria | 5272 |
| 218 | Ga0395898_0034764 | 3300037466 | Bacteria | 5017 |
| 219 | Ga0395898_0038603 | 3300037466 | Bacteria | 4731 |
| 220 | Ga0395898_0048404 | 3300037466 | Bacteria | 4169 |
| 221 | Ga0395898_0068747 | 3300037466 | Bacteria | 3427 |
| 222 | Ga0395905_0009398 | 3300037471 | Bacteria | 9559 |
| 223 | Ga0395905_0040311 | 3300037471 | Bacteria | 4381 |
| 224 | Ga0395905_0047279 | 3300037471 | Bacteria | 4033 |
| 225 | Ga0395905_0050802 | 3300037471 | Bacteria | 3884 |
| 226 | Ga0395905_0095922 | 3300037471 | Bacteria | 2784 |
| 227 | Ga0395901_0004504 | 3300038443 | Bacteria | 14052 |
| 228 | Ga0395901_0005951 | 3300038443 | Bacteria | 12351 |
| 229 | Ga0395901_0010778 | 3300038443 | Bacteria | 9267 |
| 230 | Ga0395901_0011152 | 3300038443 | Bacteria | 9106 |
| 231 | Ga0395901_0014936 | 3300038443 | Bacteria | 7890 |
| 232 | Ga0395901_0021061 | 3300038443 | Bacteria | 6679 |
| 233 | Ga0395901_0035884 | 3300038443 | Bacteria | 5123 |
| 234 | Ga0395901_0044547 | 3300038443 | Bacteria | 4602 |
| 235 | Ga0395901_0050064 | 3300038443 | Bacteria | 4341 |
| 236 | Ga0395901_0054686 | 3300038443 | Bacteria | 4149 |
| 237 | Ga0395901_0066428 | 3300038443 | Bacteria | 3756 |
| 238 | Ga0395901_0103831 | 3300038443 | Bacteria | 2982 |
| 239 | Ga0395901_0158415 | 3300038443 | Bacteria | 2378 |
| 240 | Ga0451798_0061935 | 3300041458 | Bacteria | 2518 |
| 241 | Ga0451800_1305818 | 3300041459 | Bacteria | 4398 |
| 242 | Ga0451835_0463010 | 3300041492 | Bacteria | 3407 |
| 243 | Ga0451847_0213419 | 3300041503 | Bacteria | 2407 |
| 244 | Ga0439448_0001266 | 3300042005 | Bacteria | 6463 |
| 245 | Ga0466969_0001557 | 3300044656 | Bacteria | 12315 |
| 246 | Ga0466969_0018725 | 3300044656 | Bacteria | 3605 |
| 247 | Ga0466966_0004349 | 3300044684 | Bacteria | 9342 |
| 248 | Ga0466966_0021473 | 3300044684 | Bacteria | 4239 |
| 249 | Ga0466961_0002376 | 3300044693 | Bacteria | 11691 |
| 250 | Ga0466961_0003110 | 3300044693 | Bacteria | 10334 |
| 251 | Ga0466961_0008403 | 3300044693 | Bacteria | 6575 |
| 252 | Ga0466961_0024448 | 3300044693 | Bacteria | 3886 |
| 253 | Ga0466961_0046826 | 3300044693 | Bacteria | 2765 |
| 254 | Ga0466963_0000295 | 3300044694 | Bacteria | 22402 |
| 255 | Ga0466963_0002164 | 3300044694 | Bacteria | 10857 |
| 256 | Ga0466963_0003302 | 3300044694 | Bacteria | 9201 |
| 257 | Ga0466963_0004570 | 3300044694 | Bacteria | 8055 |
| 258 | Ga0466963_0007442 | 3300044694 | Bacteria | 6527 |
| 259 | Ga0466963_0007729 | 3300044694 | Bacteria | 6424 |
| 260 | Ga0466963_0008549 | 3300044694 | Bacteria | 6143 |
| 261 | Ga0466963_0009984 | 3300044694 | Bacteria | 5737 |
| 262 | Ga0466963_0010921 | 3300044694 | Bacteria | 5516 |
| 263 | Ga0466963_0021854 | 3300044694 | Bacteria | 4043 |
| 264 | Ga0466964_0000527 | 3300044706 | Bacteria | 11975 |
| 265 | Ga0466964_0007720 | 3300044706 | Bacteria | 4027 |
| 266 | Ga0466964_0020912 | 3300044706 | Bacteria | 2525 |
| 267 | Ga0466971_0000590 | 3300044719 | Bacteria | 14368 |
| 268 | Ga0466971_0001451 | 3300044719 | Bacteria | 9982 |
| 269 | Ga0466968_0000752 | 3300044735 | Bacteria | 11232 |
| 270 | Ga0466968_0001498 | 3300044735 | Bacteria | 8360 |
| 271 | Ga0466968_0002452 | 3300044735 | Bacteria | 6804 |
| 272 | Ga0466970_0004375 | 3300044765 | Bacteria | 6959 |
| 273 | Ga0466957_0001198 | 3300044842 | Bacteria | 13515 |
| 274 | Ga0466957_0002401 | 3300044842 | Bacteria | 10055 |
| 275 | Ga0466957_0002405 | 3300044842 | Bacteria | 10047 |
| 276 | Ga0466957_0002526 | 3300044842 | Bacteria | 9843 |
| 277 | Ga0466957_0003540 | 3300044842 | Bacteria | 8598 |
| 278 | Ga0466957_0018267 | 3300044842 | Bacteria | 4117 |
| 279 | Ga0466957_0024015 | 3300044842 | Bacteria | 3608 |
| 280 | Ga0466957_0024686 | 3300044842 | Bacteria | 3559 |
| 281 | Ga0466960_0002014 | 3300044901 | Bacteria | 7537 |
| 282 | Ga0466960_0043870 | 3300044901 | Bacteria | 2130 |
| 283 | Ga0466959_0000831 | 3300045049 | Bacteria | 18229 |
| 284 | Ga0466959_0006977 | 3300045049 | Bacteria | 7893 |
| 285 | Ga0466959_0007329 | 3300045049 | Bacteria | 7731 |
| 286 | Ga0466959_0037307 | 3300045049 | Bacteria | 3590 |
| 287 | Ga0466959_0101787 | 3300045049 | Bacteria | 2056 |
| 288 | Ga0451576_0014006 | 3300045051 | Bacteria | 8941 |
| 289 | Ga0466958_0000860 | 3300045836 | Bacteria | 13532 |
| 290 | Ga0466958_0001026 | 3300045836 | Bacteria | 12733 |
| 291 | Ga0466958_0001749 | 3300045836 | Bacteria | 10513 |
| 292 | Ga0466958_0004821 | 3300045836 | Bacteria | 7179 |
| 293 | Ga0466958_0006894 | 3300045836 | Bacteria | 6212 |
| 294 | Ga0466958_0008478 | 3300045836 | Bacteria | 5706 |
| 295 | Ga0466958_0009025 | 3300045836 | Bacteria | 5536 |
| 296 | Ga0466958_0010145 | 3300045836 | Bacteria | 5265 |
| 297 | Ga0466958_0027359 | 3300045836 | Bacteria | 3375 |
| 298 | Ga0466967_0000957 | 3300045976 | Bacteria | 15637 |
| 299 | Ga0466967_0001277 | 3300045976 | Bacteria | 14306 |
| 300 | Ga0466967_0006331 | 3300045976 | Bacteria | 8358 |
| 301 | Ga0466967_0006442 | 3300045976 | Bacteria | 8305 |
| 302 | Ga0466967_0009473 | 3300045976 | Bacteria | 7228 |
| 303 | Ga0466967_0009578 | 3300045976 | Bacteria | 7200 |
| 304 | Ga0466967_0021448 | 3300045976 | Bacteria | 5247 |
| 305 | Ga0466967_0038022 | 3300045976 | Bacteria | 4124 |
| 306 | Ga0466967_0039428 | 3300045976 | Bacteria | 4061 |
