F465826

General Info

Members Datasets Scaffolds Average Seq Length
579 262 1158 118

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_11073568|Ga0105239_110735681
Length 130
Sequence MLVTSATKWRWAMADAGLFIGWGEVVRGRESEAAELFKETLGWYASLQDQGVIESFEPVFLEPHGGDLFGFILIRGDADKLAALRVSEEFSQLSTRVGLIVDKLGVVGAEMGERLQRQVEYFTKQVGAFA

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
168 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
169 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
170 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
184 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
188 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
189 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
192 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.9
Nodule 0
Rhizoplane 6.04
Rhizosphere 91.88
Stem 0
Stem Tuber 0
Unclassified 13.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_11073568 3300010375 Bacteria 927
2 JGI24743J22301_10005547 3300001991 Bacteria 2111
3 JGI24735J21928_10093383 3300002067 Bacteria 863
4 JGI24742J22300_10051700 3300002244 Bacteria 745
5 JGI25406J46586_10032234 3300003203 Unclassified 1949
6 JGI25406J46586_10190220 3300003203 Bacteria 599
7 JGI25407J50210_10120061 3300003373 Bacteria 647
8 Ga0070658_10035192 3300005327 Bacteria 4033
9 Ga0070676_10426548 3300005328 Bacteria 928
10 Ga0070683_100029245 3300005329 Bacteria 4986
11 Ga0068869_100228159 3300005334 Bacteria 1479
12 Ga0070666_10686725 3300005335 Bacteria 750
13 Ga0070680_101053095 3300005336 Bacteria 703
14 Ga0070682_100002236 3300005337 Bacteria 10729
15 Ga0070682_100062815 3300005337 Bacteria 2353
16 Ga0068868_100114314 3300005338 Bacteria 2196
17 Ga0070660_100004011 3300005339 Bacteria 10164
18 Ga0070660_100688596 3300005339 Bacteria 857
19 Ga0070689_100126414 3300005340 Bacteria 2046
20 Ga0070691_10006424 3300005341 Bacteria 5372
21 Ga0070691_10026000 3300005341 Bacteria 2727
22 Ga0070687_100042146 3300005343 Bacteria 2311
23 Ga0070687_100184498 3300005343 Unclassified 1252
24 Ga0070661_100005467 3300005344 Bacteria 8763
25 Ga0070692_10001096 3300005345 Bacteria 9432
26 Ga0070692_10165414 3300005345 Bacteria 1271
27 Ga0070692_10196328 3300005345 Bacteria 1179
28 Ga0070692_10309928 3300005345 Bacteria 967
29 Ga0070668_100019854 3300005347 Bacteria 5063
30 Ga0070668_100043069 3300005347 Bacteria 3461
31 Ga0070668_100198853 3300005347 Unclassified 1645
32 Ga0070669_100069909 3300005353 Bacteria 2594
33 Ga0070675_100018103 3300005354 Bacteria 5607
34 Ga0070675_100472588 3300005354 Bacteria 1127
35 Ga0070671_100316274 3300005355 Bacteria 1330
36 Ga0070674_100020373 3300005356 Bacteria 4236
37 Ga0070673_100001740 3300005364 Bacteria 12961
38 Ga0070659_100000759 3300005366 Bacteria 23424
39 Ga0070667_101256801 3300005367 Unclassified 693
40 Ga0070703_10251862 3300005406 Bacteria 717
41 Ga0070703_10348290 3300005406 Unclassified 631
42 Ga0070710_10647990 3300005437 Bacteria 740
43 Ga0070701_10068748 3300005438 Bacteria 1888
44 Ga0070711_101423205 3300005439 Bacteria 604
45 Ga0070705_101179671 3300005440 Unclassified 630
46 Ga0070700_100068425 3300005441 Bacteria 2258
47 Ga0070700_100514114 3300005441 Bacteria 924
48 Ga0070700_100702738 3300005441 Bacteria 804
49 Ga0070700_100961486 3300005441 Bacteria 700
50 Ga0070694_100191149 3300005444 Bacteria 1520
51 Ga0070663_100007034 3300005455 Bacteria 6819
52 Ga0070662_100004507 3300005457 Bacteria 8823
53 Ga0070662_100018709 3300005457 Bacteria 4691
54 Ga0070681_10371649 3300005458 Bacteria 1340
55 Ga0068867_100007628 3300005459 Bacteria 7653
56 Ga0070685_10025878 3300005466 Bacteria 3232
57 Ga0070685_10372071 3300005466 Bacteria 982
58 Ga0070706_101708948 3300005467 Unclassified 573
59 Ga0070679_100301372 3300005530 Bacteria 1553
60 Ga0070684_100032170 3300005535 Bacteria 4469
61 Ga0070684_100631379 3300005535 Bacteria 997
62 Ga0070684_101809352 3300005535 Unclassified 576
63 Ga0070684_102013518 3300005535 Bacteria 545
64 Ga0070684_102036490 3300005535 Bacteria 542
65 Ga0070697_100955376 3300005536 Unclassified 761
66 Ga0068853_100036582 3300005539 Bacteria 4176
67 Ga0070672_100002113 3300005543 Bacteria 12542
68 Ga0070686_100005553 3300005544 Bacteria 6977
69 Ga0070686_100478170 3300005544 Bacteria 963
70 Ga0070695_101001423 3300005545 Bacteria 680
71 Ga0070695_101876146 3300005545 Unclassified 503
72 Ga0070696_100149023 3300005546 Bacteria 1716
73 Ga0070693_100152671 3300005547 Bacteria 1464
74 Ga0070665_100186825 3300005548 Bacteria 2073
75 Ga0070665_100906539 3300005548 Bacteria 894
76 Ga0070704_100006445 3300005549 Bacteria 6918
77 Ga0070704_100300382 3300005549 Bacteria 1337
78 Ga0070664_100013939 3300005564 Bacteria 6553
79 Ga0068857_100078707 3300005577 Unclassified 2942
80 Ga0068854_100037662 3300005578 Bacteria 3396
81 Ga0068854_101577984 3300005578 Bacteria 597
82 Ga0068856_100265337 3300005614 Unclassified 1733
83 Ga0070702_100016779 3300005615 Bacteria 3765
84 Ga0068852_100034303 3300005616 Bacteria 4220
85 Ga0068852_102736675 3300005616 Bacteria 512
86 Ga0068859_100180095 3300005617 Bacteria 2196
87 Ga0068859_101019065 3300005617 Bacteria 909
88 Ga0068864_100354571 3300005618 Bacteria 1385
89 Ga0068866_10041581 3300005718 Bacteria 2281
90 Ga0068866_10256643 3300005718 Bacteria 1072
91 Ga0068861_100001504 3300005719 Bacteria 14790
92 Ga0068851_10064974 3300005834 Bacteria 1876
93 Ga0068870_10219942 3300005840 Bacteria 1162
94 Ga0068870_10275876 3300005840 Bacteria 1052
95 Ga0068860_100134926 3300005843 Bacteria 2370
