F465839

General Info

Members Datasets Scaffolds Average Seq Length
579 249 1158 631

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100081603|Ga0207675_1000816032
Length 698
Sequence VISLPITRHRFWQLVVDGVLVAAAWYLAFRLRFDPKIPPYYHTMFTRTIWIVLLIQLSVFILFGFYNRWWRYVSTRDMWGAGRGVTVACLVSSVVVYFANPVAGVRLPRSVAIMDWLLLLAFVAGARMLARTLMERPTARGLVARGREVIVVGAGDAAQLIIKELLKSPSLGYTPIGLVDDDPRKKNLRVHNVRVLGTTEELSRILHENRPDEVLIAIPHADTAAVRAVVRTLEPFKVPIKTLPNLREIIDGRVDVAQIRGLAFEDLLVRAPVGLDRGPLKRLIAGRRVMVTGAGGSIGSELCRQIAQLKPAALVMLDRYENTLHAIRVELDAREHVFGVIPVIGDVTDASRVNALLAEHQPEIIFHAAAHKHVPLMEENPCEAVKNNVGGTRVLAQSADAFGVDHFIMISTDKAVNPTSIMGASKRIAELVVQAQAAGSGTTFSIVRFGNVLGSNGSVVPHFMEQIRRGGPVTVTDPEIRRFFMLIPEAVQLVLHAAAQAENGATYVLEMGEQVKLLDMARNLIRLSGFIPDEDIKIVFTGLRPGEKLYEELVGAGEDASASSVEKVLCVRSRASVDPEMLTRVKALLSEALRGRTVAVLAAIKELVGTFQDADGSTAAGPEPLAPXXXXASGVNSHDEQPCPECGTGRAHRSRARSAHEGAAPVEVLQPPDWATLDSDAKLRPVERRQNFSPRNLR