| 307 | Ga0466967_0058688 | 3300045976 | Bacteria | 3402 |
| 308 | Ga0466967_0071494 | 3300045976 | Bacteria | 3107 |
| 309 | Ga0466967_0096475 | 3300045976 | Bacteria | 2697 |
| 310 | Ga0495592_0000075 | 3300046454 | Bacteria | 88214 |
| 311 | Ga0495592_0072584 | 3300046454 | Bacteria | 2504 |
| 312 | Ga0495603_0000962 | 3300046455 | Bacteria | 16598 |
| 313 | Ga0495603_0076317 | 3300046455 | Bacteria | 1967 |
| 314 | Ga0495641_0000472 | 3300046461 | Bacteria | 33428 |
| 315 | Ga0495641_0001728 | 3300046461 | Bacteria | 18228 |
| 316 | Ga0495641_0003785 | 3300046461 | Bacteria | 11088 |
| 317 | Ga0495641_0008818 | 3300046461 | Bacteria | 6080 |
| 318 | Ga0495641_0017106 | 3300046461 | Bacteria | 3791 |
| 319 | Ga0495651_0000344 | 3300046462 | Bacteria | 35980 |
| 320 | Ga0495651_0049119 | 3300046462 | Bacteria | 3257 |
| 321 | Ga0495651_0055466 | 3300046462 | Bacteria | 3044 |
| 322 | Ga0495651_0060024 | 3300046462 | Bacteria | 2914 |
| 323 | Ga0495651_0077263 | 3300046462 | Bacteria | 2520 |
| 324 | Ga0495653_0002590 | 3300046463 | Bacteria | 14395 |
| 325 | Ga0495653_0003311 | 3300046463 | Bacteria | 12933 |
| 326 | Ga0495653_0039932 | 3300046463 | Bacteria | 3672 |
| 327 | Ga0495580_0003552 | 3300046472 | Bacteria | 13244 |
| 328 | Ga0495582_0000585 | 3300046473 | Bacteria | 20182 |
| 329 | Ga0495582_0020642 | 3300046473 | Bacteria | 3606 |
| 330 | Ga0495582_0021723 | 3300046473 | Bacteria | 3512 |
| 331 | Ga0495639_0003168 | 3300046475 | Bacteria | 7148 |
| 332 | Ga0495662_0000314 | 3300046476 | Bacteria | 21029 |
| 333 | Ga0495662_0018729 | 3300046476 | Bacteria | 3352 |
| 334 | Ga0495664_0012764 | 3300046477 | Bacteria | 4759 |
| 335 | Ga0495664_0023109 | 3300046477 | Bacteria | 3606 |
| 336 | Ga0495594_0009639 | 3300046499 | Bacteria | 4992 |
| 337 | Ga0495607_0014549 | 3300046501 | Bacteria | 5116 |
| 338 | Ga0495608_0002205 | 3300046511 | Bacteria | 14066 |
| 339 | Ga0495608_0007897 | 3300046511 | Bacteria | 7477 |
| 340 | Ga0495618_0007881 | 3300046514 | Bacteria | 6446 |
| 341 | Ga0495618_0024324 | 3300046514 | Bacteria | 3750 |
| 342 | Ga0495628_0000329 | 3300046516 | Bacteria | 42884 |
| 343 | Ga0495628_0026571 | 3300046516 | Bacteria | 4717 |
| 344 | Ga0495628_0044891 | 3300046516 | Bacteria | 3514 |
| 345 | Ga0495628_0063586 | 3300046516 | Bacteria | 2891 |
| 346 | Ga0495630_0013513 | 3300046517 | Bacteria | 5938 |
| 347 | Ga0495630_0018166 | 3300046517 | Bacteria | 5164 |
| 348 | Ga0495644_0009202 | 3300046523 | Bacteria | 3806 |
| 349 | Ga0495666_0000339 | 3300046526 | Bacteria | 20415 |
| 350 | Ga0495652_0000111 | 3300046529 | Bacteria | 87928 |
| 351 | Ga0495652_0011077 | 3300046529 | Bacteria | 8169 |
| 352 | Ga0495652_0067123 | 3300046529 | Bacteria | 3008 |
| 353 | Ga0495665_0000420 | 3300046531 | Bacteria | 21621 |
| 354 | Ga0495665_0001861 | 3300046531 | Bacteria | 11392 |
| 355 | Ga0495640_0033102 | 3300046533 | Bacteria | 3675 |
| 356 | Ga0495640_0088963 | 3300046533 | Bacteria | 2040 |
| 357 | Ga0495586_0012457 | 3300046535 | Bacteria | 4510 |
| 358 | Ga0495587_0000100 | 3300046536 | Bacteria | 67315 |
| 359 | Ga0495587_0023561 | 3300046536 | Bacteria | 3783 |
| 360 | Ga0495587_0026035 | 3300046536 | Bacteria | 3569 |
| 361 | Ga0495645_0000046 | 3300046543 | Bacteria | 89390 |
| 362 | Ga0495645_0056861 | 3300046543 | Bacteria | 2840 |
| 363 | Ga0495645_0105194 | 3300046543 | Bacteria | 2003 |
| 364 | Ga0495667_0021737 | 3300046559 | Bacteria | 4329 |
| 365 | Ga0495667_0090976 | 3300046559 | Bacteria | 1977 |
| 366 | Ga0495656_0004325 | 3300046615 | Bacteria | 4856 |
| 367 | Ga0495634_0019257 | 3300046642 | Bacteria | 4849 |
| 368 | Ga0495634_0022604 | 3300046642 | Bacteria | 4430 |
| 369 | Ga0495635_0006782 | 3300046663 | Bacteria | 8002 |
| 370 | Ga0495635_0031412 | 3300046663 | Bacteria | 3687 |
| 371 | Ga0495588_0000666 | 3300046674 | Bacteria | 15878 |
| 372 | Ga0495657_0006756 | 3300046675 | Bacteria | 8943 |
| 373 | Ga0495599_0000086 | 3300046678 | Bacteria | 64425 |
| 374 | Ga0495599_0002616 | 3300046678 | Bacteria | 10493 |
| 375 | Ga0495599_0033582 | 3300046678 | Bacteria | 3224 |
| 376 | Ga0495599_0054022 | 3300046678 | Bacteria | 2516 |
| 377 | Ga0495623_0000037 | 3300046679 | Bacteria | 80938 |
| 378 | Ga0495623_0031223 | 3300046679 | Bacteria | 3425 |
| 379 | Ga0495646_0016353 | 3300046680 | Bacteria | 4707 |
| 380 | Ga0495646_0050084 | 3300046680 | Bacteria | 2533 |
| 381 | Ga0495647_0000750 | 3300046681 | Bacteria | 9638 |
| 382 | Ga0495658_0001836 | 3300046683 | Bacteria | 10871 |
| 383 | Ga0495658_0007173 | 3300046683 | Bacteria | 5505 |
| 384 | Ga0495658_0035094 | 3300046683 | Bacteria | 2757 |
| 385 | Ga0495613_0019145 | 3300046689 | Bacteria | 5102 |
| 386 | Ga0495613_0035320 | 3300046689 | Bacteria | 3710 |
| 387 | Ga0495613_0037530 | 3300046689 | Bacteria | 3592 |
| 388 | Ga0495613_0063544 | 3300046689 | Bacteria | 2701 |
| 389 | Ga0495600_0005625 | 3300046809 | Bacteria | 7569 |
| 390 | Ga0495600_0031778 | 3300046809 | Bacteria | 3422 |
| 391 | Ga0495581_0000648 | 3300047315 | Bacteria | 18222 |
| 392 | Ga0495581_0006575 | 3300047315 | Bacteria | 6733 |
| 393 | Ga0495581_0100782 | 3300047315 | Bacteria | 1678 |
| 394 | Ga0495604_0000080 | 3300047317 | Bacteria | 83113 |
| 395 | Ga0495674_0008195 | 3300047319 | Bacteria | 9971 |
| 396 | Ga0495674_0031112 | 3300047319 | Bacteria | 4849 |