96 Ga0081455_10006955 3300005937 Bacteria 12025
97 Ga0081455_10011985 3300005937 Bacteria 8677
98 Ga0081455_10185409 3300005937 Bacteria 1572
99 Ga0081455_10867278 3300005937 Unclassified 563
100 Ga0081538_10000091 3300005981 Bacteria 88665
101 Ga0081538_10011272 3300005981 Bacteria 7252
102 Ga0081538_10011694 3300005981 Bacteria 7092
103 Ga0081538_10088815 3300005981 Bacteria 1607
104 Ga0081538_10312961 3300005981 Bacteria 574
105 Ga0081540_1029578 3300005983 Bacteria 3048
106 Ga0081539_10002534 3300005985 Bacteria 25474
107 Ga0081539_10063053 3300005985 Bacteria 2024
108 Ga0070717_10830091 3300006028 Bacteria 841
109 Ga0075365_10012310 3300006038 Bacteria 5073
110 Ga0075365_10365060 3300006038 Bacteria 1018
111 Ga0075363_100063573 3300006048 Bacteria 1992
112 Ga0075364_10187849 3300006051 Bacteria 1399
113 Ga0075432_10009803 3300006058 Bacteria 3256
114 Ga0070715_10118196 3300006163 Bacteria 1260
115 Ga0070716_100179586 3300006173 Bacteria 1388
116 Ga0075367_10147344 3300006178 Bacteria 1460
117 Ga0075367_10438210 3300006178 Bacteria 828
118 Ga0075428_100004555 3300006844 Bacteria 15329
119 Ga0075428_100059074 3300006844 Bacteria 4199
120 Ga0075428_100122878 3300006844 Bacteria 2826
121 Ga0075428_100188408 3300006844 Bacteria 2232
122 Ga0075428_100267776 3300006844 Bacteria 1839
123 Ga0075428_100517640 3300006844 Unclassified 1276
124 Ga0075428_100761639 3300006844 Bacteria 1030
125 Ga0075428_101340612 3300006844 Bacteria 752
126 Ga0075430_100000689 3300006846 Bacteria 25786
127 Ga0075430_100025038 3300006846 Bacteria 5077
128 Ga0075430_100102555 3300006846 Bacteria 2388
129 Ga0075430_100499800 3300006846 Bacteria 1004
130 Ga0075430_100682490 3300006846 Bacteria 847
131 Ga0075430_101341884 3300006846 Bacteria 588
132 Ga0075431_100009341 3300006847 Bacteria 9844
133 Ga0075431_100038941 3300006847 Bacteria 4897
134 Ga0075431_100089316 3300006847 Bacteria 3180
135 Ga0075431_100146555 3300006847 Bacteria 2433
136 Ga0075431_101788969 3300006847 Bacteria 571
137 Ga0075431_101809677 3300006847 Bacteria 567
138 Ga0075433_10135256 3300006852 Bacteria 2191
139 Ga0075433_10595080 3300006852 Bacteria 971
140 Ga0075433_11236633 3300006852 Bacteria 648
141 Ga0075429_100009257 3300006880 Bacteria 8550
142 Ga0075429_100041940 3300006880 Bacteria 3984
143 Ga0075429_100326130 3300006880 Bacteria 1344
144 Ga0075429_100583290 3300006880 Bacteria 980
145 Ga0068865_100001484 3300006881 Bacteria 13660
146 Ga0068865_100048794 3300006881 Bacteria 2915
147 Ga0068865_101241802 3300006881 Bacteria 661
148 Ga0097620_100180101 3300006931 Bacteria 2196
149 Ga0097620_101019257 3300006931 Bacteria 909
150 Ga0111539_10036724 3300009094 Bacteria 5921
151 Ga0111539_10060489 3300009094 Bacteria 4489
152 Ga0111539_10417594 3300009094 Bacteria 1563
153 Ga0111539_12645208 3300009094 Bacteria 582
154 Ga0105245_10008994 3300009098 Bacteria 8711
155 Ga0105245_10040839 3300009098 Bacteria 4134
156 Ga0105245_10047375 3300009098 Bacteria 3842
157 Ga0105245_11787855 3300009098 Bacteria 667
158 Ga0105247_10112178 3300009101 Bacteria 1756
159 Ga0105247_10438409 3300009101 Bacteria 939
160 Ga0114129_10152569 3300009147 Bacteria 3161
161 Ga0114129_10162521 3300009147 Bacteria 3049
162 Ga0114129_10178315 3300009147 Bacteria 2893
163 Ga0114129_10513073 3300009147 Bacteria 1564
164 Ga0114129_11088868 3300009147 Unclassified 1001
165 Ga0114129_11508835 3300009147 Bacteria 826
166 Ga0114129_11746550 3300009147 Bacteria 758
167 Ga0114129_12430771 3300009147 Bacteria 627
168 Ga0114129_13049817 3300009147 Bacteria 549
169 Ga0105243_10004188 3300009148 Bacteria 11435
170 Ga0105243_10334636 3300009148 Bacteria 1384
171 Ga0105243_11717970 3300009148 Bacteria 657
172 Ga0105241_11015563 3300009174 Bacteria 777
173 Ga0105242_10199928 3300009176 Bacteria 1775
174 Ga0105248_10143344 3300009177 Bacteria 2696
175 Ga0105248_10922497 3300009177 Bacteria 986
176 Ga0105237_11781675 3300009545 Bacteria 623
177 Ga0105238_10113277 3300009551 Bacteria 2692
178 Ga0105238_11002841 3300009551 Bacteria 856
179 Ga0105249_10029176 3300009553 Bacteria 4982
180 Ga0105249_10232635 3300009553 Bacteria 1818
181 Ga0105249_10349486 3300009553 Bacteria 1497
182 Ga0105249_11551964 3300009553 Bacteria 734
183 Ga0105249_11867155 3300009553 Unclassified 673
184 Ga0105239_10062685 3300010375 Bacteria 4080
185 Ga0105239_10121255 3300010375 Bacteria 2904
186 Ga0105239_10855810 3300010375 Bacteria 1043
187 Ga0105246_10376682 3300011119 Unclassified 1171
188 Ga0105246_10681196 3300011119 Unclassified 899
189 Ga0157371_11449396 3300013102 Bacteria 534
190 Ga0157374_10638337 3300013296 Bacteria 1076
191 Ga0157374_11643529 3300013296 Unclassified 667
192 Ga0163162_10196999 3300013306 Bacteria 2143
193 Ga0163162_10372940 3300013306 Unclassified 1560
194 Ga0163162_10742734 3300013306 Unclassified 1101
195 Ga0163162_12900026 3300013306 Bacteria 552
196 Ga0157372_10144646 3300013307 Bacteria 2742
197 Ga0157372_10438361 3300013307 Bacteria 1523
198 Ga0157372_10893553 3300013307 Bacteria 1031
199 Ga0157375_10030731 3300013308 Bacteria 5069
200 Ga0157375_10351400 3300013308 Bacteria 1640
201 Ga0157375_11009736 3300013308 Bacteria 971
202 Ga0163163_10624421 3300014325 Bacteria 1141
203 Ga0157380_10044798 3300014326 Bacteria 3469
204 Ga0157380_10927704 3300014326 Bacteria 899
205 Ga0157377_10006589 3300014745 Bacteria 5548
206 Ga0157379_10080463 3300014968 Bacteria 2918
207 Ga0157379_10339531 3300014968 Unclassified 1374
208 Ga0157376_10807421 3300014969 Bacteria 951
209 Ga0157376_10854191 3300014969 Bacteria 926