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
95 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
107 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
108 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
123 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
124 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
125 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
126 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
246 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
247 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
248 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
249 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.17
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 14.16
Rhizosphere 85.32
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100081603 3300026118 Bacteria 3032
2 JGI25407J50210_10000296 3300003373 Bacteria 9040
3 Ga0070683_100009621 3300005329 Bacteria 8274
4 Ga0070683_100010636 3300005329 Bacteria 7909
5 Ga0070683_100044242 3300005329 Bacteria 4106
6 Ga0070680_100014560 3300005336 Bacteria 6152
7 Ga0070680_100085339 3300005336 Bacteria 2608
8 Ga0070682_100010759 3300005337 Bacteria 5203
9 Ga0070692_10027603 3300005345 Bacteria 2815
10 Ga0070692_10054506 3300005345 Bacteria 2088
11 Ga0070674_100009597 3300005356 Bacteria 5801
12 Ga0070674_100035285 3300005356 Bacteria 3348
13 Ga0070674_100087382 3300005356 Bacteria 2241
14 Ga0070673_100003722 3300005364 Bacteria 9556
15 Ga0070688_100045641 3300005365 Bacteria 2708
16 Ga0070667_100006289 3300005367 Bacteria 9869
17 Ga0070703_10007165 3300005406 Bacteria 3131
18 Ga0070714_100003825 3300005435 Bacteria 11307
19 Ga0070714_100009995 3300005435 Bacteria 7483
20 Ga0070714_100019611 3300005435 Bacteria 5513
21 Ga0070714_100056431 3300005435 Bacteria 3359
22 Ga0070714_100144371 3300005435 Bacteria 2139
23 Ga0070713_100010133 3300005436 Bacteria 6798
24 Ga0070713_100017556 3300005436 Bacteria 5415
25 Ga0070713_100029792 3300005436 Bacteria 4326
26 Ga0070713_100035926 3300005436 Bacteria 3994
27 Ga0070713_100079900 3300005436 Bacteria 2787
28 Ga0070694_100000416 3300005444 Bacteria 23229
29 Ga0070708_100014798 3300005445 Bacteria 6430
30 Ga0070708_100102497 3300005445 Bacteria 2622
31 Ga0070678_100025008 3300005456 Bacteria 4009
32 Ga0070706_100065063 3300005467 Bacteria 3371
33 Ga0070707_100002701 3300005468 Bacteria 16872
34 Ga0070707_100008868 3300005468 Bacteria 9325
35 Ga0070707_100139049 3300005468 Bacteria 2363
36 Ga0070698_100019860 3300005471 Bacteria 7048
37 Ga0070699_100058465 3300005518 Bacteria 3340
38 Ga0070679_100010400 3300005530 Bacteria 8826
39 Ga0070679_100014711 3300005530 Bacteria 7521
40 Ga0070679_100045991 3300005530 Bacteria 4349
41 Ga0070684_100015765 3300005535 Bacteria 6168
42 Ga0070684_100023556 3300005535 Bacteria 5153
43 Ga0070697_100069212 3300005536 Bacteria 2890
44 Ga0070686_100062960 3300005544 Bacteria 2401
45 Ga0070665_100054615 3300005548 Bacteria 4006
46 Ga0068855_100022559 3300005563 Bacteria 7543
47 Ga0068855_100167402 3300005563 Bacteria 2491
48 Ga0068855_100240847 3300005563 Bacteria 2021
49 Ga0070664_100034803 3300005564 Bacteria 4227
50 Ga0068857_100004546 3300005577 Bacteria 11736
51 Ga0068856_100006776 3300005614 Bacteria 11210
52 Ga0068864_100015164 3300005618 Bacteria 6409
53 Ga0068870_10002990 3300005840 Bacteria 7120
54 Ga0068870_10012320 3300005840 Bacteria 3994
55 Ga0081455_10003628 3300005937 Bacteria 17682
56 Ga0081455_10010008 3300005937 Bacteria 9692
57 Ga0081455_10010129 3300005937 Bacteria 9605
58 Ga0081455_10021363 3300005937 Bacteria 6073
59 Ga0081538_10000055 3300005981 Bacteria 106524
60 Ga0081538_10000181 3300005981 Bacteria 68890
61 Ga0081538_10006367 3300005981 Bacteria 10413
62 Ga0081538_10043478 3300005981 Bacteria 2820
63 Ga0081540_1002875 3300005983 Bacteria 13917
64 Ga0081540_1028792 3300005983 Bacteria 3109
65 Ga0070717_10002526 3300006028 Bacteria 12887
66 Ga0070717_10019040 3300006028 Bacteria 5376
67 Ga0070712_100043874 3300006175 Bacteria 3080
68 Ga0075428_100055161 3300006844 Bacteria 4354
69 Ga0075428_100059347 3300006844 Bacteria 4189
70 Ga0075433_10008591 3300006852 Bacteria 8148
71 Ga0075433_10013027 3300006852 Bacteria 6743
72 Ga0075433_10035084 3300006852 Bacteria 4311
73 Ga0075433_10078043 3300006852 Bacteria 2918
74 Ga0075433_10126158 3300006852 Bacteria 2273
75 Ga0075434_100002112 3300006871 Bacteria 17300
76 Ga0075434_100048603 3300006871 Bacteria 4209
77 Ga0075434_100108830 3300006871 Bacteria 2781
78 Ga0068865_100084618 3300006881 Bacteria 2286
79 Ga0075436_100004922 3300006914 Bacteria 9179
80 Ga0075436_100017849 3300006914 Bacteria 4858
81 Ga0075435_100007173 3300007076 Bacteria 7927
82 Ga0075435_100069122 3300007076 Bacteria 2879
83 Ga0075435_100116080 3300007076 Bacteria 2229
84 Ga0105240_10084629 3300009093 Bacteria 3888
85 Ga0105240_10147933 3300009093 Bacteria 2801
86 Ga0111539_10047122 3300009094 Bacteria 5153
87 Ga0111539_10055644 3300009094 Bacteria 4703
88 Ga0111539_10072803 3300009094 Bacteria 4052
89 Ga0105245_10004292 3300009098 Bacteria 12636
90 Ga0105245_10040830 3300009098 Bacteria 4135
91 Ga0105245_10071367 3300009098 Bacteria 3154
92 Ga0105247_10009428 3300009101 Bacteria 5926
93 Ga0114129_10021204 3300009147 Bacteria 9229
94 Ga0114129_10035154 3300009147 Bacteria 7080
95 Ga0114129_10189480 3300009147 Bacteria 2794
96 Ga0105243_10000083 3300009148 Bacteria 107982
97 Ga0105241_10073862 3300009174 Bacteria 2654
98 Ga0105242_10000027 3300009176 Bacteria 106530
99 Ga0105242_10053783 3300009176 Bacteria 3289
100 Ga0105248_10170393 3300009177 Bacteria 2454
101 Ga0105249_10011417 3300009553 Bacteria 7802
102 Ga0105249_10087980 3300009553 Bacteria 2900
103 Ga0105239_10098829 3300010375 Bacteria 3226
104 Ga0105246_10003787 3300011119 Bacteria 9165
105 Ga0157370_10019388 3300013104 Bacteria 6824
106 Ga0157369_10024655 3300013105 Bacteria 6687
107 Ga0157369_10029594 3300013105 Bacteria 6050
108 Ga0157369_10110545 3300013105 Bacteria 2922
109 Ga0157374_10099403 3300013296 Bacteria 2787
110 Ga0163162_10050053 3300013306 Bacteria 4190
111 Ga0163162_10129908 3300013306 Bacteria 2627
112 Ga0157375_10214504 3300013308 Bacteria 2082
113 Ga0163163_10014926 3300014325 Bacteria 7157
114 Ga0157376_10103127 3300014969 Bacteria 2497
115 Ga0206356_10569481 3300020070 Bacteria 4588
116 Ga0207653_10006974 3300025885 Bacteria 3524
117 Ga0207710_10032220 3300025900 Bacteria 2295
118 Ga0207688_10000901 3300025901 Bacteria 14998
119 Ga0207643_10013338 3300025908 Bacteria 4448
120 Ga0207643_10024388 3300025908 Bacteria 3338
121 Ga0207643_10035811 3300025908 Bacteria 2784
122 Ga0207705_10032551 3300025909 Bacteria 3726
123 Ga0207693_10000797 3300025915 Bacteria 28134
124 Ga0207693_10026933 3300025915 Bacteria 4547
125 Ga0207693_10072793 3300025915 Bacteria 2690
126 Ga0207663_10022595 3300025916 Bacteria 3598
127 Ga0207663_10027758 3300025916 Bacteria 3304
128 Ga0207660_10020386 3300025917 Bacteria 4447
