F465769

General Info

Members Datasets Scaffolds Average Seq Length
578 405 409 239

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0085461|Ga0496116_0085461_1116_1883
Length 255
Sequence MTLDDILGSLFADSQGLVRENGLLWGRARLADDGQDRMPTVIGVEGRAFVGVDDAIVLARVVLQTIAQGAAQGSQEPILVLIDSSSQRMSKRDELLGLNEFLAHLAKSLIYAHARGHATVGLXXXXTAAGAFIATALATSTLLALPGAHPAVMDLPSMARVTKLPLTVLEEKAKSTPVFAPGLDNLAQTGGVAQVLNPDQPLSAQVRDVLATLTTGLTPRERAQDHRDRLGKTRGGRPVAADIADQVYALARAAI

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
4 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
5 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
6 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
7 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
8 2519103095 Burkholderia sp. KJ006 Isolate Nodule
9 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
10 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
11 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
12 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
13 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
14 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
15 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
16 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
17 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
18 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
19 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
20 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
21 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
22 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
23 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
24 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
25 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
26 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
27 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
28 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
29 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
30 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
31 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
32 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
33 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
34 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
35 2818991452 Burkholderia cepacia 561 Isolate Unclassified
36 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
37 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
38 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
39 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
40 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
41 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
42 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
43 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
44 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
45 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
46 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
47 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
48 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
49 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
50 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
51 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
52 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
53 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
54 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
55 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
56 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
57 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
58 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
59 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
60 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
61 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
62 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
63 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
64 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
65 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
66 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
67 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
68 2928163908 Burkholderia sp. 567 Isolate Unclassified
69 2928170801 Burkholderia sp. 572 Isolate Unclassified
70 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
71 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
72 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
73 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
74 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
75 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
76 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
77 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
78 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
79 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
80 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
81 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
82 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
83 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
84 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
85 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
86 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
87 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
88 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
89 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
90 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
91 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
92 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
93 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
94 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
95 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
96 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
97 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
98 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
99 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
100 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
101 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
102 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
103 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
104 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
105 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
106 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
107 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
108 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
109 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
110 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
111 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
112 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
113 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
114 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
115 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
116 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
117 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
118 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
119 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
120 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
121 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
122 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
123 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
124 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
125 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
126 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
127 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
128 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
129 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
130 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
131 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
132 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
133 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
134 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
135 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
136 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
137 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
138 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
139 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
140 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
141 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
142 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
143 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
144 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