210 Ga0163161_10147011 3300017792 Bacteria 1789
211 Ga0163161_10515209 3300017792 Bacteria 976
212 Ga0207653_10146687 3300025885 Bacteria 866
213 Ga0207642_10104330 3300025899 Unclassified 1430
214 Ga0207642_10190786 3300025899 Bacteria 1124
215 Ga0207710_10105633 3300025900 Bacteria 1332
216 Ga0207710_10133606 3300025900 Bacteria 1193
217 Ga0207688_10098037 3300025901 Bacteria 1689
218 Ga0207688_10611343 3300025901 Bacteria 687
219 Ga0207645_10157367 3300025907 Bacteria 1485
220 Ga0207643_10721534 3300025908 Bacteria 645
221 Ga0207705_10133318 3300025909 Bacteria 1850
222 Ga0207707_10487629 3300025912 Bacteria 1052
223 Ga0207693_10003498 3300025915 Bacteria 13403
224 Ga0207660_10452843 3300025917 Bacteria 1038
225 Ga0207662_10037984 3300025918 Bacteria 2821
226 Ga0207662_10262529 3300025918 Bacteria 1137
227 Ga0207657_10002062 3300025919 Bacteria 21736
228 Ga0207649_10186220 3300025920 Bacteria 1456
229 Ga0207681_10150152 3300025923 Bacteria 1745
230 Ga0207659_10011911 3300025926 Bacteria 5509
231 Ga0207659_10243985 3300025926 Bacteria 1455
232 Ga0207687_10005452 3300025927 Bacteria 8416
233 Ga0207687_10008479 3300025927 Bacteria 6719
234 Ga0207687_10055991 3300025927 Bacteria 2765
235 Ga0207687_11177736 3300025927 Bacteria 659
236 Ga0207690_10007322 3300025932 Bacteria 6551
237 Ga0207706_10003320 3300025933 Bacteria 15402
238 Ga0207706_10006030 3300025933 Bacteria 11274
239 Ga0207706_10580301 3300025933 Bacteria 964
240 Ga0207686_11698748 3300025934 Bacteria 522
241 Ga0207709_10118537 3300025935 Unclassified 1783
242 Ga0207670_10045603 3300025936 Bacteria 2907
243 Ga0207669_10017449 3300025937 Bacteria 3682
244 Ga0207704_10009563 3300025938 Bacteria 4683
245 Ga0207704_11342411 3300025938 Bacteria 612
246 Ga0207665_10431372 3300025939 Bacteria 1008
247 Ga0207691_10003070 3300025940 Bacteria 16291
248 Ga0207661_10076605 3300025944 Bacteria 2747
249 Ga0207661_10755981 3300025944 Bacteria 895
250 Ga0207679_10222536 3300025945 Bacteria 1588
251 Ga0207651_10017751 3300025960 Bacteria 4212
252 Ga0207712_10027236 3300025961 Bacteria 3815
253 Ga0207712_10914817 3300025961 Bacteria 776
254 Ga0207712_11297180 3300025961 Bacteria 651
255 Ga0207712_12029991 3300025961 Bacteria 515
256 Ga0207668_10014180 3300025972 Bacteria 4930
257 Ga0207668_10027235 3300025972 Bacteria 3722
258 Ga0207668_10454259 3300025972 Bacteria 1094
259 Ga0207668_11080521 3300025972 Unclassified 719
260 Ga0207658_10203022 3300025986 Bacteria 1656
261 Ga0207677_10021368 3300026023 Bacteria 3953
262 Ga0207703_11550702 3300026035 Bacteria 637
263 Ga0207639_10072445 3300026041 Bacteria 2697
264 Ga0207678_10002877 3300026067 Bacteria 15628
265 Ga0207678_10945096 3300026067 Bacteria 763
266 Ga0207708_10001316 3300026075 Bacteria 18668
267 Ga0207708_10090120 3300026075 Bacteria 2364
268 Ga0207708_10536240 3300026075 Bacteria 985
269 Ga0207648_10004492 3300026089 Bacteria 14301
270 Ga0207676_10324344 3300026095 Bacteria 1415
271 Ga0207674_10029909 3300026116 Bacteria 5731
272 Ga0207674_10093538 3300026116 Bacteria 2994
273 Ga0207675_100006017 3300026118 Bacteria 11548
274 Ga0207675_101469139 3300026118 Bacteria 702
275 Ga0207683_10096836 3300026121 Bacteria 2631
276 Ga0207683_10321516 3300026121 Bacteria 1417
277 Ga0207683_11829829 3300026121 Bacteria 556
278 Ga0207698_10075296 3300026142 Bacteria 2697
279 Ga0207698_10077907 3300026142 Bacteria 2659
280 Ga0207698_10826597 3300026142 Bacteria 930
281 Ga0209970_1029123 3300027614 Bacteria 955
282 Ga0209983_1009903 3300027665 Bacteria 1948
283 Ga0207428_10221941 3300027907 Bacteria 1416
284 Ga0207428_10305521 3300027907 Bacteria 1177
285 Ga0207428_10483265 3300027907 Bacteria 901
286 Ga0268266_10278674 3300028379 Bacteria 1554
287 Ga0268266_10468271 3300028379 Bacteria 1200
288 Ga0268264_11266368 3300028381 Bacteria 747
289 Ga0268264_12571460 3300028381 Bacteria 514
290 Ga0316575_10339619 3300031665 Bacteria 639
291 Ga0316576_10631455 3300031727 Unclassified 780
292 Ga0307405_10107787 3300031731 Bacteria 1881
293 Ga0307405_10305746 3300031731 Unclassified 1208
294 Ga0307413_10152672 3300031824 Unclassified 1612
295 Ga0307410_10145587 3300031852 Bacteria 1758
296 Ga0307406_10090435 3300031901 Bacteria 2060
297 Ga0307406_10524662 3300031901 Bacteria 964
298 Ga0307409_100052270 3300031995 Bacteria 3131
299 Ga0307409_100101415 3300031995 Bacteria 2388
300 Ga0307409_100139165 3300031995 Bacteria 2088
301 Ga0307409_101058753 3300031995 Bacteria 831
302 Ga0307409_101702123 3300031995 Bacteria 659
303 Ga0307416_100182512 3300032002 Bacteria 1968
304 Ga0307416_100946230 3300032002 Bacteria 963
305 Ga0307416_102286647 3300032002 Bacteria 641
306 Ga0307416_102354778 3300032002 Bacteria 632
307 Ga0307416_103516078 3300032002 Unclassified 524
308 Ga0307414_10864219 3300032004 Bacteria 828
309 Ga0307415_100160800 3300032126 Unclassified 1740
310 Ga0307415_100477683 3300032126 Bacteria 1084
311 Ga0307415_101408819 3300032126 Unclassified 664
312 Ga0307415_102077767 3300032126 Bacteria 554
313 Ga0373958_0056527 3300034819 Bacteria 840
314 Ga0373940_0020401 3300035088 Bacteria 1684
315 Ga0373949_0067891 3300035090 Bacteria 929
316 Ga0373951_0028301 3300035091 Bacteria 1313
317 Ga0373941_0040108 3300035115 Bacteria 1442
318 Ga0373942_0307705 3300035207 Bacteria 551
319 Ga0373961_0141785 3300035241 Bacteria 812
320 Ga0373961_0234170 3300035241 Bacteria 659
321 Ga0316574_0066767 3300035398 Bacteria 2267
322 Ga0316574_0068298 3300035398 Bacteria 2241
323 Ga0373947_1261202 3300035725 Unclassified 503