| 397 | Ga0495674_0067706 | 3300047319 | Bacteria | 3092 |
| 398 | Ga0495676_0000548 | 3300047321 | Bacteria | 30843 |
| 399 | Ga0495676_0031735 | 3300047321 | Bacteria | 4464 |
| 400 | Ga0495676_0033605 | 3300047321 | Bacteria | 4316 |
| 401 | Ga0495680_0002321 | 3300047322 | Bacteria | 19510 |
| 402 | Ga0495680_0006534 | 3300047322 | Bacteria | 10824 |
| 403 | Ga0495680_0006791 | 3300047322 | Bacteria | 10571 |
| 404 | Ga0495680_0010943 | 3300047322 | Bacteria | 8061 |
| 405 | Ga0495680_0035152 | 3300047322 | Bacteria | 4038 |
| 406 | Ga0495675_0000060 | 3300047444 | Bacteria | 76099 |
| 407 | Ga0495684_0001384 | 3300047471 | Bacteria | 19473 |
| 408 | Ga0495684_0002833 | 3300047471 | Bacteria | 13668 |
| 409 | Ga0495684_0010241 | 3300047471 | Bacteria | 7251 |
| 410 | Ga0495593_0004952 | 3300047673 | Bacteria | 7891 |
| 411 | Ga0495593_0022089 | 3300047673 | Bacteria | 3550 |
| 412 | Ga0495602_0000075 | 3300048088 | Bacteria | 95851 |
| 413 | Ga0495602_0027938 | 3300048088 | Bacteria | 5411 |
| 414 | Ga0495602_0043869 | 3300048088 | Bacteria | 4060 |
| 415 | Ga0495602_0085066 | 3300048088 | Bacteria | 2644 |
| 416 | Ga0496100_0002541 | 3300048903 | Bacteria | 9300 |
| 417 | Ga0496101_0002117 | 3300048904 | Bacteria | 12102 |
| 418 | Ga0496101_0021901 | 3300048904 | Bacteria | 4392 |
| 419 | Ga0496101_0028624 | 3300048904 | Bacteria | 3891 |
| 420 | Ga0496101_0042179 | 3300048904 | Bacteria | 3257 |
| 421 | Ga0496101_0045670 | 3300048904 | Bacteria | 3138 |
| 422 | Ga0496102_0007800 | 3300048905 | Bacteria | 9150 |
| 423 | Ga0496102_0013826 | 3300048905 | Bacteria | 7005 |
| 424 | Ga0496102_0030931 | 3300048905 | Bacteria | 4795 |
| 425 | Ga0496103_0002645 | 3300048906 | Bacteria | 11207 |
| 426 | Ga0496103_0028729 | 3300048906 | Bacteria | 3377 |
| 427 | Ga0496104_0002859 | 3300048907 | Bacteria | 14876 |
| 428 | Ga0496104_0006744 | 3300048907 | Bacteria | 10112 |
| 429 | Ga0496104_0006985 | 3300048907 | Bacteria | 9955 |
| 430 | Ga0496104_0049169 | 3300048907 | Bacteria | 3976 |
| 431 | Ga0496104_0100457 | 3300048907 | Bacteria | 2769 |
| 432 | Ga0496105_0000255 | 3300048908 | Bacteria | 35883 |
| 433 | Ga0496105_0000750 | 3300048908 | Bacteria | 22004 |
| 434 | Ga0496105_0009288 | 3300048908 | Bacteria | 7686 |
| 435 | Ga0496105_0010646 | 3300048908 | Bacteria | 7236 |
| 436 | Ga0496105_0040766 | 3300048908 | Bacteria | 3829 |
| 437 | Ga0496105_0157255 | 3300048908 | Bacteria | 1866 |
| 438 | Ga0496106_0000449 | 3300048909 | Bacteria | 29371 |
| 439 | Ga0496106_0012351 | 3300048909 | Bacteria | 6304 |
| 440 | Ga0496106_0018646 | 3300048909 | Bacteria | 5135 |
| 441 | Ga0496106_0021859 | 3300048909 | Bacteria | 4752 |
| 442 | Ga0496106_0050048 | 3300048909 | Bacteria | 3148 |
| 443 | Ga0496106_0059562 | 3300048909 | Bacteria | 2892 |
| 444 | Ga0496107_0007161 | 3300048910 | Bacteria | 7686 |
| 445 | Ga0496107_0009985 | 3300048910 | Bacteria | 6584 |
| 446 | Ga0496107_0013350 | 3300048910 | Bacteria | 5739 |
| 447 | Ga0496107_0049466 | 3300048910 | Bacteria | 3029 |
| 448 | Ga0496107_0083783 | 3300048910 | Bacteria | 2325 |
| 449 | Ga0496108_0003540 | 3300048911 | Bacteria | 12521 |
| 450 | Ga0496108_0004794 | 3300048911 | Bacteria | 10910 |
| 451 | Ga0496108_0007596 | 3300048911 | Bacteria | 8780 |
| 452 | Ga0496108_0014723 | 3300048911 | Bacteria | 6383 |
| 453 | Ga0496108_0104864 | 3300048911 | Bacteria | 2413 |
| 454 | Ga0496109_0001531 | 3300048912 | Bacteria | 19233 |
| 455 | Ga0496109_0017092 | 3300048912 | Bacteria | 6348 |
| 456 | Ga0496109_0021960 | 3300048912 | Bacteria | 5650 |
| 457 | Ga0496109_0045614 | 3300048912 | Bacteria | 3978 |
| 458 | Ga0496109_0048628 | 3300048912 | Bacteria | 3858 |
| 459 | Ga0496109_0057382 | 3300048912 | Bacteria | 3554 |
| 460 | Ga0496109_0129479 | 3300048912 | Bacteria | 2355 |
| 461 | Ga0496110_0000810 | 3300048913 | Bacteria | 21899 |
| 462 | Ga0496110_0001410 | 3300048913 | Bacteria | 17372 |
| 463 | Ga0496110_0002008 | 3300048913 | Bacteria | 15145 |
| 464 | Ga0496110_0004466 | 3300048913 | Bacteria | 10844 |
| 465 | Ga0496110_0008011 | 3300048913 | Bacteria | 8468 |
| 466 | Ga0496110_0014324 | 3300048913 | Bacteria | 6580 |
| 467 | Ga0496110_0027796 | 3300048913 | Bacteria | 4851 |
| 468 | Ga0496110_0051584 | 3300048913 | Bacteria | 3615 |
| 469 | Ga0496110_0071401 | 3300048913 | Bacteria | 3078 |
| 470 | Ga0496111_0000034 | 3300048914 | Bacteria | 54519 |
| 471 | Ga0496111_0000638 | 3300048914 | Bacteria | 18456 |
| 472 | Ga0496111_0001587 | 3300048914 | Bacteria | 13129 |
| 473 | Ga0496111_0004994 | 3300048914 | Bacteria | 8439 |
| 474 | Ga0496111_0007409 | 3300048914 | Bacteria | 7189 |
| 475 | Ga0496111_0016285 | 3300048914 | Bacteria | 5119 |
| 476 | Ga0496111_0018163 | 3300048914 | Bacteria | 4869 |
| 477 | Ga0496111_0019596 | 3300048914 | Bacteria | 4703 |
| 478 | Ga0496111_0028767 | 3300048914 | Bacteria | 3940 |
| 479 | Ga0496112_0000204 | 3300048915 | Bacteria | 38947 |
| 480 | Ga0496112_0006067 | 3300048915 | Bacteria | 10558 |
| 481 | Ga0496112_0022651 | 3300048915 | Bacteria | 5990 |
| 482 | Ga0496112_0034780 | 3300048915 | Bacteria | 4903 |
| 483 | Ga0496112_0075666 | 3300048915 | Bacteria | 3329 |
| 484 | Ga0496112_0134748 | 3300048915 | Bacteria | 2440 |
| 485 | Ga0496113_0021430 | 3300048916 | Bacteria | 4559 |