129 Ga0207660_10053506 3300025917 Bacteria 2878
130 Ga0207657_10000299 3300025919 Bacteria 52815
131 Ga0207652_10025421 3300025921 Bacteria 4923
132 Ga0207646_10004651 3300025922 Bacteria 14812
133 Ga0207646_10099144 3300025922 Bacteria 2611
134 Ga0207694_10037299 3300025924 Bacteria 3733
135 Ga0207650_10004030 3300025925 Bacteria 10046
136 Ga0207687_10004012 3300025927 Bacteria 9864
137 Ga0207687_10051028 3300025927 Bacteria 2882
138 Ga0207700_10000001 3300025928 Bacteria 1122509
139 Ga0207700_10005890 3300025928 Bacteria 7370
140 Ga0207700_10007847 3300025928 Bacteria 6563
141 Ga0207700_10009821 3300025928 Bacteria 6001
142 Ga0207664_10010013 3300025929 Bacteria 6681
143 Ga0207664_10021677 3300025929 Bacteria 4784
144 Ga0207664_10028774 3300025929 Bacteria 4226
145 Ga0207706_10010925 3300025933 Bacteria 8280
146 Ga0207686_10000004 3300025934 Bacteria 349251
147 Ga0207686_10031438 3300025934 Bacteria 3152
148 Ga0207709_10000028 3300025935 Bacteria 334429
149 Ga0207704_10011912 3300025938 Bacteria 4301
150 Ga0207704_10032542 3300025938 Bacteria 2952
151 Ga0207665_10001701 3300025939 Bacteria 14795
152 Ga0207665_10005324 3300025939 Bacteria 8599
153 Ga0207691_10108059 3300025940 Bacteria 2476
154 Ga0207661_10005180 3300025944 Bacteria 9163
155 Ga0207661_10025701 3300025944 Bacteria 4479
156 Ga0207668_10093861 3300025972 Bacteria 2212
157 Ga0207658_10014786 3300025986 Bacteria 5348
158 Ga0207703_10077018 3300026035 Unclassified 2768
159 Ga0207702_10012256 3300026078 Bacteria 7135
160 Ga0207702_10036853 3300026078 Bacteria 4091
161 Ga0207676_10040336 3300026095 Bacteria 3578
162 Ga0207674_10046096 3300026116 Bacteria 4478
163 Ga0207674_10083612 3300026116 Bacteria 3191
164 Ga0207675_100007997 3300026118 Bacteria 9964
165 Ga0207675_100013600 3300026118 Bacteria 7597
166 Ga0207683_10001788 3300026121 Bacteria 19030
167 Ga0207683_10008439 3300026121 Bacteria 8817
168 Ga0207428_10003917 3300027907 Bacteria 14275
169 Ga0265318_10010744 3300028577 Bacteria 3975
170 Ga0265336_10017647 3300028666 Bacteria 2322
171 Ga0265338_10015807 3300028800 Bacteria 8263
172 Ga0265338_10016270 3300028800 Bacteria 8104
173 Ga0265338_10016377 3300028800 Bacteria 8073
174 Ga0265338_10020387 3300028800 Bacteria 6975
175 Ga0265338_10047022 3300028800 Bacteria 3946
176 Ga0265325_10025132 3300031241 Bacteria 3235
177 Ga0265339_10039248 3300031249 Bacteria 2637
178 Ga0265316_10033459 3300031344 Bacteria 4186
179 Ga0265316_10051288 3300031344 Bacteria 3241
180 Ga0265313_10011651 3300031595 Bacteria 5448
181 Ga0265314_10013147 3300031711 Bacteria 6706
182 Ga0307409_100058648 3300031995 Bacteria 2991
183 Ga0307416_100011036 3300032002 Bacteria 6002
184 Ga0307411_10055163 3300032005 Bacteria 2613
185 Ga0307415_100006503 3300032126 Bacteria 6313
186 Ga0373929_0003377 3300035085 Bacteria 2882
187 Ga0373944_0006286 3300035089 Bacteria 3149
188 Ga0373956_0032062 3300035119 Bacteria 2305
189 Ga0373943_0000713 3300035170 Bacteria 14523
190 Ga0373943_0006172 3300035170 Bacteria 5379
191 Ga0373943_0007113 3300035170 Bacteria 5021
192 Ga0373946_0007094 3300035171 Bacteria 4090
193 Ga0373935_0047664 3300035692 Bacteria 2710
194 Ga0373927_0010890 3300035695 Bacteria 6057
195 Ga0373933_0013384 3300035724 Bacteria 4546
196 Ga0373947_0006646 3300035725 Bacteria 6711
197 Ga0373947_0009996 3300035725 Bacteria 5447
198 Ga0373947_0011041 3300035725 Bacteria 5184
199 Ga0373947_0016652 3300035725 Bacteria 4223
200 Ga0373937_0000921 3300036401 Bacteria 24951
201 Ga0373937_0114843 3300036401 Bacteria 2506
202 Ga0373925_0001342 3300037068 Bacteria 21503
203 Ga0373925_0013743 3300037068 Bacteria 5859
204 Ga0395899_0001897 3300037312 Bacteria 17264
205 Ga0395899_0005633 3300037312 Bacteria 9721
206 Ga0395899_0027349 3300037312 Bacteria 4301
207 Ga0395899_0063600 3300037312 Bacteria 2714
208 Ga0395900_0002741 3300037418 Bacteria 19239
209 Ga0395900_0009667 3300037418 Bacteria 9887
210 Ga0395900_0013511 3300037418 Bacteria 8343
211 Ga0395900_0025542 3300037418 Bacteria 6047
212 Ga0395900_0050434 3300037418 Bacteria 4287
213 Ga0395900_0141341 3300037418 Bacteria 2465
214 Ga0395898_0017713 3300037466 Bacteria 7270
215 Ga0395898_0018356 3300037466 Bacteria 7133
216 Ga0395898_0020873 3300037466 Bacteria 6647
217 Ga0395898_0031774 3300037466 Bacteria 5272
218 Ga0395898_0034764 3300037466 Bacteria 5017
219 Ga0395898_0038603 3300037466 Bacteria 4731
220 Ga0395898_0048404 3300037466 Bacteria 4169
221 Ga0395898_0068747 3300037466 Bacteria 3427
222 Ga0395905_0009398 3300037471 Bacteria 9559
223 Ga0395905_0040311 3300037471 Bacteria 4381
224 Ga0395905_0047279 3300037471 Bacteria 4033
225 Ga0395905_0050802 3300037471 Bacteria 3884
226 Ga0395905_0095922 3300037471 Bacteria 2784
227 Ga0395901_0004504 3300038443 Bacteria 14052
228 Ga0395901_0005951 3300038443 Bacteria 12351
229 Ga0395901_0010778 3300038443 Bacteria 9267
230 Ga0395901_0011152 3300038443 Bacteria 9106
231 Ga0395901_0014936 3300038443 Bacteria 7890
232 Ga0395901_0021061 3300038443 Bacteria 6679
233 Ga0395901_0035884 3300038443 Bacteria 5123
234 Ga0395901_0044547 3300038443 Bacteria 4602
235 Ga0395901_0050064 3300038443 Bacteria 4341
236 Ga0395901_0054686 3300038443 Bacteria 4149
237 Ga0395901_0066428 3300038443 Bacteria 3756
238 Ga0395901_0103831 3300038443 Bacteria 2982
239 Ga0395901_0158415 3300038443 Bacteria 2378
240 Ga0451798_0061935 3300041458 Bacteria 2518
241 Ga0451800_1305818 3300041459 Bacteria 4398
242 Ga0451835_0463010 3300041492 Bacteria 3407
243 Ga0451847_0213419 3300041503 Bacteria 2407
244 Ga0439448_0001266 3300042005 Bacteria 6463
245 Ga0466969_0001557 3300044656 Bacteria 12315
246 Ga0466969_0018725 3300044656 Bacteria 3605
247 Ga0466966_0004349 3300044684 Bacteria 9342
248 Ga0466966_0021473 3300044684 Bacteria 4239
249 Ga0466961_0002376 3300044693 Bacteria 11691
250 Ga0466961_0003110 3300044693 Bacteria 10334
251 Ga0466961_0008403 3300044693 Bacteria 6575
252 Ga0466961_0024448 3300044693 Bacteria 3886
253 Ga0466961_0046826 3300044693 Bacteria 2765
254 Ga0466963_0000295 3300044694 Bacteria 22402
255 Ga0466963_0002164 3300044694 Bacteria 10857
256 Ga0466963_0003302 3300044694 Bacteria 9201
257 Ga0466963_0004570 3300044694 Bacteria 8055
258 Ga0466963_0007442 3300044694 Bacteria 6527
259 Ga0466963_0007729 3300044694 Bacteria 6424
260 Ga0466963_0008549 3300044694 Bacteria 6143
261 Ga0466963_0009984 3300044694 Bacteria 5737
262 Ga0466963_0010921 3300044694 Bacteria 5516
263 Ga0466963_0021854 3300044694 Bacteria 4043
264 Ga0466964_0000527 3300044706 Bacteria 11975
265 Ga0466964_0007720 3300044706 Bacteria 4027
266 Ga0466964_0020912 3300044706 Bacteria 2525
267 Ga0466971_0000590 3300044719 Bacteria 14368
268 Ga0466971_0001451 3300044719 Bacteria 9982
269 Ga0466968_0000752 3300044735 Bacteria 11232
270 Ga0466968_0001498 3300044735 Bacteria 8360
271 Ga0466968_0002452 3300044735 Bacteria 6804
272 Ga0466970_0004375 3300044765 Bacteria 6959
273 Ga0466957_0001198 3300044842 Bacteria 13515
274 Ga0466957_0002401 3300044842 Bacteria 10055