324 Ga0395899_0034822 3300037312 Bacteria 3782
325 Ga0395900_0027444 3300037418 Bacteria 5832
326 Ga0395900_0580253 3300037418 Bacteria 1063
327 Ga0395900_0683199 3300037418 Bacteria 961
328 Ga0395900_0732312 3300037418 Bacteria 920
329 Ga0395900_1323729 3300037418 Bacteria 634
330 Ga0395898_0008955 3300037466 Bacteria 10538
331 Ga0395898_0116675 3300037466 Bacteria 2558
332 Ga0395898_0765549 3300037466 Bacteria 906
333 Ga0395898_1258301 3300037466 Unclassified 670
334 Ga0395905_0052204 3300037471 Bacteria 3827
335 Ga0395905_0573262 3300037471 Bacteria 1030
336 Ga0395901_0011357 3300038443 Bacteria 9025
337 Ga0395901_0036078 3300038443 Bacteria 5108
338 Ga0395901_1506587 3300038443 Unclassified 628
339 Ga0395901_1681516 3300038443 Unclassified 586
340 Ga0451853_2129555 3300041512 Bacteria 825
341 Ga0439448_0187183 3300042005 Bacteria 724
342 Ga0439448_0264182 3300042005 Bacteria 609
343 Ga0450910_094949 3300042147 Unclassified 531
344 Ga0439464_0184259 3300042439 Unclassified 662
345 Ga0439440_0248422 3300042993 Bacteria 541
346 Ga0495591_116334 3300046458 Unclassified 654
347 Ga0495641_0076083 3300046461 Bacteria 1505
348 Ga0495584_0126974 3300046491 Bacteria 1293
349 Ga0495596_0055968 3300046500 Bacteria 1541
350 Ga0495596_0162374 3300046500 Bacteria 868
351 Ga0495596_0244773 3300046500 Unclassified 696
352 Ga0495596_0370892 3300046500 Bacteria 558
353 Ga0495607_0213265 3300046501 Bacteria 949
354 Ga0495644_0455277 3300046523 Unclassified 510
355 Ga0495666_0528783 3300046526 Unclassified 526
356 Ga0495609_0243554 3300046538 Bacteria 742
357 Ga0495659_0159960 3300046664 Unclassified 909
358 Ga0495588_0133498 3300046674 Bacteria 1310
359 Ga0495669_0520261 3300046684 Bacteria 579
360 Ga0495589_0124500 3300046794 Bacteria 1240
361 Ga0495589_0221874 3300046794 Bacteria 888
362 Ga0495589_0249176 3300046794 Bacteria 830
363 Ga0495676_0599212 3300047321 Unclassified 718
364 Ga0495614_0244130 3300048089 Bacteria 820
365 Ga0495615_0226640 3300048090 Unclassified 585
366 Ga0496100_0218909 3300048903 Bacteria 1396
367 Ga0496100_0338159 3300048903 Bacteria 1135
368 Ga0496101_0130174 3300048904 Bacteria 1910
369 Ga0496101_0205452 3300048904 Bacteria 1524
370 Ga0496102_0016678 3300048905 Bacteria 6424
371 Ga0496102_0314266 3300048905 Bacteria 1476
372 Ga0496102_0681698 3300048905 Bacteria 951
373 Ga0496104_0583434 3300048907 Bacteria 1028
374 Ga0496105_0453087 3300048908 Bacteria 1012
375 Ga0496106_0055657 3300048909 Bacteria 2990
376 Ga0496106_0435616 3300048909 Bacteria 1053
377 Ga0496107_0001899 3300048910 Bacteria 13247
378 Ga0496107_0127505 3300048910 Bacteria 1877
379 Ga0496107_0392466 3300048910 Bacteria 1032
380 Ga0496108_0011737 3300048911 Bacteria 7125
381 Ga0496108_0025434 3300048911 Bacteria 4879
382 Ga0496109_0010750 3300048912 Bacteria 7835
383 Ga0496109_0011418 3300048912 Bacteria 7635
384 Ga0496109_0384316 3300048912 Unclassified 1326
385 Ga0496109_0678042 3300048912 Bacteria 968
386 Ga0496110_0002608 3300048913 Bacteria 13562
387 Ga0496110_0132173 3300048913 Bacteria 2254
388 Ga0496110_0570820 3300048913 Bacteria 1027
389 Ga0496111_0018658 3300048914 Bacteria 4808
390 Ga0496111_0021999 3300048914 Bacteria 4459
391 Ga0496111_0033154 3300048914 Bacteria 3683
392 Ga0496111_0630105 3300048914 Unclassified 783
393 Ga0496111_0806244 3300048914 Bacteria 679
394 Ga0496112_0025748 3300048915 Bacteria 5651
395 Ga0496112_0384791 3300048915 Bacteria 1344
396 Ga0496113_0025683 3300048916 Bacteria 4202
397 Ga0496113_1484865 3300048916 Bacteria 523
398 Ga0496114_0027734 3300048917 Bacteria 4641
399 Ga0496114_0214034 3300048917 Bacteria 1691
400 Ga0496115_0008007 3300048918 Bacteria 7799
401 Ga0501031_0022579 3300049568 Bacteria 4099
402 Ga0501031_0076086 3300049568 Bacteria 2186
403 Ga0501031_0223086 3300049568 Bacteria 1227
404 Ga0501032_0020649 3300049569 Bacteria 4585
405 Ga0501032_0611062 3300049569 Unclassified 693
406 Ga0501033_0037714 3300049570 Bacteria 3616
407 Ga0501034_0673906 3300049571 Bacteria 934
408 Ga0501036_0005277 3300049572 Bacteria 10454
409 Ga0501036_0123478 3300049572 Bacteria 2187
410 Ga0501036_0218331 3300049572 Bacteria 1601
411 Ga0501036_0410593 3300049572 Unclassified 1129
412 Ga0501036_0730843 3300049572 Bacteria 817
413 Ga0501036_1295455 3300049572 Unclassified 592
414 Ga0501036_1497073 3300049572 Unclassified 546
415 Ga0501037_0004859 3300049573 Bacteria 9780
416 Ga0501037_0659374 3300049573 Unclassified 699
417 Ga0501037_0876791 3300049573 Unclassified 589
418 Ga0501038_0198600 3300049574 Bacteria 1611
419 Ga0501039_0076187 3300049575 Bacteria 2608
420 Ga0501039_0244762 3300049575 Bacteria 1410
421 Ga0501039_0470800 3300049575 Bacteria 986
422 Ga0501039_0480067 3300049575 Unclassified 976
423 Ga0501040_0004461 3300049576 Bacteria 9087
424 Ga0501040_0190532 3300049576 Bacteria 1455
425 Ga0501040_0197148 3300049576 Bacteria 1429
426 Ga0501040_0267504 3300049576 Bacteria 1220
427 Ga0501040_0480113 3300049576 Bacteria 896
428 Ga0501040_0532646 3300049576 Unclassified 847
429 Ga0501040_0594478 3300049576 Bacteria 799
430 Ga0501041_0042336 3300049577 Bacteria 2767
431 Ga0501041_0080157 3300049577 Bacteria 2010
432 Ga0501041_0171827 3300049577 Unclassified 1356
433 Ga0501041_0188991 3300049577 Unclassified 1290
434 Ga0501041_0331471 3300049577 Bacteria 960
435 Ga0501041_1000160 3300049577 Unclassified 538
436 Ga0501042_0002873 3300049578 Bacteria 10682
437 Ga0501042_0089921 3300049578 Bacteria 2203
438 Ga0501042_0259349 3300049578 Bacteria 1255