| 486 | Ga0496113_0026074 | 3300048916 | Bacteria | 4175 |
| 487 | Ga0496113_0036630 | 3300048916 | Bacteria | 3595 |
| 488 | Ga0496113_0060496 | 3300048916 | Bacteria | 2855 |
| 489 | Ga0496113_0093296 | 3300048916 | Bacteria | 2323 |
| 490 | Ga0496114_0000923 | 3300048917 | Bacteria | 21968 |
| 491 | Ga0496114_0005338 | 3300048917 | Bacteria | 10043 |
| 492 | Ga0496114_0028799 | 3300048917 | Bacteria | 4561 |
| 493 | Ga0496114_0070639 | 3300048917 | Bacteria | 2933 |
| 494 | Ga0496115_0004501 | 3300048918 | Bacteria | 10083 |
| 495 | Ga0496115_0033036 | 3300048918 | Bacteria | 4084 |
| 496 | Ga0501031_0000809 | 3300049568 | Bacteria | 18820 |
| 497 | Ga0501031_0006967 | 3300049568 | Bacteria | 7382 |
| 498 | Ga0501033_0000948 | 3300049570 | Bacteria | 26325 |
| 499 | Ga0501033_0032755 | 3300049570 | Bacteria | 3903 |
| 500 | Ga0501034_0074024 | 3300049571 | Bacteria | 3415 |
| 501 | Ga0501036_0095971 | 3300049572 | Bacteria | 2506 |
| 502 | Ga0501037_0003338 | 3300049573 | Bacteria | 11660 |
| 503 | Ga0501038_0001030 | 3300049574 | Bacteria | 25161 |
| 504 | Ga0501038_0002937 | 3300049574 | Bacteria | 15901 |
| 505 | Ga0501039_0002129 | 3300049575 | Bacteria | 14657 |
| 506 | Ga0501040_0016841 | 3300049576 | Bacteria | 4846 |
| 507 | Ga0501041_0001786 | 3300049577 | Bacteria | 12044 |
| 508 | Ga0501043_0005483 | 3300049579 | Bacteria | 10249 |
| 509 | Ga0501043_0011077 | 3300049579 | Bacteria | 7064 |
| 510 | Ga0501046_0002426 | 3300049580 | Bacteria | 17479 |
| 511 | Ga0501047_0139107 | 3300049581 | Bacteria | 2307 |
| 512 | Ga0501048_0010921 | 3300049582 | Bacteria | 6774 |
| 513 | Ga0501048_0041271 | 3300049582 | Bacteria | 3306 |
| 514 | Ga0501067_0002658 | 3300049583 | Bacteria | 9895 |
| 515 | Ga0501068_0002172 | 3300049584 | Bacteria | 10452 |
| 516 | Ga0501069_0019885 | 3300049585 | Bacteria | 3633 |
| 517 | Ga0501070_0000049 | 3300049586 | Bacteria | 104564 |
| 518 | Ga0501070_0002768 | 3300049586 | Bacteria | 15306 |
| 519 | Ga0501070_0012190 | 3300049586 | Bacteria | 7254 |
| 520 | Ga0501071_0004475 | 3300049587 | Bacteria | 8872 |
| 521 | Ga0501072_0012308 | 3300049588 | Bacteria | 6538 |
| 522 | Ga0501073_0000550 | 3300049589 | Bacteria | 26515 |
| 523 | Ga0501073_0002187 | 3300049589 | Bacteria | 14621 |
| 524 | Ga0501074_0000503 | 3300049590 | Bacteria | 24003 |
| 525 | Ga0501080_0001089 | 3300049742 | Bacteria | 22370 |
| 526 | Ga0501080_0001890 | 3300049742 | Bacteria | 18030 |
| 527 | Ga0501080_0063609 | 3300049742 | Bacteria | 3434 |
| 528 | Ga0501080_0079349 | 3300049742 | Bacteria | 3052 |
| 529 | Ga0501081_0001281 | 3300049743 | Bacteria | 15290 |
| 530 | Ga0501081_0056411 | 3300049743 | Bacteria | 2715 |
| 531 | Ga0501081_0078354 | 3300049743 | Bacteria | 2310 |
| 532 | Ga0501083_0000816 | 3300049744 | Bacteria | 20385 |
| 533 | Ga0501035_0007156 | 3300049822 | Bacteria | 10438 |
| 534 | Ga0501035_0085788 | 3300049822 | Bacteria | 2775 |
| 535 | Ga0501044_0019942 | 3300049823 | Bacteria | 7162 |
| 536 | Ga0501044_0056558 | 3300049823 | Bacteria | 4028 |
| 537 | Ga0501045_0000585 | 3300049824 | Bacteria | 22890 |
| 538 | nmdc:mga05p37_103850_c1 | 3300050507 | Bacteria | 3497 |
| 539 | nmdc:mga05p37_22170_c1 | 3300050507 | Bacteria | 7699 |
| 540 | nmdc:mga05p37_42427_c1 | 3300050507 | Bacteria | 5589 |
| 541 | nmdc:mga05p37_56521_c1 | 3300050507 | Bacteria | 4832 |
| 542 | nmdc:mga06r32_303094_c1 | 3300050510 | Bacteria | 1584 |
| 543 | nmdc:mga06r32_71843_c1 | 3300050510 | Bacteria | 3349 |
| 544 | nmdc:mga08y16_148565_c1 | 3300050511 | Bacteria | 2436 |
| 545 | nmdc:mga08y16_5425_c1 | 3300050511 | Bacteria | 13335 |
| 546 | nmdc:mga08y16_76228_c1 | 3300050511 | Bacteria | 3495 |
| 547 | nmdc:mga0n895_154406_c1 | 3300050512 | Bacteria | 2326 |
| 548 | nmdc:mga0n895_16016_c1 | 3300050512 | Bacteria | 6866 |
| 549 | nmdc:mga0rr50_933_c2 | 3300050513 | Bacteria | 13017 |
| 550 | nmdc:mga08x19_22600_c1 | 3300050514 | Bacteria | 3896 |
| 551 | nmdc:mga08x19_71609_c1 | 3300050514 | Bacteria | 2260 |
| 552 | nmdc:mga0a205_137069_c1 | 3300050515 | Bacteria | 2348 |
| 553 | nmdc:mga0a205_27351_c1 | 3300050515 | Bacteria | 5448 |
| 554 | nmdc:mga0a205_4922_c1 | 3300050515 | Bacteria | 12016 |
| 555 | nmdc:mga0a205_73002_c1 | 3300050515 | Bacteria | 3315 |
| 556 | Ga0495601_0000040 | 3300053077 | Bacteria | 79488 |
| 557 | Ga0495612_0001962 | 3300053078 | Bacteria | 8474 |
| 558 | Ga0495612_0013384 | 3300053078 | Bacteria | 3305 |
| 559 | Ga0495595_0010510 | 3300053084 | Bacteria | 3848 |
| 560 | Ga0495619_0000615 | 3300053085 | Bacteria | 23532 |
| 561 | Ga0495619_0004088 | 3300053085 | Bacteria | 9341 |
| 562 | Ga0495619_0004325 | 3300053085 | Bacteria | 9061 |
| 563 | Ga0495619_0008072 | 3300053085 | Bacteria | 6662 |
| 564 | Ga0495619_0031917 | 3300053085 | Bacteria | 3415 |
| 565 | Ga0495619_0033546 | 3300053085 | Bacteria | 3334 |
| 566 | Ga0495619_0038341 | 3300053085 | Bacteria | 3126 |
| 567 | Ga0500566_0033627 | 3300053094 | Bacteria | 2986 |
| 568 | Ga0501084_0009831 | 3300054114 | Bacteria | 7902 |
| 569 | Ga0501082_0001714 | 3300060353 | Bacteria | 19338 |
| 570 | Ga0501082_0030677 | 3300060353 | Bacteria | 4634 |
| 571 | Ga0466962_0001633 | 3300061719 | Bacteria | 10512 |
| 572 | Ga0466962_0001644 | 3300061719 | Bacteria | 10476 |
| 573 | Ga0466962_0002064 | 3300061719 | Bacteria | 9501 |