275 Ga0466957_0002405 3300044842 Bacteria 10047
276 Ga0466957_0002526 3300044842 Bacteria 9843
277 Ga0466957_0003540 3300044842 Bacteria 8598
278 Ga0466957_0018267 3300044842 Bacteria 4117
279 Ga0466957_0024015 3300044842 Bacteria 3608
280 Ga0466957_0024686 3300044842 Bacteria 3559
281 Ga0466960_0002014 3300044901 Bacteria 7537
282 Ga0466960_0043870 3300044901 Bacteria 2130
283 Ga0466959_0000831 3300045049 Bacteria 18229
284 Ga0466959_0006977 3300045049 Bacteria 7893
285 Ga0466959_0007329 3300045049 Bacteria 7731
286 Ga0466959_0037307 3300045049 Bacteria 3590
287 Ga0466959_0101787 3300045049 Bacteria 2056
288 Ga0451576_0014006 3300045051 Bacteria 8941
289 Ga0466958_0000860 3300045836 Bacteria 13532
290 Ga0466958_0001026 3300045836 Bacteria 12733
291 Ga0466958_0001749 3300045836 Bacteria 10513
292 Ga0466958_0004821 3300045836 Bacteria 7179
293 Ga0466958_0006894 3300045836 Bacteria 6212
294 Ga0466958_0008478 3300045836 Bacteria 5706
295 Ga0466958_0009025 3300045836 Bacteria 5536
296 Ga0466958_0010145 3300045836 Bacteria 5265
297 Ga0466958_0027359 3300045836 Bacteria 3375
298 Ga0466967_0000957 3300045976 Bacteria 15637
299 Ga0466967_0001277 3300045976 Bacteria 14306
300 Ga0466967_0006331 3300045976 Bacteria 8358
301 Ga0466967_0006442 3300045976 Bacteria 8305
302 Ga0466967_0009473 3300045976 Bacteria 7228
303 Ga0466967_0009578 3300045976 Bacteria 7200
304 Ga0466967_0021448 3300045976 Bacteria 5247
305 Ga0466967_0038022 3300045976 Bacteria 4124
306 Ga0466967_0039428 3300045976 Bacteria 4061
307 Ga0466967_0058688 3300045976 Bacteria 3402
308 Ga0466967_0071494 3300045976 Bacteria 3107
309 Ga0466967_0096475 3300045976 Bacteria 2697
310 Ga0495592_0000075 3300046454 Bacteria 88214
311 Ga0495592_0072584 3300046454 Bacteria 2504
312 Ga0495603_0000962 3300046455 Bacteria 16598
313 Ga0495603_0076317 3300046455 Bacteria 1967
314 Ga0495641_0000472 3300046461 Bacteria 33428
315 Ga0495641_0001728 3300046461 Bacteria 18228
316 Ga0495641_0003785 3300046461 Bacteria 11088
317 Ga0495641_0008818 3300046461 Bacteria 6080
318 Ga0495641_0017106 3300046461 Bacteria 3791
319 Ga0495651_0000344 3300046462 Bacteria 35980
320 Ga0495651_0049119 3300046462 Bacteria 3257
321 Ga0495651_0055466 3300046462 Bacteria 3044
322 Ga0495651_0060024 3300046462 Bacteria 2914
323 Ga0495651_0077263 3300046462 Bacteria 2520
324 Ga0495653_0002590 3300046463 Bacteria 14395
325 Ga0495653_0003311 3300046463 Bacteria 12933
326 Ga0495653_0039932 3300046463 Bacteria 3672
327 Ga0495580_0003552 3300046472 Bacteria 13244
328 Ga0495582_0000585 3300046473 Bacteria 20182
329 Ga0495582_0020642 3300046473 Bacteria 3606
330 Ga0495582_0021723 3300046473 Bacteria 3512
331 Ga0495639_0003168 3300046475 Bacteria 7148
332 Ga0495662_0000314 3300046476 Bacteria 21029
333 Ga0495662_0018729 3300046476 Bacteria 3352
334 Ga0495664_0012764 3300046477 Bacteria 4759
335 Ga0495664_0023109 3300046477 Bacteria 3606
336 Ga0495594_0009639 3300046499 Bacteria 4992
337 Ga0495607_0014549 3300046501 Bacteria 5116
338 Ga0495608_0002205 3300046511 Bacteria 14066
339 Ga0495608_0007897 3300046511 Bacteria 7477
340 Ga0495618_0007881 3300046514 Bacteria 6446
341 Ga0495618_0024324 3300046514 Bacteria 3750
342 Ga0495628_0000329 3300046516 Bacteria 42884
343 Ga0495628_0026571 3300046516 Bacteria 4717
344 Ga0495628_0044891 3300046516 Bacteria 3514
345 Ga0495628_0063586 3300046516 Bacteria 2891
346 Ga0495630_0013513 3300046517 Bacteria 5938
347 Ga0495630_0018166 3300046517 Bacteria 5164
348 Ga0495644_0009202 3300046523 Bacteria 3806
349 Ga0495666_0000339 3300046526 Bacteria 20415
350 Ga0495652_0000111 3300046529 Bacteria 87928
351 Ga0495652_0011077 3300046529 Bacteria 8169
352 Ga0495652_0067123 3300046529 Bacteria 3008
353 Ga0495665_0000420 3300046531 Bacteria 21621
354 Ga0495665_0001861 3300046531 Bacteria 11392
355 Ga0495640_0033102 3300046533 Bacteria 3675
356 Ga0495640_0088963 3300046533 Bacteria 2040
357 Ga0495586_0012457 3300046535 Bacteria 4510
358 Ga0495587_0000100 3300046536 Bacteria 67315
359 Ga0495587_0023561 3300046536 Bacteria 3783
360 Ga0495587_0026035 3300046536 Bacteria 3569
361 Ga0495645_0000046 3300046543 Bacteria 89390
362 Ga0495645_0056861 3300046543 Bacteria 2840
363 Ga0495645_0105194 3300046543 Bacteria 2003
364 Ga0495667_0021737 3300046559 Bacteria 4329
365 Ga0495667_0090976 3300046559 Bacteria 1977
366 Ga0495656_0004325 3300046615 Bacteria 4856
367 Ga0495634_0019257 3300046642 Bacteria 4849
368 Ga0495634_0022604 3300046642 Bacteria 4430
369 Ga0495635_0006782 3300046663 Bacteria 8002
370 Ga0495635_0031412 3300046663 Bacteria 3687
371 Ga0495588_0000666 3300046674 Bacteria 15878
372 Ga0495657_0006756 3300046675 Bacteria 8943
373 Ga0495599_0000086 3300046678 Bacteria 64425
374 Ga0495599_0002616 3300046678 Bacteria 10493
375 Ga0495599_0033582 3300046678 Bacteria 3224
376 Ga0495599_0054022 3300046678 Bacteria 2516
377 Ga0495623_0000037 3300046679 Bacteria 80938
378 Ga0495623_0031223 3300046679 Bacteria 3425
379 Ga0495646_0016353 3300046680 Bacteria 4707
380 Ga0495646_0050084 3300046680 Bacteria 2533
381 Ga0495647_0000750 3300046681 Bacteria 9638
382 Ga0495658_0001836 3300046683 Bacteria 10871
383 Ga0495658_0007173 3300046683 Bacteria 5505
384 Ga0495658_0035094 3300046683 Bacteria 2757
385 Ga0495613_0019145 3300046689 Bacteria 5102
386 Ga0495613_0035320 3300046689 Bacteria 3710
387 Ga0495613_0037530 3300046689 Bacteria 3592
388 Ga0495613_0063544 3300046689 Bacteria 2701
389 Ga0495600_0005625 3300046809 Bacteria 7569
390 Ga0495600_0031778 3300046809 Bacteria 3422
391 Ga0495581_0000648 3300047315 Bacteria 18222
392 Ga0495581_0006575 3300047315 Bacteria 6733
393 Ga0495581_0100782 3300047315 Bacteria 1678
394 Ga0495604_0000080 3300047317 Bacteria 83113
395 Ga0495674_0008195 3300047319 Bacteria 9971
396 Ga0495674_0031112 3300047319 Bacteria 4849
397 Ga0495674_0067706 3300047319 Bacteria 3092
398 Ga0495676_0000548 3300047321 Bacteria 30843
399 Ga0495676_0031735 3300047321 Bacteria 4464
400 Ga0495676_0033605 3300047321 Bacteria 4316
401 Ga0495680_0002321 3300047322 Bacteria 19510
402 Ga0495680_0006534 3300047322 Bacteria 10824
403 Ga0495680_0006791 3300047322 Bacteria 10571
404 Ga0495680_0010943 3300047322 Bacteria 8061
405 Ga0495680_0035152 3300047322 Bacteria 4038
406 Ga0495675_0000060 3300047444 Bacteria 76099
407 Ga0495684_0001384 3300047471 Bacteria 19473
408 Ga0495684_0002833 3300047471 Bacteria 13668
409 Ga0495684_0010241 3300047471 Bacteria 7251
410 Ga0495593_0004952 3300047673 Bacteria 7891
411 Ga0495593_0022089 3300047673 Bacteria 3550
412 Ga0495602_0000075 3300048088 Bacteria 95851
413 Ga0495602_0027938 3300048088 Bacteria 5411
414 Ga0495602_0043869 3300048088 Bacteria 4060
415 Ga0495602_0085066 3300048088 Bacteria 2644
416 Ga0496100_0002541 3300048903 Bacteria 9300
417 Ga0496101_0002117 3300048904 Bacteria 12102
418 Ga0496101_0021901 3300048904 Bacteria 4392
419 Ga0496101_0028624 3300048904 Bacteria 3891
420 Ga0496101_0042179 3300048904 Bacteria 3257