439 Ga0501043_0034348 3300049579 Bacteria 3988
440 Ga0501046_0005116 3300049580 Bacteria 11763
441 Ga0501046_0209935 3300049580 Bacteria 1446
442 Ga0501046_0648642 3300049580 Unclassified 746
443 Ga0501047_0233048 3300049581 Bacteria 1694
444 Ga0501048_0011824 3300049582 Bacteria 6508
445 Ga0501048_0060203 3300049582 Bacteria 2691
446 Ga0501048_0270200 3300049582 Unclassified 1208
447 Ga0501048_0392908 3300049582 Bacteria 991
448 Ga0501048_0486824 3300049582 Bacteria 884
449 Ga0501048_0756037 3300049582 Bacteria 698
450 Ga0501048_0938221 3300049582 Unclassified 622
451 Ga0501048_1022354 3300049582 Unclassified 594
452 Ga0501067_0679286 3300049583 Bacteria 578
453 Ga0501068_0012647 3300049584 Bacteria 4790
454 Ga0501069_0116567 3300049585 Bacteria 1523
455 Ga0501069_0476722 3300049585 Bacteria 743
456 Ga0501070_0012884 3300049586 Bacteria 7045
457 Ga0501070_0530772 3300049586 Bacteria 944
458 Ga0501070_1534707 3300049586 Unclassified 503
459 Ga0501071_0016263 3300049587 Bacteria 5115
460 Ga0501071_0050267 3300049587 Bacteria 3003
461 Ga0501071_0117612 3300049587 Bacteria 1969
462 Ga0501071_0196793 3300049587 Bacteria 1513
463 Ga0501071_0254164 3300049587 Bacteria 1327
464 Ga0501071_0472736 3300049587 Unclassified 960
465 Ga0501071_0695666 3300049587 Bacteria 783
466 Ga0501071_1107598 3300049587 Unclassified 612
467 Ga0501072_0102990 3300049588 Bacteria 2269
468 Ga0501072_0162611 3300049588 Bacteria 1781
469 Ga0501072_0162861 3300049588 Bacteria 1779
470 Ga0501072_0204737 3300049588 Bacteria 1573
471 Ga0501072_0403321 3300049588 Bacteria 1084
472 Ga0501072_0504839 3300049588 Bacteria 957
473 Ga0501073_0001168 3300049589 Bacteria 19173
474 Ga0501073_0908284 3300049589 Unclassified 606
475 Ga0501074_0161256 3300049590 Bacteria 1602
476 Ga0501074_0270769 3300049590 Unclassified 1207
477 Ga0501074_0466537 3300049590 Bacteria 895
478 Ga0501074_0788124 3300049590 Unclassified 670
479 Ga0501075_0037365 3300049591 Bacteria 3628
480 Ga0501075_0152548 3300049591 Bacteria 1761
481 Ga0501075_0256727 3300049591 Bacteria 1332
482 Ga0501075_0355010 3300049591 Bacteria 1117
483 Ga0501075_1099992 3300049591 Unclassified 603
484 Ga0501075_1220889 3300049591 Unclassified 570
485 Ga0501076_0057056 3300049592 Bacteria 3100
486 Ga0501076_0083590 3300049592 Bacteria 2564
487 Ga0501076_0175129 3300049592 Bacteria 1748
488 Ga0501076_0261671 3300049592 Bacteria 1416
489 Ga0501076_0326217 3300049592 Bacteria 1259
490 Ga0501076_0778196 3300049592 Bacteria 790
491 Ga0501077_0003294 3300049593 Bacteria 9722
492 Ga0501077_0046687 3300049593 Bacteria 2751
493 Ga0501077_0306406 3300049593 Bacteria 1012
494 Ga0501077_0698650 3300049593 Bacteria 652
495 Ga0501261_099741 3300049690 Bacteria 551
496 Ga0501079_0056263 3300049741 Unclassified 3035
497 Ga0501079_0093285 3300049741 Bacteria 2332
498 Ga0501079_0831578 3300049741 Bacteria 727
499 Ga0501079_0835701 3300049741 Unclassified 725
500 Ga0501080_0058550 3300049742 Bacteria 3586
501 Ga0501080_0077003 3300049742 Bacteria 3101
502 Ga0501081_0037901 3300049743 Bacteria 3290
503 Ga0501081_0095806 3300049743 Bacteria 2093
504 Ga0501081_0315037 3300049743 Bacteria 1149
505 Ga0501081_0323303 3300049743 Bacteria 1134
506 Ga0501081_0325480 3300049743 Unclassified 1130
507 Ga0501081_0924828 3300049743 Bacteria 658
508 Ga0501083_0005468 3300049744 Bacteria 8996
509 Ga0501035_0018930 3300049822 Bacteria 6342
510 Ga0501035_0792539 3300049822 Bacteria 757
511 Ga0501035_1128469 3300049822 Bacteria 611
512 Ga0501044_0149566 3300049823 Bacteria 2318
513 Ga0501044_0994693 3300049823 Bacteria 711
514 Ga0501045_0091879 3300049824 Bacteria 2244
515 Ga0501045_0184253 3300049824 Bacteria 1555
516 Ga0501045_0305847 3300049824 Bacteria 1183
517 Ga0501045_0449408 3300049824 Bacteria 958
518 Ga0501045_0539430 3300049824 Unclassified 865
519 Ga0501045_0841424 3300049824 Unclassified 675
520 nmdc:mga03n38_47694_c1 3300050490 Bacteria 1897
521 nmdc:mga00v17_13426_c1 3300050491 Bacteria 4547
522 nmdc:mga0yw44_15858_c1 3300050492 Bacteria 4052
523 nmdc:mga0yw44_488766_c1 3300050492 Bacteria 835
524 nmdc:mga06z11_139964_c1 3300050494 Bacteria 1367
525 nmdc:mga05p37_120372_c1 3300050507 Bacteria 3225
526 nmdc:mga05p37_1260509_c1 3300050507 Bacteria 757
527 nmdc:mga05p37_1725930_c1 3300050507 Bacteria 609
528 nmdc:mga05p37_1879636_c1 3300050507 Bacteria 573
529 nmdc:mga05p37_34203_c1 3300050507 Bacteria 6224
530 nmdc:mga05p37_402585_c1 3300050507 Bacteria 1598
531 nmdc:mga05p37_601674_c1 3300050507 Bacteria 1241
532 nmdc:mga05p37_673616_c1 3300050507 Bacteria 1154
533 nmdc:mga05p37_909622_c1 3300050507 Bacteria 947
534 nmdc:mga05p37_992710_c1 3300050507 Unclassified 893
535 nmdc:mga09592_1333117_c1 3300050508 Bacteria 589
536 nmdc:mga09592_156126_c1 3300050508 Unclassified 1970
537 nmdc:mga09592_311982_c1 3300050508 Bacteria 1363
538 nmdc:mga09592_38421_c1 3300050508 Bacteria 4019
539 nmdc:mga09592_656355_c1 3300050508 Bacteria 895
540 nmdc:mga0qj67_102159_c1 3300050509 Bacteria 2312
541 nmdc:mga0qj67_2590_c1 3300050509 Bacteria 12943
542 nmdc:mga0qj67_385731_c1 3300050509 Bacteria 1131
543 nmdc:mga0qj67_550124_c1 3300050509 Bacteria 926
544 nmdc:mga06r32_13497_c1 3300050510 Bacteria 7403
545 nmdc:mga06r32_139474_c1 3300050510 Bacteria 2400
546 nmdc:mga06r32_281886_c1 3300050510 Bacteria 1649
547 nmdc:mga06r32_378651_c1 3300050510 Bacteria 1398
548 nmdc:mga06r32_493341_c1 3300050510 Bacteria 1202
549 nmdc:mga06r32_49638_c1 3300050510 Bacteria 4013
550 nmdc:mga08y16_187461_c1 3300050511 Bacteria 2146