| 574 | Ga0466962_0016212 | 3300061719 | Bacteria | 3594 |
| 575 | Ga0530510_0001637 | 3300061734 | Bacteria | 15131 |
| 576 | 2895504101 | 2895498888 | Bacteria | 5283788 |
| 577 | 2895515455 | 2895511927 | Bacteria | 6802080 |
| 578 | 2895525034 | 2895522137 | Bacteria | 3284416 |
| 579 | 2895527743 | 2895525241 | Bacteria | 3388457 |
| 580 | Ga0207675_100081603 | |||
| 581 | JGI25407J50210_10000296 | |||
| 582 | Ga0070683_100009621 | |||
| 583 | Ga0070683_100010636 | |||
| 584 | Ga0070683_100044242 | |||
| 585 | Ga0070680_100014560 | |||
| 586 | Ga0070680_100085339 | |||
| 587 | Ga0070682_100010759 | |||
| 588 | Ga0070692_10027603 | |||
| 589 | Ga0070692_10054506 | |||
| 590 | Ga0070674_100009597 | |||
| 591 | Ga0070674_100035285 | |||
| 592 | Ga0070674_100087382 | |||
| 593 | Ga0070673_100003722 | |||
| 594 | Ga0070688_100045641 | |||
| 595 | Ga0070667_100006289 | |||
| 596 | Ga0070703_10007165 | |||
| 597 | Ga0070714_100003825 | |||
| 598 | Ga0070714_100009995 | |||
| 599 | Ga0070714_100019611 | |||
| 600 | Ga0070714_100056431 | |||
| 601 | Ga0070714_100144371 | |||
| 602 | Ga0070713_100010133 | |||
| 603 | Ga0070713_100017556 | |||
| 604 | Ga0070713_100029792 | |||
| 605 | Ga0070713_100035926 | |||
| 606 | Ga0070713_100079900 | |||
| 607 | Ga0070694_100000416 | |||
| 608 | Ga0070708_100014798 | |||
| 609 | Ga0070708_100102497 | |||
| 610 | Ga0070678_100025008 | |||
| 611 | Ga0070706_100065063 | |||
| 612 | Ga0070707_100002701 | |||
| 613 | Ga0070707_100008868 | |||
| 614 | Ga0070707_100139049 | |||
| 615 | Ga0070698_100019860 | |||
| 616 | Ga0070699_100058465 | |||
| 617 | Ga0070679_100010400 | |||
| 618 | Ga0070679_100014711 | |||
| 619 | Ga0070679_100045991 | |||
| 620 | Ga0070684_100015765 | |||
| 621 | Ga0070684_100023556 | |||
| 622 | Ga0070697_100069212 | |||
| 623 | Ga0070686_100062960 | |||
| 624 | Ga0070665_100054615 | |||
| 625 | Ga0068855_100022559 | |||
| 626 | Ga0068855_100167402 | |||
| 627 | Ga0068855_100240847 | |||
| 628 | Ga0070664_100034803 | |||
| 629 | Ga0068857_100004546 | |||
| 630 | Ga0068856_100006776 | |||
| 631 | Ga0068864_100015164 | |||
| 632 | Ga0068870_10002990 | |||
| 633 | Ga0068870_10012320 | |||
| 634 | Ga0081455_10003628 | |||
| 635 | Ga0081455_10010008 | |||
| 636 | Ga0081455_10010129 | |||
| 637 | Ga0081455_10021363 | |||
| 638 | Ga0081538_10000055 | |||
| 639 | Ga0081538_10000181 | |||
| 640 | Ga0081538_10006367 | |||
| 641 | Ga0081538_10043478 | |||
| 642 | Ga0081540_1002875 | |||
| 643 | Ga0081540_1028792 | |||
| 644 | Ga0070717_10002526 | |||
| 645 | Ga0070717_10019040 | |||
| 646 | Ga0070712_100043874 | |||
| 647 | Ga0075428_100055161 | |||
| 648 | Ga0075428_100059347 | |||
| 649 | Ga0075433_10008591 | |||
| 650 | Ga0075433_10013027 | |||
| 651 | Ga0075433_10035084 | |||
| 652 | Ga0075433_10078043 | |||
| 653 | Ga0075433_10126158 | |||
| 654 | Ga0075434_100002112 | |||
| 655 | Ga0075434_100048603 | |||
| 656 | Ga0075434_100108830 | |||
| 657 | Ga0068865_100084618 | |||
| 658 | Ga0075436_100004922 | |||
| 659 | Ga0075436_100017849 | |||
| 660 | Ga0075435_100007173 | |||
| 661 | Ga0075435_100069122 | |||
| 662 | Ga0075435_100116080 | |||
| 663 | Ga0105240_10084629 | |||
| 664 | Ga0105240_10147933 | |||
| 665 | Ga0111539_10047122 | |||
| 666 | Ga0111539_10055644 | |||
| 667 | Ga0111539_10072803 | |||
| 668 | Ga0105245_10004292 | |||
| 669 | Ga0105245_10040830 | |||
| 670 | Ga0105245_10071367 | |||
| 671 | Ga0105247_10009428 | |||
| 672 | Ga0114129_10021204 | |||
| 673 | Ga0114129_10035154 | |||
| 674 | Ga0114129_10189480 | |||
| 675 | Ga0105243_10000083 | |||
| 676 | Ga0105241_10073862 | |||
| 677 | Ga0105242_10000027 | |||
| 678 | Ga0105242_10053783 | |||
| 679 | Ga0105248_10170393 | |||
| 680 | Ga0105249_10011417 | |||
| 681 | Ga0105249_10087980 | |||
| 682 | Ga0105239_10098829 | |||
| 683 | Ga0105246_10003787 | |||
| 684 | Ga0157370_10019388 | |||
| 685 | Ga0157369_10024655 | |||
| 686 | Ga0157369_10029594 | |||
| 687 | Ga0157369_10110545 | |||
| 688 | Ga0157374_10099403 | |||
| 689 | Ga0163162_10050053 | |||
| 690 | Ga0163162_10129908 | |||
| 691 | Ga0157375_10214504 | |||
| 692 | Ga0163163_10014926 | |||
| 693 | Ga0157376_10103127 | |||
| 694 | Ga0206356_10569481 | |||
| 695 | Ga0207653_10006974 | |||
| 696 | Ga0207710_10032220 | |||
| 697 | Ga0207688_10000901 | |||
| 698 | Ga0207643_10013338 | |||
| 699 | Ga0207643_10024388 | |||
| 700 | Ga0207643_10035811 | |||
| 701 | Ga0207705_10032551 | |||
| 702 | Ga0207693_10000797 | |||
| 703 | Ga0207693_10026933 | |||
| 704 | Ga0207693_10072793 | |||
| 705 | Ga0207663_10022595 | |||
| 706 | Ga0207663_10027758 | |||
| 707 | Ga0207660_10020386 | |||
| 708 | Ga0207660_10053506 | |||
| 709 | Ga0207657_10000299 | |||
| 710 | Ga0207652_10025421 | |||
| 711 | Ga0207646_10004651 | |||
| 712 | Ga0207646_10099144 | |||
| 713 | Ga0207694_10037299 | |||
| 714 | Ga0207650_10004030 | |||
| 715 | Ga0207687_10004012 | |||
| 716 | Ga0207687_10051028 | |||
| 717 | Ga0207700_10000001 | |||
| 718 | Ga0207700_10005890 | |||
| 719 | Ga0207700_10007847 | |||
| 720 | Ga0207700_10009821 | |||
| 721 | Ga0207664_10010013 | |||
| 722 | Ga0207664_10021677 | |||
| 723 | Ga0207664_10028774 | |||
| 724 | Ga0207706_10010925 | |||
| 725 | Ga0207686_10000004 | |||
| 726 | Ga0207686_10031438 | |||
| 727 | Ga0207709_10000028 | |||
| 728 | Ga0207704_10011912 | |||