421 Ga0496101_0045670 3300048904 Bacteria 3138
422 Ga0496102_0007800 3300048905 Bacteria 9150
423 Ga0496102_0013826 3300048905 Bacteria 7005
424 Ga0496102_0030931 3300048905 Bacteria 4795
425 Ga0496103_0002645 3300048906 Bacteria 11207
426 Ga0496103_0028729 3300048906 Bacteria 3377
427 Ga0496104_0002859 3300048907 Bacteria 14876
428 Ga0496104_0006744 3300048907 Bacteria 10112
429 Ga0496104_0006985 3300048907 Bacteria 9955
430 Ga0496104_0049169 3300048907 Bacteria 3976
431 Ga0496104_0100457 3300048907 Bacteria 2769
432 Ga0496105_0000255 3300048908 Bacteria 35883
433 Ga0496105_0000750 3300048908 Bacteria 22004
434 Ga0496105_0009288 3300048908 Bacteria 7686
435 Ga0496105_0010646 3300048908 Bacteria 7236
436 Ga0496105_0040766 3300048908 Bacteria 3829
437 Ga0496105_0157255 3300048908 Bacteria 1866
438 Ga0496106_0000449 3300048909 Bacteria 29371
439 Ga0496106_0012351 3300048909 Bacteria 6304
440 Ga0496106_0018646 3300048909 Bacteria 5135
441 Ga0496106_0021859 3300048909 Bacteria 4752
442 Ga0496106_0050048 3300048909 Bacteria 3148
443 Ga0496106_0059562 3300048909 Bacteria 2892
444 Ga0496107_0007161 3300048910 Bacteria 7686
445 Ga0496107_0009985 3300048910 Bacteria 6584
446 Ga0496107_0013350 3300048910 Bacteria 5739
447 Ga0496107_0049466 3300048910 Bacteria 3029
448 Ga0496107_0083783 3300048910 Bacteria 2325
449 Ga0496108_0003540 3300048911 Bacteria 12521
450 Ga0496108_0004794 3300048911 Bacteria 10910
451 Ga0496108_0007596 3300048911 Bacteria 8780
452 Ga0496108_0014723 3300048911 Bacteria 6383
453 Ga0496108_0104864 3300048911 Bacteria 2413
454 Ga0496109_0001531 3300048912 Bacteria 19233
455 Ga0496109_0017092 3300048912 Bacteria 6348
456 Ga0496109_0021960 3300048912 Bacteria 5650
457 Ga0496109_0045614 3300048912 Bacteria 3978
458 Ga0496109_0048628 3300048912 Bacteria 3858
459 Ga0496109_0057382 3300048912 Bacteria 3554
460 Ga0496109_0129479 3300048912 Bacteria 2355
461 Ga0496110_0000810 3300048913 Bacteria 21899
462 Ga0496110_0001410 3300048913 Bacteria 17372
463 Ga0496110_0002008 3300048913 Bacteria 15145
464 Ga0496110_0004466 3300048913 Bacteria 10844
465 Ga0496110_0008011 3300048913 Bacteria 8468
466 Ga0496110_0014324 3300048913 Bacteria 6580
467 Ga0496110_0027796 3300048913 Bacteria 4851
468 Ga0496110_0051584 3300048913 Bacteria 3615
469 Ga0496110_0071401 3300048913 Bacteria 3078
470 Ga0496111_0000034 3300048914 Bacteria 54519
471 Ga0496111_0000638 3300048914 Bacteria 18456
472 Ga0496111_0001587 3300048914 Bacteria 13129
473 Ga0496111_0004994 3300048914 Bacteria 8439
474 Ga0496111_0007409 3300048914 Bacteria 7189
475 Ga0496111_0016285 3300048914 Bacteria 5119
476 Ga0496111_0018163 3300048914 Bacteria 4869
477 Ga0496111_0019596 3300048914 Bacteria 4703
478 Ga0496111_0028767 3300048914 Bacteria 3940
479 Ga0496112_0000204 3300048915 Bacteria 38947
480 Ga0496112_0006067 3300048915 Bacteria 10558
481 Ga0496112_0022651 3300048915 Bacteria 5990
482 Ga0496112_0034780 3300048915 Bacteria 4903
483 Ga0496112_0075666 3300048915 Bacteria 3329
484 Ga0496112_0134748 3300048915 Bacteria 2440
485 Ga0496113_0021430 3300048916 Bacteria 4559
486 Ga0496113_0026074 3300048916 Bacteria 4175
487 Ga0496113_0036630 3300048916 Bacteria 3595
488 Ga0496113_0060496 3300048916 Bacteria 2855
489 Ga0496113_0093296 3300048916 Bacteria 2323
490 Ga0496114_0000923 3300048917 Bacteria 21968
491 Ga0496114_0005338 3300048917 Bacteria 10043
492 Ga0496114_0028799 3300048917 Bacteria 4561
493 Ga0496114_0070639 3300048917 Bacteria 2933
494 Ga0496115_0004501 3300048918 Bacteria 10083
495 Ga0496115_0033036 3300048918 Bacteria 4084
496 Ga0501031_0000809 3300049568 Bacteria 18820
497 Ga0501031_0006967 3300049568 Bacteria 7382
498 Ga0501033_0000948 3300049570 Bacteria 26325
499 Ga0501033_0032755 3300049570 Bacteria 3903
500 Ga0501034_0074024 3300049571 Bacteria 3415
501 Ga0501036_0095971 3300049572 Bacteria 2506
502 Ga0501037_0003338 3300049573 Bacteria 11660
503 Ga0501038_0001030 3300049574 Bacteria 25161
504 Ga0501038_0002937 3300049574 Bacteria 15901
505 Ga0501039_0002129 3300049575 Bacteria 14657
506 Ga0501040_0016841 3300049576 Bacteria 4846
507 Ga0501041_0001786 3300049577 Bacteria 12044
508 Ga0501043_0005483 3300049579 Bacteria 10249
509 Ga0501043_0011077 3300049579 Bacteria 7064
510 Ga0501046_0002426 3300049580 Bacteria 17479
511 Ga0501047_0139107 3300049581 Bacteria 2307
512 Ga0501048_0010921 3300049582 Bacteria 6774
513 Ga0501048_0041271 3300049582 Bacteria 3306
514 Ga0501067_0002658 3300049583 Bacteria 9895
515 Ga0501068_0002172 3300049584 Bacteria 10452
516 Ga0501069_0019885 3300049585 Bacteria 3633
517 Ga0501070_0000049 3300049586 Bacteria 104564
518 Ga0501070_0002768 3300049586 Bacteria 15306
519 Ga0501070_0012190 3300049586 Bacteria 7254
520 Ga0501071_0004475 3300049587 Bacteria 8872
521 Ga0501072_0012308 3300049588 Bacteria 6538
522 Ga0501073_0000550 3300049589 Bacteria 26515
523 Ga0501073_0002187 3300049589 Bacteria 14621
524 Ga0501074_0000503 3300049590 Bacteria 24003
525 Ga0501080_0001089 3300049742 Bacteria 22370
526 Ga0501080_0001890 3300049742 Bacteria 18030
527 Ga0501080_0063609 3300049742 Bacteria 3434
528 Ga0501080_0079349 3300049742 Bacteria 3052
529 Ga0501081_0001281 3300049743 Bacteria 15290
530 Ga0501081_0056411 3300049743 Bacteria 2715
531 Ga0501081_0078354 3300049743 Bacteria 2310
532 Ga0501083_0000816 3300049744 Bacteria 20385
533 Ga0501035_0007156 3300049822 Bacteria 10438
534 Ga0501035_0085788 3300049822 Bacteria 2775
535 Ga0501044_0019942 3300049823 Bacteria 7162
536 Ga0501044_0056558 3300049823 Bacteria 4028
537 Ga0501045_0000585 3300049824 Bacteria 22890
538 nmdc:mga05p37_103850_c1 3300050507 Bacteria 3497
539 nmdc:mga05p37_22170_c1 3300050507 Bacteria 7699
540 nmdc:mga05p37_42427_c1 3300050507 Bacteria 5589
541 nmdc:mga05p37_56521_c1 3300050507 Bacteria 4832
542 nmdc:mga06r32_303094_c1 3300050510 Bacteria 1584
543 nmdc:mga06r32_71843_c1 3300050510 Bacteria 3349
544 nmdc:mga08y16_148565_c1 3300050511 Bacteria 2436
545 nmdc:mga08y16_5425_c1 3300050511 Bacteria 13335
546 nmdc:mga08y16_76228_c1 3300050511 Bacteria 3495
547 nmdc:mga0n895_154406_c1 3300050512 Bacteria 2326
548 nmdc:mga0n895_16016_c1 3300050512 Bacteria 6866
549 nmdc:mga0rr50_933_c2 3300050513 Bacteria 13017
550 nmdc:mga08x19_22600_c1 3300050514 Bacteria 3896
551 nmdc:mga08x19_71609_c1 3300050514 Bacteria 2260
552 nmdc:mga0a205_137069_c1 3300050515 Bacteria 2348
553 nmdc:mga0a205_27351_c1 3300050515 Bacteria 5448
554 nmdc:mga0a205_4922_c1 3300050515 Bacteria 12016
555 nmdc:mga0a205_73002_c1 3300050515 Bacteria 3315
556 Ga0495601_0000040 3300053077 Bacteria 79488
557 Ga0495612_0001962 3300053078 Bacteria 8474
558 Ga0495612_0013384 3300053078 Bacteria 3305
559 Ga0495595_0010510 3300053084 Bacteria 3848
560 Ga0495619_0000615 3300053085 Bacteria 23532
561 Ga0495619_0004088 3300053085 Bacteria 9341
562 Ga0495619_0004325 3300053085 Bacteria 9061
563 Ga0495619_0008072 3300053085 Bacteria 6662
564 Ga0495619_0031917 3300053085 Bacteria 3415
565 Ga0495619_0033546 3300053085 Bacteria 3334