551 nmdc:mga08y16_37319_c1 3300050511 Bacteria 5104
552 nmdc:mga08y16_86346_c1 3300050511 Bacteria 3270
553 nmdc:mga08y16_86580_c1 3300050511 Bacteria 3265
554 nmdc:mga0rr50_1462544_c1 3300050513 Unclassified 578
555 nmdc:mga0a205_1203279_c1 3300050515 Bacteria 605
556 nmdc:mga0a205_657269_c1 3300050515 Bacteria 899
557 nmdc:mga0a205_96172_c1 3300050515 Bacteria 2860
558 Ga0495655_0019424 3300053083 Bacteria 1509
559 Ga0495655_0055349 3300053083 Bacteria 1064
560 Ga0501084_0029471 3300054114 Bacteria 4590
561 Ga0501084_0040357 3300054114 Bacteria 3904
562 Ga0501084_0098300 3300054114 Bacteria 2458
563 Ga0501084_0125452 3300054114 Bacteria 2160
564 Ga0501084_0506603 3300054114 Bacteria 1020
565 Ga0501084_0561554 3300054114 Bacteria 964
566 Ga0501084_0852306 3300054114 Bacteria 767
567 Ga0501084_0889011 3300054114 Unclassified 749
568 Ga0501082_0110987 3300060353 Bacteria 2373
569 Ga0501082_0161659 3300060353 Bacteria 1946
570 Ga0501082_0650692 3300060353 Bacteria 922
571 Ga0501082_0669828 3300060353 Bacteria 908
572 Ga0501082_1391774 3300060353 Bacteria 613
573 Ga0530510_0012073 3300061734 Bacteria 6060
574 Ga0530510_0035754 3300061734 Bacteria 3581
575 Ga0530510_0108393 3300061734 Bacteria 2033
576 Ga0530510_0196984 3300061734 Bacteria 1496
577 Ga0530510_0396113 3300061734 Bacteria 1040
578 Ga0530510_0677467 3300061734 Bacteria 785
579 Ga0530510_0762676 3300061734 Bacteria 738
580 Ga0105239_11073568
581 JGI24743J22301_10005547
582 JGI24735J21928_10093383
583 JGI24742J22300_10051700
584 JGI25406J46586_10032234
585 JGI25406J46586_10190220
586 JGI25407J50210_10120061
587 Ga0070658_10035192
588 Ga0070676_10426548
589 Ga0070683_100029245
590 Ga0068869_100228159
591 Ga0070666_10686725
592 Ga0070680_101053095
593 Ga0070682_100002236
594 Ga0070682_100062815
595 Ga0068868_100114314
596 Ga0070660_100004011
597 Ga0070660_100688596
598 Ga0070689_100126414
599 Ga0070691_10006424
600 Ga0070691_10026000
601 Ga0070687_100042146
602 Ga0070687_100184498
603 Ga0070661_100005467
604 Ga0070692_10001096
605 Ga0070692_10165414
606 Ga0070692_10196328
607 Ga0070692_10309928
608 Ga0070668_100019854
609 Ga0070668_100043069
610 Ga0070668_100198853
611 Ga0070669_100069909
612 Ga0070675_100018103
613 Ga0070675_100472588
614 Ga0070671_100316274
615 Ga0070674_100020373
616 Ga0070673_100001740
617 Ga0070659_100000759
618 Ga0070667_101256801
619 Ga0070703_10251862
620 Ga0070703_10348290
621 Ga0070710_10647990
622 Ga0070701_10068748
623 Ga0070711_101423205
624 Ga0070705_101179671
625 Ga0070700_100068425
626 Ga0070700_100514114
627 Ga0070700_100702738
628 Ga0070700_100961486
629 Ga0070694_100191149
630 Ga0070663_100007034
631 Ga0070662_100004507
632 Ga0070662_100018709
633 Ga0070681_10371649
634 Ga0068867_100007628
635 Ga0070685_10025878
636 Ga0070685_10372071
637 Ga0070706_101708948
638 Ga0070679_100301372
639 Ga0070684_100032170
640 Ga0070684_100631379
641 Ga0070684_101809352
642 Ga0070684_102013518
643 Ga0070684_102036490
644 Ga0070697_100955376
645 Ga0068853_100036582
646 Ga0070672_100002113
647 Ga0070686_100005553
648 Ga0070686_100478170
649 Ga0070695_101001423
650 Ga0070695_101876146
651 Ga0070696_100149023
652 Ga0070693_100152671
653 Ga0070665_100186825
654 Ga0070665_100906539
655 Ga0070704_100006445
656 Ga0070704_100300382
657 Ga0070664_100013939
658 Ga0068857_100078707
659 Ga0068854_100037662
660 Ga0068854_101577984
661 Ga0068856_100265337
662 Ga0070702_100016779
663 Ga0068852_100034303
664 Ga0068852_102736675
665 Ga0068859_100180095
666 Ga0068859_101019065
667 Ga0068864_100354571
668 Ga0068866_10041581
669 Ga0068866_10256643
670 Ga0068861_100001504
671 Ga0068851_10064974
672 Ga0068870_10219942
673 Ga0068870_10275876
674 Ga0068860_100134926
675 Ga0081455_10006955
676 Ga0081455_10011985
677 Ga0081455_10185409
678 Ga0081455_10867278
679 Ga0081538_10000091
680 Ga0081538_10011272
681 Ga0081538_10011694
682 Ga0081538_10088815
683 Ga0081538_10312961
684 Ga0081540_1029578
685 Ga0081539_10002534
686 Ga0081539_10063053
687 Ga0070717_10830091
688 Ga0075365_10012310
689 Ga0075365_10365060
690 Ga0075363_100063573
691 Ga0075364_10187849
692 Ga0075432_10009803
693 Ga0070715_10118196
694 Ga0070716_100179586
695 Ga0075367_10147344
696 Ga0075367_10438210
697 Ga0075428_100004555
698 Ga0075428_100059074
699 Ga0075428_100122878
700 Ga0075428_100188408
701 Ga0075428_100267776
702 Ga0075428_100517640
703 Ga0075428_100761639
704 Ga0075428_101340612
705 Ga0075430_100000689
706 Ga0075430_100025038
707 Ga0075430_100102555
708 Ga0075430_100499800
709 Ga0075430_100682490
710 Ga0075430_101341884
711 Ga0075431_100009341
712 Ga0075431_100038941
713 Ga0075431_100089316
714 Ga0075431_100146555
715 Ga0075431_101788969
716 Ga0075431_101809677
717 Ga0075433_10135256
718 Ga0075433_10595080
719 Ga0075433_11236633
720 Ga0075429_100009257
721 Ga0075429_100041940
722 Ga0075429_100326130
723 Ga0075429_100583290
724 Ga0068865_100001484
725 Ga0068865_100048794
726 Ga0068865_101241802
727 Ga0097620_100180101
728 Ga0097620_101019257
729 Ga0111539_10036724
730 Ga0111539_10060489
731 Ga0111539_10417594
732 Ga0111539_12645208
733 Ga0105245_10008994
734 Ga0105245_10040839
735 Ga0105245_10047375
736 Ga0105245_11787855
737 Ga0105247_10112178
738 Ga0105247_10438409
739 Ga0114129_10152569
740 Ga0114129_10162521
741 Ga0114129_10178315
742 Ga0114129_10513073
743 Ga0114129_11088868
744 Ga0114129_11508835
745 Ga0114129_11746550
746 Ga0114129_12430771
747 Ga0114129_13049817
748 Ga0105243_10004188
749 Ga0105243_10334636
750 Ga0105243_11717970
751 Ga0105241_11015563
752 Ga0105242_10199928