145 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
146 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
147 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
148 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
149 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
150 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
151 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
152 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
153 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
154 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
155 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
156 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
157 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
158 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
159 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
160 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
161 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
162 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
163 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
164 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
165 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
166 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
167 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
168 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
169 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
170 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
171 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
172 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
173 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
174 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
175 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
176 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
177 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
178 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
179 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
180 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
181 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
182 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
183 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
184 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
185 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
186 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
187 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
188 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
189 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
190 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
191 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
192 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
193 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
194 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
195 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
201 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
202 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
206 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
208 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
209 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
210 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
251 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
253 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
254 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
255 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
256 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
257 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
258 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
259 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
260 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
261 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
262 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
263 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
264 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
265 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
266 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
267 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
268 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
269 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
270 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
271 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
272 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
273 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
278 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
279 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
280 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
281 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
282 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
283 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
284 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
285 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
286 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
293 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
296 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
297 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
298 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
299 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
302 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
303 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
304 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
307 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
308 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
309 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
315 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
316 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
317 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
321 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
335 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
336 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
337 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
338 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
339 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
342 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
343 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
344 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
345 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
346 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
347 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
348 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
349 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
350 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
351 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
352 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
353 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
354 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
355 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
356 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
357 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
358 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
359 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
360 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
361 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
362 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
363 641522639 Methylobacterium sp. 4-46 Isolate Nodule
364 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
365 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
366 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
367 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
368 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
369 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
370 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
371 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
372 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
373 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
374 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
375 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
376 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
377 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
378 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
379 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
380 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
381 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