566 Ga0495619_0038341 3300053085 Bacteria 3126
567 Ga0500566_0033627 3300053094 Bacteria 2986
568 Ga0501084_0009831 3300054114 Bacteria 7902
569 Ga0501082_0001714 3300060353 Bacteria 19338
570 Ga0501082_0030677 3300060353 Bacteria 4634
571 Ga0466962_0001633 3300061719 Bacteria 10512
572 Ga0466962_0001644 3300061719 Bacteria 10476
573 Ga0466962_0002064 3300061719 Bacteria 9501
574 Ga0466962_0016212 3300061719 Bacteria 3594
575 Ga0530510_0001637 3300061734 Bacteria 15131
576 2895504101 2895498888 Bacteria 5283788
577 2895515455 2895511927 Bacteria 6802080
578 2895525034 2895522137 Bacteria 3284416
579 2895527743 2895525241 Bacteria 3388457
580 Ga0207675_100081603
581 JGI25407J50210_10000296
582 Ga0070683_100009621
583 Ga0070683_100010636
584 Ga0070683_100044242
585 Ga0070680_100014560
586 Ga0070680_100085339
587 Ga0070682_100010759
588 Ga0070692_10027603
589 Ga0070692_10054506
590 Ga0070674_100009597
591 Ga0070674_100035285
592 Ga0070674_100087382
593 Ga0070673_100003722
594 Ga0070688_100045641
595 Ga0070667_100006289
596 Ga0070703_10007165
597 Ga0070714_100003825
598 Ga0070714_100009995
599 Ga0070714_100019611
600 Ga0070714_100056431
601 Ga0070714_100144371
602 Ga0070713_100010133
603 Ga0070713_100017556
604 Ga0070713_100029792
605 Ga0070713_100035926
606 Ga0070713_100079900
607 Ga0070694_100000416
608 Ga0070708_100014798
609 Ga0070708_100102497
610 Ga0070678_100025008
611 Ga0070706_100065063
612 Ga0070707_100002701
613 Ga0070707_100008868
614 Ga0070707_100139049
615 Ga0070698_100019860
616 Ga0070699_100058465
617 Ga0070679_100010400
618 Ga0070679_100014711
619 Ga0070679_100045991
620 Ga0070684_100015765
621 Ga0070684_100023556
622 Ga0070697_100069212
623 Ga0070686_100062960
624 Ga0070665_100054615
625 Ga0068855_100022559
626 Ga0068855_100167402
627 Ga0068855_100240847
628 Ga0070664_100034803
629 Ga0068857_100004546
630 Ga0068856_100006776
631 Ga0068864_100015164
632 Ga0068870_10002990
633 Ga0068870_10012320
634 Ga0081455_10003628
635 Ga0081455_10010008
636 Ga0081455_10010129
637 Ga0081455_10021363
638 Ga0081538_10000055
639 Ga0081538_10000181
640 Ga0081538_10006367
641 Ga0081538_10043478
642 Ga0081540_1002875
643 Ga0081540_1028792
644 Ga0070717_10002526
645 Ga0070717_10019040
646 Ga0070712_100043874
647 Ga0075428_100055161
648 Ga0075428_100059347
649 Ga0075433_10008591
650 Ga0075433_10013027
651 Ga0075433_10035084
652 Ga0075433_10078043
653 Ga0075433_10126158
654 Ga0075434_100002112
655 Ga0075434_100048603
656 Ga0075434_100108830
657 Ga0068865_100084618
658 Ga0075436_100004922
659 Ga0075436_100017849
660 Ga0075435_100007173
661 Ga0075435_100069122
662 Ga0075435_100116080
663 Ga0105240_10084629
664 Ga0105240_10147933
665 Ga0111539_10047122
666 Ga0111539_10055644
667 Ga0111539_10072803
668 Ga0105245_10004292
669 Ga0105245_10040830
670 Ga0105245_10071367
671 Ga0105247_10009428
672 Ga0114129_10021204
673 Ga0114129_10035154
674 Ga0114129_10189480
675 Ga0105243_10000083
676 Ga0105241_10073862
677 Ga0105242_10000027
678 Ga0105242_10053783
679 Ga0105248_10170393
680 Ga0105249_10011417
681 Ga0105249_10087980
682 Ga0105239_10098829
683 Ga0105246_10003787
684 Ga0157370_10019388
685 Ga0157369_10024655
686 Ga0157369_10029594
687 Ga0157369_10110545
688 Ga0157374_10099403
689 Ga0163162_10050053
690 Ga0163162_10129908
691 Ga0157375_10214504
692 Ga0163163_10014926
693 Ga0157376_10103127
694 Ga0206356_10569481
695 Ga0207653_10006974
696 Ga0207710_10032220
697 Ga0207688_10000901
698 Ga0207643_10013338
699 Ga0207643_10024388
700 Ga0207643_10035811
701 Ga0207705_10032551
702 Ga0207693_10000797
703 Ga0207693_10026933
704 Ga0207693_10072793
705 Ga0207663_10022595
706 Ga0207663_10027758
707 Ga0207660_10020386
708 Ga0207660_10053506
709 Ga0207657_10000299
710 Ga0207652_10025421
711 Ga0207646_10004651
712 Ga0207646_10099144
713 Ga0207694_10037299
714 Ga0207650_10004030
715 Ga0207687_10004012
716 Ga0207687_10051028
717 Ga0207700_10000001
718 Ga0207700_10005890
719 Ga0207700_10007847
720 Ga0207700_10009821
721 Ga0207664_10010013
722 Ga0207664_10021677
723 Ga0207664_10028774
724 Ga0207706_10010925
725 Ga0207686_10000004
726 Ga0207686_10031438
727 Ga0207709_10000028
728 Ga0207704_10011912
729 Ga0207704_10032542
730 Ga0207665_10001701
731 Ga0207665_10005324
732 Ga0207691_10108059
733 Ga0207661_10005180
734 Ga0207661_10025701
735 Ga0207668_10093861
736 Ga0207658_10014786
737 Ga0207703_10077018
738 Ga0207702_10012256
739 Ga0207702_10036853
740 Ga0207676_10040336
741 Ga0207674_10046096
742 Ga0207674_10083612
743 Ga0207675_100007997
744 Ga0207675_100013600
745 Ga0207683_10001788
746 Ga0207683_10008439
747 Ga0207428_10003917
748 Ga0265318_10010744
749 Ga0265336_10017647
750 Ga0265338_10015807
751 Ga0265338_10016270
752 Ga0265338_10016377
753 Ga0265338_10020387
754 Ga0265338_10047022
755 Ga0265325_10025132
756 Ga0265339_10039248
757 Ga0265316_10033459
758 Ga0265316_10051288
759 Ga0265313_10011651
760 Ga0265314_10013147
761 Ga0307409_100058648
762 Ga0307416_100011036
763 Ga0307411_10055163
764 Ga0307415_100006503
765 Ga0373929_0003377
766 Ga0373944_0006286
767 Ga0373956_0032062
768 Ga0373943_0000713
769 Ga0373943_0006172
770 Ga0373943_0007113
771 Ga0373946_0007094
772 Ga0373935_0047664
773 Ga0373927_0010890
774 Ga0373933_0013384
775 Ga0373947_0006646
776 Ga0373947_0009996
777 Ga0373947_0011041
778 Ga0373947_0016652
779 Ga0373937_0000921
780 Ga0373937_0114843
781 Ga0373925_0001342
782 Ga0373925_0013743
783 Ga0395899_0001897
784 Ga0395899_0005633
785 Ga0395899_0027349
786 Ga0395899_0063600
787 Ga0395900_0002741
788 Ga0395900_0009667
789 Ga0395900_0013511
790 Ga0395900_0025542
791 Ga0395900_0050434
792 Ga0395900_0141341
793 Ga0395898_0017713
794 Ga0395898_0018356
795 Ga0395898_0020873
796 Ga0395898_0031774
797 Ga0395898_0034764
798 Ga0395898_0038603
799 Ga0395898_0048404
800 Ga0395898_0068747
801 Ga0395905_0009398
802 Ga0395905_0040311
803 Ga0395905_0047279
804 Ga0395905_0050802
805 Ga0395905_0095922
806 Ga0395901_0004504
807 Ga0395901_0005951
808 Ga0395901_0010778
809 Ga0395901_0011152
810 Ga0395901_0014936
811 Ga0395901_0021061
812 Ga0395901_0035884
813 Ga0395901_0044547
814 Ga0395901_0050064
815 Ga0395901_0054686
816 Ga0395901_0066428
817 Ga0395901_0103831
818 Ga0395901_0158415
819 Ga0451798_0061935
820 Ga0451800_1305818
821 Ga0451835_0463010
822 Ga0451847_0213419
823 Ga0439448_0001266
824 Ga0466969_0001557
825 Ga0466969_0018725
826 Ga0466966_0004349
827 Ga0466966_0021473
828 Ga0466961_0002376
829 Ga0466961_0003110
830 Ga0466961_0008403
831 Ga0466961_0024448
832 Ga0466961_0046826
833 Ga0466963_0000295
834 Ga0466963_0002164
835 Ga0466963_0003302
836 Ga0466963_0004570
837 Ga0466963_0007442
838 Ga0466963_0007729
839 Ga0466963_0008549
840 Ga0466963_0009984
841 Ga0466963_0010921
842 Ga0466963_0021854
843 Ga0466964_0000527
844 Ga0466964_0007720
845 Ga0466964_0020912
846 Ga0466971_0000590
847 Ga0466971_0001451
848 Ga0466968_0000752
849 Ga0466968_0001498
850 Ga0466968_0002452
851 Ga0466970_0004375
852 Ga0466957_0001198
853 Ga0466957_0002401