| 729 | Ga0207704_10032542 | |||
| 730 | Ga0207665_10001701 | |||
| 731 | Ga0207665_10005324 | |||
| 732 | Ga0207691_10108059 | |||
| 733 | Ga0207661_10005180 | |||
| 734 | Ga0207661_10025701 | |||
| 735 | Ga0207668_10093861 | |||
| 736 | Ga0207658_10014786 | |||
| 737 | Ga0207703_10077018 | |||
| 738 | Ga0207702_10012256 | |||
| 739 | Ga0207702_10036853 | |||
| 740 | Ga0207676_10040336 | |||
| 741 | Ga0207674_10046096 | |||
| 742 | Ga0207674_10083612 | |||
| 743 | Ga0207675_100007997 | |||
| 744 | Ga0207675_100013600 | |||
| 745 | Ga0207683_10001788 | |||
| 746 | Ga0207683_10008439 | |||
| 747 | Ga0207428_10003917 | |||
| 748 | Ga0265318_10010744 | |||
| 749 | Ga0265336_10017647 | |||
| 750 | Ga0265338_10015807 | |||
| 751 | Ga0265338_10016270 | |||
| 752 | Ga0265338_10016377 | |||
| 753 | Ga0265338_10020387 | |||
| 754 | Ga0265338_10047022 | |||
| 755 | Ga0265325_10025132 | |||
| 756 | Ga0265339_10039248 | |||
| 757 | Ga0265316_10033459 | |||
| 758 | Ga0265316_10051288 | |||
| 759 | Ga0265313_10011651 | |||
| 760 | Ga0265314_10013147 | |||
| 761 | Ga0307409_100058648 | |||
| 762 | Ga0307416_100011036 | |||
| 763 | Ga0307411_10055163 | |||
| 764 | Ga0307415_100006503 | |||
| 765 | Ga0373929_0003377 | |||
| 766 | Ga0373944_0006286 | |||
| 767 | Ga0373956_0032062 | |||
| 768 | Ga0373943_0000713 | |||
| 769 | Ga0373943_0006172 | |||
| 770 | Ga0373943_0007113 | |||
| 771 | Ga0373946_0007094 | |||
| 772 | Ga0373935_0047664 | |||
| 773 | Ga0373927_0010890 | |||
| 774 | Ga0373933_0013384 | |||
| 775 | Ga0373947_0006646 | |||
| 776 | Ga0373947_0009996 | |||
| 777 | Ga0373947_0011041 | |||
| 778 | Ga0373947_0016652 | |||
| 779 | Ga0373937_0000921 | |||
| 780 | Ga0373937_0114843 | |||
| 781 | Ga0373925_0001342 | |||
| 782 | Ga0373925_0013743 | |||
| 783 | Ga0395899_0001897 | |||
| 784 | Ga0395899_0005633 | |||
| 785 | Ga0395899_0027349 | |||
| 786 | Ga0395899_0063600 | |||
| 787 | Ga0395900_0002741 | |||
| 788 | Ga0395900_0009667 | |||
| 789 | Ga0395900_0013511 | |||
| 790 | Ga0395900_0025542 | |||
| 791 | Ga0395900_0050434 | |||
| 792 | Ga0395900_0141341 | |||
| 793 | Ga0395898_0017713 | |||
| 794 | Ga0395898_0018356 | |||
| 795 | Ga0395898_0020873 | |||
| 796 | Ga0395898_0031774 | |||
| 797 | Ga0395898_0034764 | |||
| 798 | Ga0395898_0038603 | |||
| 799 | Ga0395898_0048404 | |||
| 800 | Ga0395898_0068747 | |||
| 801 | Ga0395905_0009398 | |||
| 802 | Ga0395905_0040311 | |||
| 803 | Ga0395905_0047279 | |||
| 804 | Ga0395905_0050802 | |||
| 805 | Ga0395905_0095922 | |||
| 806 | Ga0395901_0004504 | |||
| 807 | Ga0395901_0005951 | |||
| 808 | Ga0395901_0010778 | |||
| 809 | Ga0395901_0011152 | |||
| 810 | Ga0395901_0014936 | |||
| 811 | Ga0395901_0021061 | |||
| 812 | Ga0395901_0035884 | |||
| 813 | Ga0395901_0044547 | |||
| 814 | Ga0395901_0050064 | |||
| 815 | Ga0395901_0054686 | |||
| 816 | Ga0395901_0066428 | |||
| 817 | Ga0395901_0103831 | |||
| 818 | Ga0395901_0158415 | |||
| 819 | Ga0451798_0061935 | |||
| 820 | Ga0451800_1305818 | |||
| 821 | Ga0451835_0463010 | |||
| 822 | Ga0451847_0213419 | |||
| 823 | Ga0439448_0001266 | |||
| 824 | Ga0466969_0001557 | |||
| 825 | Ga0466969_0018725 | |||
| 826 | Ga0466966_0004349 | |||
| 827 | Ga0466966_0021473 | |||
| 828 | Ga0466961_0002376 | |||
| 829 | Ga0466961_0003110 | |||
| 830 | Ga0466961_0008403 | |||
| 831 | Ga0466961_0024448 | |||
| 832 | Ga0466961_0046826 | |||
| 833 | Ga0466963_0000295 | |||
| 834 | Ga0466963_0002164 | |||
| 835 | Ga0466963_0003302 | |||
| 836 | Ga0466963_0004570 | |||
| 837 | Ga0466963_0007442 | |||
| 838 | Ga0466963_0007729 | |||
| 839 | Ga0466963_0008549 | |||
| 840 | Ga0466963_0009984 | |||
| 841 | Ga0466963_0010921 | |||
| 842 | Ga0466963_0021854 | |||
| 843 | Ga0466964_0000527 | |||
| 844 | Ga0466964_0007720 | |||
| 845 | Ga0466964_0020912 | |||
| 846 | Ga0466971_0000590 | |||
| 847 | Ga0466971_0001451 | |||
| 848 | Ga0466968_0000752 | |||
| 849 | Ga0466968_0001498 | |||
| 850 | Ga0466968_0002452 | |||
| 851 | Ga0466970_0004375 | |||
| 852 | Ga0466957_0001198 | |||
| 853 | Ga0466957_0002401 | |||
| 854 | Ga0466957_0002405 | |||
| 855 | Ga0466957_0002526 | |||
| 856 | Ga0466957_0003540 | |||
| 857 | Ga0466957_0018267 | |||
| 858 | Ga0466957_0024015 | |||
| 859 | Ga0466957_0024686 | |||
| 860 | Ga0466960_0002014 | |||
| 861 | Ga0466960_0043870 | |||
| 862 | Ga0466959_0000831 | |||
| 863 | Ga0466959_0006977 | |||
| 864 | Ga0466959_0007329 | |||
| 865 | Ga0466959_0037307 | |||
| 866 | Ga0466959_0101787 | |||
| 867 | Ga0451576_0014006 | |||
| 868 | Ga0466958_0000860 | |||
| 869 | Ga0466958_0001026 | |||
| 870 | Ga0466958_0001749 | |||
| 871 | Ga0466958_0004821 | |||
| 872 | Ga0466958_0006894 | |||
| 873 | Ga0466958_0008478 | |||
| 874 | Ga0466958_0009025 | |||
| 875 | Ga0466958_0010145 | |||
| 876 | Ga0466958_0027359 | |||
| 877 | Ga0466967_0000957 | |||
| 878 | Ga0466967_0001277 | |||
| 879 | Ga0466967_0006331 | |||
| 880 | Ga0466967_0006442 | |||
| 881 | Ga0466967_0009473 | |||
| 882 | Ga0466967_0009578 | |||
| 883 | Ga0466967_0021448 | |||
| 884 | Ga0466967_0038022 | |||
| 885 | Ga0466967_0039428 | |||
| 886 | Ga0466967_0058688 | |||
| 887 | Ga0466967_0071494 | |||
| 888 | Ga0466967_0096475 | |||
| 889 | Ga0495592_0000075 | |||
| 890 | Ga0495592_0072584 | |||
| 891 | Ga0495603_0000962 | |||
| 892 | Ga0495603_0076317 | |||
| 893 | Ga0495641_0000472 | |||