753 Ga0105248_10143344
754 Ga0105248_10922497
755 Ga0105237_11781675
756 Ga0105238_10113277
757 Ga0105238_11002841
758 Ga0105249_10029176
759 Ga0105249_10232635
760 Ga0105249_10349486
761 Ga0105249_11551964
762 Ga0105249_11867155
763 Ga0105239_10062685
764 Ga0105239_10121255
765 Ga0105239_10855810
766 Ga0105246_10376682
767 Ga0105246_10681196
768 Ga0157371_11449396
769 Ga0157374_10638337
770 Ga0157374_11643529
771 Ga0163162_10196999
772 Ga0163162_10372940
773 Ga0163162_10742734
774 Ga0163162_12900026
775 Ga0157372_10144646
776 Ga0157372_10438361
777 Ga0157372_10893553
778 Ga0157375_10030731
779 Ga0157375_10351400
780 Ga0157375_11009736
781 Ga0163163_10624421
782 Ga0157380_10044798
783 Ga0157380_10927704
784 Ga0157377_10006589
785 Ga0157379_10080463
786 Ga0157379_10339531
787 Ga0157376_10807421
788 Ga0157376_10854191
789 Ga0163161_10147011
790 Ga0163161_10515209
791 Ga0207653_10146687
792 Ga0207642_10104330
793 Ga0207642_10190786
794 Ga0207710_10105633
795 Ga0207710_10133606
796 Ga0207688_10098037
797 Ga0207688_10611343
798 Ga0207645_10157367
799 Ga0207643_10721534
800 Ga0207705_10133318
801 Ga0207707_10487629
802 Ga0207693_10003498
803 Ga0207660_10452843
804 Ga0207662_10037984
805 Ga0207662_10262529
806 Ga0207657_10002062
807 Ga0207649_10186220
808 Ga0207681_10150152
809 Ga0207659_10011911
810 Ga0207659_10243985
811 Ga0207687_10005452
812 Ga0207687_10008479
813 Ga0207687_10055991
814 Ga0207687_11177736
815 Ga0207690_10007322
816 Ga0207706_10003320
817 Ga0207706_10006030
818 Ga0207706_10580301
819 Ga0207686_11698748
820 Ga0207709_10118537
821 Ga0207670_10045603
822 Ga0207669_10017449
823 Ga0207704_10009563
824 Ga0207704_11342411
825 Ga0207665_10431372
826 Ga0207691_10003070
827 Ga0207661_10076605
828 Ga0207661_10755981
829 Ga0207679_10222536
830 Ga0207651_10017751
831 Ga0207712_10027236
832 Ga0207712_10914817
833 Ga0207712_11297180
834 Ga0207712_12029991
835 Ga0207668_10014180
836 Ga0207668_10027235
837 Ga0207668_10454259
838 Ga0207668_11080521
839 Ga0207658_10203022
840 Ga0207677_10021368
841 Ga0207703_11550702
842 Ga0207639_10072445
843 Ga0207678_10002877
844 Ga0207678_10945096
845 Ga0207708_10001316
846 Ga0207708_10090120
847 Ga0207708_10536240
848 Ga0207648_10004492
849 Ga0207676_10324344
850 Ga0207674_10029909
851 Ga0207674_10093538
852 Ga0207675_100006017
853 Ga0207675_101469139
854 Ga0207683_10096836
855 Ga0207683_10321516
856 Ga0207683_11829829
857 Ga0207698_10075296
858 Ga0207698_10077907
859 Ga0207698_10826597
860 Ga0209970_1029123
861 Ga0209983_1009903
862 Ga0207428_10221941
863 Ga0207428_10305521
864 Ga0207428_10483265
865 Ga0268266_10278674
866 Ga0268266_10468271
867 Ga0268264_11266368
868 Ga0268264_12571460
869 Ga0316575_10339619
870 Ga0316576_10631455
871 Ga0307405_10107787
872 Ga0307405_10305746
873 Ga0307413_10152672
874 Ga0307410_10145587
875 Ga0307406_10090435
876 Ga0307406_10524662
877 Ga0307409_100052270
878 Ga0307409_100101415
879 Ga0307409_100139165
880 Ga0307409_101058753
881 Ga0307409_101702123
882 Ga0307416_100182512
883 Ga0307416_100946230
884 Ga0307416_102286647
885 Ga0307416_102354778
886 Ga0307416_103516078
887 Ga0307414_10864219
888 Ga0307415_100160800
889 Ga0307415_100477683
890 Ga0307415_101408819
891 Ga0307415_102077767
892 Ga0373958_0056527
893 Ga0373940_0020401
894 Ga0373949_0067891
895 Ga0373951_0028301
896 Ga0373941_0040108
897 Ga0373942_0307705
898 Ga0373961_0141785
899 Ga0373961_0234170
900 Ga0316574_0066767
901 Ga0316574_0068298
902 Ga0373947_1261202
903 Ga0395899_0034822
904 Ga0395900_0027444
905 Ga0395900_0580253
906 Ga0395900_0683199
907 Ga0395900_0732312
908 Ga0395900_1323729
909 Ga0395898_0008955
910 Ga0395898_0116675
911 Ga0395898_0765549
912 Ga0395898_1258301
913 Ga0395905_0052204
914 Ga0395905_0573262
915 Ga0395901_0011357
916 Ga0395901_0036078
917 Ga0395901_1506587
918 Ga0395901_1681516
919 Ga0451853_2129555
920 Ga0439448_0187183
921 Ga0439448_0264182
922 Ga0450910_094949
923 Ga0439464_0184259
924 Ga0439440_0248422
925 Ga0495591_116334
926 Ga0495641_0076083
927 Ga0495584_0126974
928 Ga0495596_0055968
929 Ga0495596_0162374
930 Ga0495596_0244773
931 Ga0495596_0370892
932 Ga0495607_0213265
933 Ga0495644_0455277
934 Ga0495666_0528783
935 Ga0495609_0243554
936 Ga0495659_0159960
937 Ga0495588_0133498
938 Ga0495669_0520261
939 Ga0495589_0124500
940 Ga0495589_0221874
941 Ga0495589_0249176
942 Ga0495676_0599212
943 Ga0495614_0244130
944 Ga0495615_0226640
945 Ga0496100_0218909
946 Ga0496100_0338159
947 Ga0496101_0130174
948 Ga0496101_0205452
949 Ga0496102_0016678
950 Ga0496102_0314266
951 Ga0496102_0681698
952 Ga0496104_0583434
953 Ga0496105_0453087
954 Ga0496106_0055657
955 Ga0496106_0435616
956 Ga0496107_0001899
957 Ga0496107_0127505
958 Ga0496107_0392466
959 Ga0496108_0011737
960 Ga0496108_0025434
961 Ga0496109_0010750
962 Ga0496109_0011418
963 Ga0496109_0384316
964 Ga0496109_0678042
965 Ga0496110_0002608
966 Ga0496110_0132173
967 Ga0496110_0570820
968 Ga0496111_0018658
969 Ga0496111_0021999
970 Ga0496111_0033154
971 Ga0496111_0630105
972 Ga0496111_0806244
973 Ga0496112_0025748
974 Ga0496112_0384791
975 Ga0496113_0025683
976 Ga0496113_1484865
977 Ga0496114_0027734
978 Ga0496114_0214034
979 Ga0496115_0008007
980 Ga0501031_0022579
981 Ga0501031_0076086
982 Ga0501031_0223086
983 Ga0501032_0020649
984 Ga0501032_0611062
985 Ga0501033_0037714
986 Ga0501034_0673906
987 Ga0501036_0005277
988 Ga0501036_0123478
989 Ga0501036_0218331
990 Ga0501036_0410593
991 Ga0501036_0730843
992 Ga0501036_1295455
993 Ga0501036_1497073
994 Ga0501037_0004859