854 Ga0466957_0002405
855 Ga0466957_0002526
856 Ga0466957_0003540
857 Ga0466957_0018267
858 Ga0466957_0024015
859 Ga0466957_0024686
860 Ga0466960_0002014
861 Ga0466960_0043870
862 Ga0466959_0000831
863 Ga0466959_0006977
864 Ga0466959_0007329
865 Ga0466959_0037307
866 Ga0466959_0101787
867 Ga0451576_0014006
868 Ga0466958_0000860
869 Ga0466958_0001026
870 Ga0466958_0001749
871 Ga0466958_0004821
872 Ga0466958_0006894
873 Ga0466958_0008478
874 Ga0466958_0009025
875 Ga0466958_0010145
876 Ga0466958_0027359
877 Ga0466967_0000957
878 Ga0466967_0001277
879 Ga0466967_0006331
880 Ga0466967_0006442
881 Ga0466967_0009473
882 Ga0466967_0009578
883 Ga0466967_0021448
884 Ga0466967_0038022
885 Ga0466967_0039428
886 Ga0466967_0058688
887 Ga0466967_0071494
888 Ga0466967_0096475
889 Ga0495592_0000075
890 Ga0495592_0072584
891 Ga0495603_0000962
892 Ga0495603_0076317
893 Ga0495641_0000472
894 Ga0495641_0001728
895 Ga0495641_0003785
896 Ga0495641_0008818
897 Ga0495641_0017106
898 Ga0495651_0000344
899 Ga0495651_0049119
900 Ga0495651_0055466
901 Ga0495651_0060024
902 Ga0495651_0077263
903 Ga0495653_0002590
904 Ga0495653_0003311
905 Ga0495653_0039932
906 Ga0495580_0003552
907 Ga0495582_0000585
908 Ga0495582_0020642
909 Ga0495582_0021723
910 Ga0495639_0003168
911 Ga0495662_0000314
912 Ga0495662_0018729
913 Ga0495664_0012764
914 Ga0495664_0023109
915 Ga0495594_0009639
916 Ga0495607_0014549
917 Ga0495608_0002205
918 Ga0495608_0007897
919 Ga0495618_0007881
920 Ga0495618_0024324
921 Ga0495628_0000329
922 Ga0495628_0026571
923 Ga0495628_0044891
924 Ga0495628_0063586
925 Ga0495630_0013513
926 Ga0495630_0018166
927 Ga0495644_0009202
928 Ga0495666_0000339
929 Ga0495652_0000111
930 Ga0495652_0011077
931 Ga0495652_0067123
932 Ga0495665_0000420
933 Ga0495665_0001861
934 Ga0495640_0033102
935 Ga0495640_0088963
936 Ga0495586_0012457
937 Ga0495587_0000100
938 Ga0495587_0023561
939 Ga0495587_0026035
940 Ga0495645_0000046
941 Ga0495645_0056861
942 Ga0495645_0105194
943 Ga0495667_0021737
944 Ga0495667_0090976
945 Ga0495656_0004325
946 Ga0495634_0019257
947 Ga0495634_0022604
948 Ga0495635_0006782
949 Ga0495635_0031412
950 Ga0495588_0000666
951 Ga0495657_0006756
952 Ga0495599_0000086
953 Ga0495599_0002616
954 Ga0495599_0033582
955 Ga0495599_0054022
956 Ga0495623_0000037
957 Ga0495623_0031223
958 Ga0495646_0016353
959 Ga0495646_0050084
960 Ga0495647_0000750
961 Ga0495658_0001836
962 Ga0495658_0007173
963 Ga0495658_0035094
964 Ga0495613_0019145
965 Ga0495613_0035320
966 Ga0495613_0037530
967 Ga0495613_0063544
968 Ga0495600_0005625
969 Ga0495600_0031778
970 Ga0495581_0000648
971 Ga0495581_0006575
972 Ga0495581_0100782
973 Ga0495604_0000080
974 Ga0495674_0008195
975 Ga0495674_0031112
976 Ga0495674_0067706
977 Ga0495676_0000548
978 Ga0495676_0031735
979 Ga0495676_0033605
980 Ga0495680_0002321
981 Ga0495680_0006534
982 Ga0495680_0006791
983 Ga0495680_0010943
984 Ga0495680_0035152
985 Ga0495675_0000060
986 Ga0495684_0001384
987 Ga0495684_0002833
988 Ga0495684_0010241
989 Ga0495593_0004952
990 Ga0495593_0022089
991 Ga0495602_0000075
992 Ga0495602_0027938
993 Ga0495602_0043869
994 Ga0495602_0085066
995 Ga0496100_0002541
996 Ga0496101_0002117
997 Ga0496101_0021901
998 Ga0496101_0028624
999 Ga0496101_0042179
1000 Ga0496101_0045670
1001 Ga0496102_0007800
1002 Ga0496102_0013826
1003 Ga0496102_0030931
1004 Ga0496103_0002645
1005 Ga0496103_0028729
1006 Ga0496104_0002859
1007 Ga0496104_0006744
1008 Ga0496104_0006985
1009 Ga0496104_0049169
1010 Ga0496104_0100457
1011 Ga0496105_0000255
1012 Ga0496105_0000750
1013 Ga0496105_0009288
1014 Ga0496105_0010646
1015 Ga0496105_0040766
1016 Ga0496105_0157255
1017 Ga0496106_0000449
1018 Ga0496106_0012351
1019 Ga0496106_0018646
1020 Ga0496106_0021859
1021 Ga0496106_0050048
1022 Ga0496106_0059562
1023 Ga0496107_0007161
1024 Ga0496107_0009985
1025 Ga0496107_0013350
1026 Ga0496107_0049466
1027 Ga0496107_0083783
1028 Ga0496108_0003540
1029 Ga0496108_0004794
1030 Ga0496108_0007596
1031 Ga0496108_0014723
1032 Ga0496108_0104864
1033 Ga0496109_0001531
1034 Ga0496109_0017092
1035 Ga0496109_0021960
1036 Ga0496109_0045614
1037 Ga0496109_0048628
1038 Ga0496109_0057382
1039 Ga0496109_0129479
1040 Ga0496110_0000810
1041 Ga0496110_0001410
1042 Ga0496110_0002008
1043 Ga0496110_0004466
1044 Ga0496110_0008011
1045 Ga0496110_0014324
1046 Ga0496110_0027796
1047 Ga0496110_0051584
1048 Ga0496110_0071401
1049 Ga0496111_0000034
1050 Ga0496111_0000638
1051 Ga0496111_0001587
1052 Ga0496111_0004994
1053 Ga0496111_0007409
1054 Ga0496111_0016285
1055 Ga0496111_0018163
1056 Ga0496111_0019596
1057 Ga0496111_0028767
1058 Ga0496112_0000204
1059 Ga0496112_0006067
1060 Ga0496112_0022651
1061 Ga0496112_0034780
1062 Ga0496112_0075666
1063 Ga0496112_0134748
1064 Ga0496113_0021430
1065 Ga0496113_0026074
1066 Ga0496113_0036630
1067 Ga0496113_0060496
1068 Ga0496113_0093296
1069 Ga0496114_0000923
1070 Ga0496114_0005338
1071 Ga0496114_0028799
1072 Ga0496114_0070639
1073 Ga0496115_0004501
1074 Ga0496115_0033036
1075 Ga0501031_0000809
1076 Ga0501031_0006967
1077 Ga0501033_0000948
1078 Ga0501033_0032755
1079 Ga0501034_0074024
1080 Ga0501036_0095971
1081 Ga0501037_0003338
1082 Ga0501038_0001030
1083 Ga0501038_0002937
1084 Ga0501039_0002129
1085 Ga0501040_0016841
1086 Ga0501041_0001786
1087 Ga0501043_0005483
1088 Ga0501043_0011077
1089 Ga0501046_0002426
1090 Ga0501047_0139107
1091 Ga0501048_0010921
1092 Ga0501048_0041271
1093 Ga0501067_0002658
1094 Ga0501068_0002172
1095 Ga0501069_0019885
1096 Ga0501070_0000049
1097 Ga0501070_0002768
1098 Ga0501070_0012190
1099 Ga0501071_0004475
1100 Ga0501072_0012308
1101 Ga0501073_0000550
1102 Ga0501073_0002187
1103 Ga0501074_0000503
1104 Ga0501080_0001089
1105 Ga0501080_0001890
1106 Ga0501080_0063609
1107 Ga0501080_0079349
1108 Ga0501081_0001281
1109 Ga0501081_0056411
1110 Ga0501081_0078354
1111 Ga0501083_0000816
1112 Ga0501035_0007156
1113 Ga0501035_0085788
1114 Ga0501044_0019942
1115 Ga0501044_0056558
1116 Ga0501045_0000585
1117 nmdc:mga05p37_103850_c1
1118 nmdc:mga05p37_22170_c1
1119 nmdc:mga05p37_42427_c1
1120 nmdc:mga05p37_56521_c1
1121 nmdc:mga06r32_303094_c1
1122 nmdc:mga06r32_71843_c1
1123 nmdc:mga08y16_148565_c1
1124 nmdc:mga08y16_5425_c1
1125 nmdc:mga08y16_76228_c1
1126 nmdc:mga0n895_154406_c1
1127 nmdc:mga0n895_16016_c1
1128 nmdc:mga0rr50_933_c2
1129 nmdc:mga08x19_22600_c1
1130 nmdc:mga08x19_71609_c1
1131 nmdc:mga0a205_137069_c1
1132 nmdc:mga0a205_27351_c1
1133 nmdc:mga0a205_4922_c1
1134 nmdc:mga0a205_73002_c1
1135 Ga0495601_0000040
1136 Ga0495612_0001962
1137 Ga0495612_0013384
1138 Ga0495595_0010510
1139 Ga0495619_0000615
1140 Ga0495619_0004088
1141 Ga0495619_0004325
1142 Ga0495619_0008072
1143 Ga0495619_0031917
1144 Ga0495619_0033546
1145 Ga0495619_0038341
1146 Ga0500566_0033627
1147 Ga0501084_0009831
1148 Ga0501082_0001714
1149 Ga0501082_0030677
1150 Ga0466962_0001633
1151 Ga0466962_0001644
1152 Ga0466962_0002064
1153 Ga0466962_0016212
1154 Ga0530510_0001637
1155 2895504101
1156 2895515455
1157 2895525034
1158 2895527743