| 894 | Ga0495641_0001728 | |||
| 895 | Ga0495641_0003785 | |||
| 896 | Ga0495641_0008818 | |||
| 897 | Ga0495641_0017106 | |||
| 898 | Ga0495651_0000344 | |||
| 899 | Ga0495651_0049119 | |||
| 900 | Ga0495651_0055466 | |||
| 901 | Ga0495651_0060024 | |||
| 902 | Ga0495651_0077263 | |||
| 903 | Ga0495653_0002590 | |||
| 904 | Ga0495653_0003311 | |||
| 905 | Ga0495653_0039932 | |||
| 906 | Ga0495580_0003552 | |||
| 907 | Ga0495582_0000585 | |||
| 908 | Ga0495582_0020642 | |||
| 909 | Ga0495582_0021723 | |||
| 910 | Ga0495639_0003168 | |||
| 911 | Ga0495662_0000314 | |||
| 912 | Ga0495662_0018729 | |||
| 913 | Ga0495664_0012764 | |||
| 914 | Ga0495664_0023109 | |||
| 915 | Ga0495594_0009639 | |||
| 916 | Ga0495607_0014549 | |||
| 917 | Ga0495608_0002205 | |||
| 918 | Ga0495608_0007897 | |||
| 919 | Ga0495618_0007881 | |||
| 920 | Ga0495618_0024324 | |||
| 921 | Ga0495628_0000329 | |||
| 922 | Ga0495628_0026571 | |||
| 923 | Ga0495628_0044891 | |||
| 924 | Ga0495628_0063586 | |||
| 925 | Ga0495630_0013513 | |||
| 926 | Ga0495630_0018166 | |||
| 927 | Ga0495644_0009202 | |||
| 928 | Ga0495666_0000339 | |||
| 929 | Ga0495652_0000111 | |||
| 930 | Ga0495652_0011077 | |||
| 931 | Ga0495652_0067123 | |||
| 932 | Ga0495665_0000420 | |||
| 933 | Ga0495665_0001861 | |||
| 934 | Ga0495640_0033102 | |||
| 935 | Ga0495640_0088963 | |||
| 936 | Ga0495586_0012457 | |||
| 937 | Ga0495587_0000100 | |||
| 938 | Ga0495587_0023561 | |||
| 939 | Ga0495587_0026035 | |||
| 940 | Ga0495645_0000046 | |||
| 941 | Ga0495645_0056861 | |||
| 942 | Ga0495645_0105194 | |||
| 943 | Ga0495667_0021737 | |||
| 944 | Ga0495667_0090976 | |||
| 945 | Ga0495656_0004325 | |||
| 946 | Ga0495634_0019257 | |||
| 947 | Ga0495634_0022604 | |||
| 948 | Ga0495635_0006782 | |||
| 949 | Ga0495635_0031412 | |||
| 950 | Ga0495588_0000666 | |||
| 951 | Ga0495657_0006756 | |||
| 952 | Ga0495599_0000086 | |||
| 953 | Ga0495599_0002616 | |||
| 954 | Ga0495599_0033582 | |||
| 955 | Ga0495599_0054022 | |||
| 956 | Ga0495623_0000037 | |||
| 957 | Ga0495623_0031223 | |||
| 958 | Ga0495646_0016353 | |||
| 959 | Ga0495646_0050084 | |||
| 960 | Ga0495647_0000750 | |||
| 961 | Ga0495658_0001836 | |||
| 962 | Ga0495658_0007173 | |||
| 963 | Ga0495658_0035094 | |||
| 964 | Ga0495613_0019145 | |||
| 965 | Ga0495613_0035320 | |||
| 966 | Ga0495613_0037530 | |||
| 967 | Ga0495613_0063544 | |||
| 968 | Ga0495600_0005625 | |||
| 969 | Ga0495600_0031778 | |||
| 970 | Ga0495581_0000648 | |||
| 971 | Ga0495581_0006575 | |||
| 972 | Ga0495581_0100782 | |||
| 973 | Ga0495604_0000080 | |||
| 974 | Ga0495674_0008195 | |||
| 975 | Ga0495674_0031112 | |||
| 976 | Ga0495674_0067706 | |||
| 977 | Ga0495676_0000548 | |||
| 978 | Ga0495676_0031735 | |||
| 979 | Ga0495676_0033605 | |||
| 980 | Ga0495680_0002321 | |||
| 981 | Ga0495680_0006534 | |||
| 982 | Ga0495680_0006791 | |||
| 983 | Ga0495680_0010943 | |||
| 984 | Ga0495680_0035152 | |||
| 985 | Ga0495675_0000060 | |||
| 986 | Ga0495684_0001384 | |||
| 987 | Ga0495684_0002833 | |||
| 988 | Ga0495684_0010241 | |||
| 989 | Ga0495593_0004952 | |||
| 990 | Ga0495593_0022089 | |||
| 991 | Ga0495602_0000075 | |||
| 992 | Ga0495602_0027938 | |||
| 993 | Ga0495602_0043869 | |||
| 994 | Ga0495602_0085066 | |||
| 995 | Ga0496100_0002541 | |||
| 996 | Ga0496101_0002117 | |||
| 997 | Ga0496101_0021901 | |||
| 998 | Ga0496101_0028624 | |||
| 999 | Ga0496101_0042179 | |||
| 1000 | Ga0496101_0045670 | |||
| 1001 | Ga0496102_0007800 | |||
| 1002 | Ga0496102_0013826 | |||
| 1003 | Ga0496102_0030931 | |||
| 1004 | Ga0496103_0002645 | |||
| 1005 | Ga0496103_0028729 | |||
| 1006 | Ga0496104_0002859 | |||
| 1007 | Ga0496104_0006744 | |||
| 1008 | Ga0496104_0006985 | |||
| 1009 | Ga0496104_0049169 | |||
| 1010 | Ga0496104_0100457 | |||
| 1011 | Ga0496105_0000255 | |||
| 1012 | Ga0496105_0000750 | |||
| 1013 | Ga0496105_0009288 | |||
| 1014 | Ga0496105_0010646 | |||
| 1015 | Ga0496105_0040766 | |||
| 1016 | Ga0496105_0157255 | |||
| 1017 | Ga0496106_0000449 | |||
| 1018 | Ga0496106_0012351 | |||
| 1019 | Ga0496106_0018646 | |||
| 1020 | Ga0496106_0021859 | |||
| 1021 | Ga0496106_0050048 | |||
| 1022 | Ga0496106_0059562 | |||
| 1023 | Ga0496107_0007161 | |||
| 1024 | Ga0496107_0009985 | |||
| 1025 | Ga0496107_0013350 | |||
| 1026 | Ga0496107_0049466 | |||
| 1027 | Ga0496107_0083783 | |||
| 1028 | Ga0496108_0003540 | |||
| 1029 | Ga0496108_0004794 | |||
| 1030 | Ga0496108_0007596 | |||
| 1031 | Ga0496108_0014723 | |||
| 1032 | Ga0496108_0104864 | |||
| 1033 | Ga0496109_0001531 | |||
| 1034 | Ga0496109_0017092 | |||
| 1035 | Ga0496109_0021960 | |||
| 1036 | Ga0496109_0045614 | |||
| 1037 | Ga0496109_0048628 | |||
| 1038 | Ga0496109_0057382 | |||
| 1039 | Ga0496109_0129479 | |||
| 1040 | Ga0496110_0000810 | |||
| 1041 | Ga0496110_0001410 | |||
| 1042 | Ga0496110_0002008 | |||
| 1043 | Ga0496110_0004466 | |||
| 1044 | Ga0496110_0008011 | |||
| 1045 | Ga0496110_0014324 | |||
| 1046 | Ga0496110_0027796 | |||
| 1047 | Ga0496110_0051584 | |||
| 1048 | Ga0496110_0071401 | |||
| 1049 | Ga0496111_0000034 | |||
| 1050 | Ga0496111_0000638 | |||
| 1051 | Ga0496111_0001587 | |||
| 1052 | Ga0496111_0004994 | |||
| 1053 | Ga0496111_0007409 | |||
| 1054 | Ga0496111_0016285 | |||
| 1055 | Ga0496111_0018163 | |||
| 1056 | Ga0496111_0019596 | |||
| 1057 | Ga0496111_0028767 | |||