995 Ga0501037_0659374
996 Ga0501037_0876791
997 Ga0501038_0198600
998 Ga0501039_0076187
999 Ga0501039_0244762
1000 Ga0501039_0470800
1001 Ga0501039_0480067
1002 Ga0501040_0004461
1003 Ga0501040_0190532
1004 Ga0501040_0197148
1005 Ga0501040_0267504
1006 Ga0501040_0480113
1007 Ga0501040_0532646
1008 Ga0501040_0594478
1009 Ga0501041_0042336
1010 Ga0501041_0080157
1011 Ga0501041_0171827
1012 Ga0501041_0188991
1013 Ga0501041_0331471
1014 Ga0501041_1000160
1015 Ga0501042_0002873
1016 Ga0501042_0089921
1017 Ga0501042_0259349
1018 Ga0501043_0034348
1019 Ga0501046_0005116
1020 Ga0501046_0209935
1021 Ga0501046_0648642
1022 Ga0501047_0233048
1023 Ga0501048_0011824
1024 Ga0501048_0060203
1025 Ga0501048_0270200
1026 Ga0501048_0392908
1027 Ga0501048_0486824
1028 Ga0501048_0756037
1029 Ga0501048_0938221
1030 Ga0501048_1022354
1031 Ga0501067_0679286
1032 Ga0501068_0012647
1033 Ga0501069_0116567
1034 Ga0501069_0476722
1035 Ga0501070_0012884
1036 Ga0501070_0530772
1037 Ga0501070_1534707
1038 Ga0501071_0016263
1039 Ga0501071_0050267
1040 Ga0501071_0117612
1041 Ga0501071_0196793
1042 Ga0501071_0254164
1043 Ga0501071_0472736
1044 Ga0501071_0695666
1045 Ga0501071_1107598
1046 Ga0501072_0102990
1047 Ga0501072_0162611
1048 Ga0501072_0162861
1049 Ga0501072_0204737
1050 Ga0501072_0403321
1051 Ga0501072_0504839
1052 Ga0501073_0001168
1053 Ga0501073_0908284
1054 Ga0501074_0161256
1055 Ga0501074_0270769
1056 Ga0501074_0466537
1057 Ga0501074_0788124
1058 Ga0501075_0037365
1059 Ga0501075_0152548
1060 Ga0501075_0256727
1061 Ga0501075_0355010
1062 Ga0501075_1099992
1063 Ga0501075_1220889
1064 Ga0501076_0057056
1065 Ga0501076_0083590
1066 Ga0501076_0175129
1067 Ga0501076_0261671
1068 Ga0501076_0326217
1069 Ga0501076_0778196
1070 Ga0501077_0003294
1071 Ga0501077_0046687
1072 Ga0501077_0306406
1073 Ga0501077_0698650
1074 Ga0501261_099741
1075 Ga0501079_0056263
1076 Ga0501079_0093285
1077 Ga0501079_0831578
1078 Ga0501079_0835701
1079 Ga0501080_0058550
1080 Ga0501080_0077003
1081 Ga0501081_0037901
1082 Ga0501081_0095806
1083 Ga0501081_0315037
1084 Ga0501081_0323303
1085 Ga0501081_0325480
1086 Ga0501081_0924828
1087 Ga0501083_0005468
1088 Ga0501035_0018930
1089 Ga0501035_0792539
1090 Ga0501035_1128469
1091 Ga0501044_0149566
1092 Ga0501044_0994693
1093 Ga0501045_0091879
1094 Ga0501045_0184253
1095 Ga0501045_0305847
1096 Ga0501045_0449408
1097 Ga0501045_0539430
1098 Ga0501045_0841424
1099 nmdc:mga03n38_47694_c1
1100 nmdc:mga00v17_13426_c1
1101 nmdc:mga0yw44_15858_c1
1102 nmdc:mga0yw44_488766_c1
1103 nmdc:mga06z11_139964_c1
1104 nmdc:mga05p37_120372_c1
1105 nmdc:mga05p37_1260509_c1
1106 nmdc:mga05p37_1725930_c1
1107 nmdc:mga05p37_1879636_c1
1108 nmdc:mga05p37_34203_c1
1109 nmdc:mga05p37_402585_c1
1110 nmdc:mga05p37_601674_c1
1111 nmdc:mga05p37_673616_c1
1112 nmdc:mga05p37_909622_c1
1113 nmdc:mga05p37_992710_c1
1114 nmdc:mga09592_1333117_c1
1115 nmdc:mga09592_156126_c1
1116 nmdc:mga09592_311982_c1
1117 nmdc:mga09592_38421_c1
1118 nmdc:mga09592_656355_c1
1119 nmdc:mga0qj67_102159_c1
1120 nmdc:mga0qj67_2590_c1
1121 nmdc:mga0qj67_385731_c1
1122 nmdc:mga0qj67_550124_c1
1123 nmdc:mga06r32_13497_c1
1124 nmdc:mga06r32_139474_c1
1125 nmdc:mga06r32_281886_c1
1126 nmdc:mga06r32_378651_c1
1127 nmdc:mga06r32_493341_c1
1128 nmdc:mga06r32_49638_c1
1129 nmdc:mga08y16_187461_c1
1130 nmdc:mga08y16_37319_c1
1131 nmdc:mga08y16_86346_c1
1132 nmdc:mga08y16_86580_c1
1133 nmdc:mga0rr50_1462544_c1
1134 nmdc:mga0a205_1203279_c1
1135 nmdc:mga0a205_657269_c1
1136 nmdc:mga0a205_96172_c1
1137 Ga0495655_0019424
1138 Ga0495655_0055349
1139 Ga0501084_0029471
1140 Ga0501084_0040357
1141 Ga0501084_0098300
1142 Ga0501084_0125452
1143 Ga0501084_0506603
1144 Ga0501084_0561554
1145 Ga0501084_0852306
1146 Ga0501084_0889011
1147 Ga0501082_0110987
1148 Ga0501082_0161659
1149 Ga0501082_0650692
1150 Ga0501082_0669828
1151 Ga0501082_1391774
1152 Ga0530510_0012073
1153 Ga0530510_0035754
1154 Ga0530510_0108393
1155 Ga0530510_0196984
1156 Ga0530510_0396113
1157 Ga0530510_0677467
1158 Ga0530510_0762676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.7627 4 100
3e8o-assembly1.cif.gz_B crystal structure of a putative antibiotic biosynthesis monooxygenase (dr_2100) from deinococcus radiodurans at 1.40 a resolution 0.7489 4 101
1y0h-assembly1.cif.gz_B structure of rv0793 from mycobacterium tuberculosis 0.7489 4 101
3bb5-assembly2.cif.gz_C crystal structure of a dimeric ferredoxin-like protein of unknown function (jann_3925) from jannaschia sp. ccs1 at 2.30 a resolution 0.7378 4 96
2fb0-assembly1.cif.gz_A-2 crystal structure of conserved protein of unknown function from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution, possible oxidoreductase 0.7317 1 98
ID Description Score Start End Superfamily
af_Q67XD6_173_269_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8189 7 95 3.30.70.100
af_Q553Q3_117_222_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.756 5 95 3.30.70.100
af_Q67XD6_173_269_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.753 7 95 3.30.70.100
1y0hB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7489 4 101 3.30.70.100
af_Q54CJ9_3_103_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7475 4 99 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A3D1TUF6-F1-model_v4 Uncharacterized protein 0.9916 5 71
AF-A0A536PMU5-F1-model_v4 Uncharacterized protein 0.9894 2 116
AF-A0A1Y6BRP0-F1-model_v4 Hemoglobin 0.9845 1 112
AF-A0A7W0ZU75-F1-model_v4 Uncharacterized protein 0.9824 8 112
AF-A0A1Q7MAV0-F1-model_v4 Uncharacterized protein 0.979 2 112

Map