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

289

573

0.97

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

289

509

0.92

PF00106

adh_short

short chain dehydrogenase

287

365

0.87

PF04321

RmlD_sub_bind

RmlD substrate binding domain

287

539

0.85

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

290

529

0.84

PF08659

KR

KR domain

288

424

0.83

PF13727

CoA_binding_3

CoA-binding domain

61

244

0.79

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

290

434

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bjw-assembly1.cif.gz_B x-ray structure of the pglf 4,6-dehydratase from campylobacter jejuni, t595s variant, in complex with udp 0.9546 261 609
5bjy-assembly1.cif.gz_B x-ray structure of the pglf 4,5-dehydratase from campylobacter jejuni, variant m405y, in complex with udp 0.9431 261 606
5bjx-assembly1.cif.gz_A x-ray structure of the pglf 4,6-dehydratase from campylobacter jejuni, variant t395v, in complex with udp 0.9407 261 606
5bjv-assembly1.cif.gz_B x-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n-acrtylglucosamine 0.9387 261 606
5bjw-assembly1.cif.gz_B x-ray structure of the pglf 4,6-dehydratase from campylobacter jejuni, t595s variant, in complex with udp 0.9382 261 609
ID Description Score Start End Superfamily
af_Q2G1K5_279_602_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9517 282 606 3.40.50.720
6bwcE01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9408 281 509 3.40.50.720
af_Q2G1K5_279_602_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9402 282 606 3.40.50.720
af_Q2G1K4_2_342_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9147 282 570 3.40.50.720
af_Q58461_9_333_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9104 283 577 3.40.50.720
ID Description Score Start End GO Terms
AF-A7TB45-F1-model_v4 Polysaccharide biosynthesis protein CapD-like domain-containing protein 0.9794 296 609
AF-A0A355BJK5-F1-model_v4 Polysaccharide biosynthesis protein 0.9789 274 536
AF-A0A1F2SSE4-F1-model_v4 Polysaccharide biosynthesis protein CapD-like domain-containing protein 0.9788 289 430
AF-A0A355BJK5-F1-model_v4 Polysaccharide biosynthesis protein 0.9752 274 536
AF-A0A373PXN5-F1-model_v4 Polysaccharide biosynthesis protein 0.9746 274 610

Map