| 1058 | Ga0496112_0000204 | |||
| 1059 | Ga0496112_0006067 | |||
| 1060 | Ga0496112_0022651 | |||
| 1061 | Ga0496112_0034780 | |||
| 1062 | Ga0496112_0075666 | |||
| 1063 | Ga0496112_0134748 | |||
| 1064 | Ga0496113_0021430 | |||
| 1065 | Ga0496113_0026074 | |||
| 1066 | Ga0496113_0036630 | |||
| 1067 | Ga0496113_0060496 | |||
| 1068 | Ga0496113_0093296 | |||
| 1069 | Ga0496114_0000923 | |||
| 1070 | Ga0496114_0005338 | |||
| 1071 | Ga0496114_0028799 | |||
| 1072 | Ga0496114_0070639 | |||
| 1073 | Ga0496115_0004501 | |||
| 1074 | Ga0496115_0033036 | |||
| 1075 | Ga0501031_0000809 | |||
| 1076 | Ga0501031_0006967 | |||
| 1077 | Ga0501033_0000948 | |||
| 1078 | Ga0501033_0032755 | |||
| 1079 | Ga0501034_0074024 | |||
| 1080 | Ga0501036_0095971 | |||
| 1081 | Ga0501037_0003338 | |||
| 1082 | Ga0501038_0001030 | |||
| 1083 | Ga0501038_0002937 | |||
| 1084 | Ga0501039_0002129 | |||
| 1085 | Ga0501040_0016841 | |||
| 1086 | Ga0501041_0001786 | |||
| 1087 | Ga0501043_0005483 | |||
| 1088 | Ga0501043_0011077 | |||
| 1089 | Ga0501046_0002426 | |||
| 1090 | Ga0501047_0139107 | |||
| 1091 | Ga0501048_0010921 | |||
| 1092 | Ga0501048_0041271 | |||
| 1093 | Ga0501067_0002658 | |||
| 1094 | Ga0501068_0002172 | |||
| 1095 | Ga0501069_0019885 | |||
| 1096 | Ga0501070_0000049 | |||
| 1097 | Ga0501070_0002768 | |||
| 1098 | Ga0501070_0012190 | |||
| 1099 | Ga0501071_0004475 | |||
| 1100 | Ga0501072_0012308 | |||
| 1101 | Ga0501073_0000550 | |||
| 1102 | Ga0501073_0002187 | |||
| 1103 | Ga0501074_0000503 | |||
| 1104 | Ga0501080_0001089 | |||
| 1105 | Ga0501080_0001890 | |||
| 1106 | Ga0501080_0063609 | |||
| 1107 | Ga0501080_0079349 | |||
| 1108 | Ga0501081_0001281 | |||
| 1109 | Ga0501081_0056411 | |||
| 1110 | Ga0501081_0078354 | |||
| 1111 | Ga0501083_0000816 | |||
| 1112 | Ga0501035_0007156 | |||
| 1113 | Ga0501035_0085788 | |||
| 1114 | Ga0501044_0019942 | |||
| 1115 | Ga0501044_0056558 | |||
| 1116 | Ga0501045_0000585 | |||
| 1117 | nmdc:mga05p37_103850_c1 | |||
| 1118 | nmdc:mga05p37_22170_c1 | |||
| 1119 | nmdc:mga05p37_42427_c1 | |||
| 1120 | nmdc:mga05p37_56521_c1 | |||
| 1121 | nmdc:mga06r32_303094_c1 | |||
| 1122 | nmdc:mga06r32_71843_c1 | |||
| 1123 | nmdc:mga08y16_148565_c1 | |||
| 1124 | nmdc:mga08y16_5425_c1 | |||
| 1125 | nmdc:mga08y16_76228_c1 | |||
| 1126 | nmdc:mga0n895_154406_c1 | |||
| 1127 | nmdc:mga0n895_16016_c1 | |||
| 1128 | nmdc:mga0rr50_933_c2 | |||
| 1129 | nmdc:mga08x19_22600_c1 | |||
| 1130 | nmdc:mga08x19_71609_c1 | |||
| 1131 | nmdc:mga0a205_137069_c1 | |||
| 1132 | nmdc:mga0a205_27351_c1 | |||
| 1133 | nmdc:mga0a205_4922_c1 | |||
| 1134 | nmdc:mga0a205_73002_c1 | |||
| 1135 | Ga0495601_0000040 | |||
| 1136 | Ga0495612_0001962 | |||
| 1137 | Ga0495612_0013384 | |||
| 1138 | Ga0495595_0010510 | |||
| 1139 | Ga0495619_0000615 | |||
| 1140 | Ga0495619_0004088 | |||
| 1141 | Ga0495619_0004325 | |||
| 1142 | Ga0495619_0008072 | |||
| 1143 | Ga0495619_0031917 | |||
| 1144 | Ga0495619_0033546 | |||
| 1145 | Ga0495619_0038341 | |||
| 1146 | Ga0500566_0033627 | |||
| 1147 | Ga0501084_0009831 | |||
| 1148 | Ga0501082_0001714 | |||
| 1149 | Ga0501082_0030677 | |||
| 1150 | Ga0466962_0001633 | |||
| 1151 | Ga0466962_0001644 | |||
| 1152 | Ga0466962_0002064 | |||
| 1153 | Ga0466962_0016212 | |||
| 1154 | Ga0530510_0001637 | |||
| 1155 | 2895504101 | |||
| 1156 | 2895515455 | |||
| 1157 | 2895525034 | |||
| 1158 | 2895527743 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5bjw-assembly1.cif.gz_B | x-ray structure of the pglf 4,6-dehydratase from campylobacter jejuni, t595s variant, in complex with udp | 0.9546 | 261 | 609 |
| 5bjy-assembly1.cif.gz_B | x-ray structure of the pglf 4,5-dehydratase from campylobacter jejuni, variant m405y, in complex with udp | 0.9431 | 261 | 606 |
| 5bjx-assembly1.cif.gz_A | x-ray structure of the pglf 4,6-dehydratase from campylobacter jejuni, variant t395v, in complex with udp | 0.9407 | 261 | 606 |
| 5bjv-assembly1.cif.gz_B | x-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n-acrtylglucosamine | 0.9387 | 261 | 606 |
| 5bjw-assembly1.cif.gz_B | x-ray structure of the pglf 4,6-dehydratase from campylobacter jejuni, t595s variant, in complex with udp | 0.9382 | 261 | 609 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1K5_279_602_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9517 | 282 | 606 | 3.40.50.720 |
| 6bwcE01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9408 | 281 | 509 | 3.40.50.720 |
| af_Q2G1K5_279_602_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9402 | 282 | 606 | 3.40.50.720 |
| af_Q2G1K4_2_342_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9147 | 282 | 570 | 3.40.50.720 |
| af_Q58461_9_333_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9104 | 283 | 577 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A7TB45-F1-model_v4 | Polysaccharide biosynthesis protein CapD-like domain-containing protein | 0.9794 | 296 | 609 |
|
| AF-A0A355BJK5-F1-model_v4 | Polysaccharide biosynthesis protein | 0.9789 | 274 | 536 |
|
| AF-A0A1F2SSE4-F1-model_v4 | Polysaccharide biosynthesis protein CapD-like domain-containing protein | 0.9788 | 289 | 430 |
|
| AF-A0A355BJK5-F1-model_v4 | Polysaccharide biosynthesis protein | 0.9752 | 274 | 536 |
|
| AF-A0A373PXN5-F1-model_v4 | Polysaccharide biosynthesis protein | 0.9746 | 274 | 610 |
|