382 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
383 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
384 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
385 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
386 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
387 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
388 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
389 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
390 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
391 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
392 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
393 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
394 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
395 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
396 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
397 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
398 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
399 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
400 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
401 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
402 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
403 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
404 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
405 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.01
Metatranscriptomes 0
Isolates 28.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.96
Nodule 19.38
Rhizoplane 4.5
Rhizosphere 45.85
Stem 0
Stem Tuber 0
Unclassified 13.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000838 3300002739 Bacteria 5867
2 JGI25152J39213_1007085 3300002773 Bacteria 2947
3 JGI25159J45721_1000678 3300002987 Bacteria 15023
4 JGI25159J45721_1002059 3300002987 Bacteria 7951
5 JGI25153J46596_10000288 3300003215 Bacteria 38391
6 JGI25153J46596_10001586 3300003215 Bacteria 13473
7 JGI25153J46596_10018033 3300003215 Bacteria 2756
8 JGI25153J46596_10041756 3300003215 Bacteria 1407
9 rootH2_10005012 3300003320 Bacteria 11801
10 rootL2_10006749 3300003322 Bacteria 38317
11 rootL2_10077760 3300003322 Bacteria 1960
12 rootH1_10109858 3300003323 Bacteria 4716
13 rootH1_10164832 3300003323 Bacteria 1379
14 rootH1_10164833 3300003323 Bacteria 1377
15 JGI25160J50197_1000413 3300003354 Bacteria 27195
16 JGI25160J50197_1001701 3300003354 Bacteria 10676
17 JGI25160J50197_1022434 3300003354 Bacteria 1850
18 JGI25161J50226_1000567 3300003374 Bacteria 15685
19 JGI25161J50226_1000572 3300003374 Bacteria 15570
20 JGI25161J50226_1000905 3300003374 Bacteria 10676
21 Ga0055532_1000954 3300003758 Bacteria 9294
22 Ga0055527_1000519 3300003760 Bacteria 13244
23 Ga0055535_1001606 3300003761 Bacteria 10646
24 Ga0055535_1001639 3300003761 Bacteria 10456
25 Ga0055542_1001602 3300003762 Bacteria 10456
26 Ga0055542_1004740 3300003762 Bacteria 3208
27 Ga0055529_1001193 3300003763 Bacteria 10456
28 Ga0055524_1007133 3300003775 Bacteria 4785
29 Ga0055528_1001484 3300003790 Bacteria 14245
30 Ga0055528_1005415 3300003790 Bacteria 5950
31 Ga0055540_1002714 3300003792 Bacteria 9116
32 Ga0058692_1016950 3300003856 Bacteria 1607
33 Ga0055543_1000079 3300004625 Bacteria 84916
34 Ga0055543_1000116 3300004625 Bacteria 67872
35 Ga0055543_1002291 3300004625 Bacteria 6462
36 Ga0065165_1002903 3300005262 Bacteria 13143
37 Ga0065165_1036443 3300005262 Bacteria 1500
38 Ga0070670_100009469 3300005331 Bacteria 8317
39 Ga0070670_100318602 3300005331 Bacteria 1362
40 Ga0070666_10033261 3300005335 Bacteria 3411
41 Ga0070666_10112887 3300005335 Bacteria 1880
42 Ga0070660_100000028 3300005339 Bacteria 88388
43 Ga0070661_100042078 3300005344 Bacteria 3334
44 Ga0070661_100070332 3300005344 Bacteria 2573
45 Ga0070668_100015221 3300005347 Bacteria 5747
46 Ga0070668_100179605 3300005347 Bacteria 1728
47 Ga0070668_100746361 3300005347 Bacteria 866
48 Ga0070659_100000230 3300005366 Bacteria 43454
49 Ga0070709_10001293 3300005434 Bacteria 13650
50 Ga0070709_10026169 3300005434 Bacteria 3454
51 Ga0070714_100045562 3300005435 Bacteria 3717
52 Ga0070713_100009193 3300005436 Bacteria 7055
53 Ga0070710_10000282 3300005437 Bacteria 24043
54 Ga0070710_10231800 3300005437 Bacteria 1179
55 Ga0070711_100014925 3300005439 Bacteria 4907
56 Ga0070711_100134613 3300005439 Bacteria 1845
57 Ga0070708_100284339 3300005445 Bacteria 1557
58 Ga0070663_100003063 3300005455 Bacteria 9558
59 Ga0070663_100023282 3300005455 Bacteria 4150
60 Ga0070662_100007492 3300005457 Bacteria 7077
61 Ga0070662_100058201 3300005457 Bacteria 2812
62 Ga0070665_100000465 3300005548 Bacteria 58821
63 Ga0070665_100003470 3300005548 Bacteria 16799
64 Ga0070665_100097993 3300005548 Bacteria 2937
65 Ga0068855_100177750 3300005563 Bacteria 2407
66 Ga0068855_100310437 3300005563 Bacteria 1745
67 Ga0070664_100141871 3300005564 Bacteria 2116
68 Ga0068856_100327522 3300005614 Bacteria 1549
69 Ga0068856_101010871 3300005614 Bacteria 850
70 Ga0068852_100029923 3300005616 Bacteria 4477
71 Ga0068859_100318350 3300005617 Bacteria 1650
72 Ga0068851_10002327 3300005834 Bacteria 8366
73 Ga0068863_100299783 3300005841 Bacteria 1559
74 Ga0068858_100013390 3300005842 Bacteria 7741
75 Ga0068858_100319541 3300005842 Bacteria 1483
76 Ga0068860_100243394 3300005843 Bacteria 1750
77 Ga0068862_100107747 3300005844 Bacteria 2443
78 Ga0081540_1009036 3300005983 Bacteria 6887
79 Ga0081540_1018480 3300005983 Bacteria 4274
80 Ga0070717_10271883 3300006028 Bacteria 1501
81 Ga0075363_100063664 3300006048 Bacteria 1991
82 Ga0075364_10020082 3300006051 Bacteria 4201
83 Ga0070712_100005683 3300006175 Bacteria 7713
84 Ga0075362_10129195 3300006177 Bacteria 1200
85 Ga0075367_10185266 3300006178 Bacteria 1298
86 Ga0075366_10021738 3300006195 Bacteria 3730
87 Ga0075370_10006671 3300006353 Bacteria 5823
88 Ga0068865_100311329 3300006881 Bacteria 1263
89 Ga0097620_100318339 3300006931 Bacteria 1650
90 Ga0099794_10013003 3300007265 Bacteria 3611
91 Ga0105250_10092105 3300009092 Unclassified 1233
92 Ga0105250_10200063 3300009092 Bacteria 842
93 Ga0105240_10001146 3300009093 Bacteria 46418
94 Ga0105240_10014261 3300009093 Bacteria 10855
95 Ga0105240_10042503 3300009093 Bacteria 5791
96 Ga0105240_10070943 3300009093 Bacteria 4309
97 Ga0105240_10457071 3300009093 Bacteria 1428
98 Ga0111539_10000323 3300009094 Bacteria 58458
99 Ga0105247_10014641 3300009101 Bacteria 4702
100 Ga0105243_10164959 3300009148 Bacteria 1913
101 Ga0105241_10065423 3300009174 Bacteria 2809
102 Ga0105241_10074884 3300009174 Bacteria 2637
103 Ga0105241_10087414 3300009174 Bacteria 2454
104 Ga0105242_10975339 3300009176 Bacteria 853
105 Ga0105248_10079304 3300009177 Bacteria 3690
106 Ga0105237_10001621 3300009545 Bacteria 29218
107 Ga0105237_10004870 3300009545 Bacteria 15385
108 Ga0105237_10016195 3300009545 Bacteria 7753
109 Ga0105237_10018112 3300009545 Bacteria 7291
110 Ga0105237_10115232 3300009545 Bacteria 2681
111 Ga0105237_10213030 3300009545 Bacteria 1931
112 Ga0105237_10395808 3300009545 Bacteria 1386
113 Ga0105237_10530513 3300009545 Bacteria 1184
114 Ga0105238_10025999 3300009551 Bacteria 5966
115 Ga0105238_10075985 3300009551 Bacteria 3351
116 Ga0105238_10503897 3300009551 Bacteria 1212
117 Ga0105249_10007619 3300009553 Bacteria 9444
118 Ga0099796_10000384 3300010159 Bacteria 7229
119 Ga0105239_10045380 3300010375 Bacteria 4816
120 Ga0105239_10078794 3300010375 Bacteria 3626
121 Ga0105239_10129037 3300010375 Bacteria 2811
122 Ga0105239_10174566 3300010375 Bacteria 2404
123 Ga0105239_10500869 3300010375 Bacteria 1381
124 Ga0105239_11372141 3300010375 Bacteria 816
125 Ga0105246_10072109 3300011119 Bacteria 2434
126 Ga0157378_10807274 3300013297 Bacteria 964
127 Ga0163162_10010810 3300013306 Bacteria 8878
128 Ga0157375_10416230 3300013308 Bacteria 1510
129 Ga0163163_10956599 3300014325 Bacteria 920
130 Ga0182008_10000113 3300014497 Bacteria 61507
131 Ga0182007_10000213 3300015262 Bacteria 38873
132 Ga0213873_10002417 3300021358 Bacteria 3234
133 Ga0213872_10003532 3300021361 Bacteria 8629
134 Ga0213872_10018759 3300021361 Bacteria 3188
135 Ga0213872_10020568 3300021361 Bacteria 3043
136 Ga0213872_10024949 3300021361 Bacteria 2749
137 Ga0213872_10025083 3300021361 Bacteria 2741
138 Ga0213872_10057011 3300021361 Bacteria 1769
139 Ga0213876_10150635 3300021384 Bacteria 1237
140 Ga0209436_100066 3300025208 Bacteria 54510
141 Ga0209566_100904 3300025225 Bacteria 14153
142 Ga0209672_100019 3300025228 Bacteria 432215
143 Ga0209672_100069 3300025228 Bacteria 174956
144 Ga0209147_100026 3300025229 Bacteria 421622
145 Ga0209147_100044 3300025229 Bacteria 300330
146 Ga0209147_100128 3300025229 Bacteria 122259
147 Ga0209258_100031 3300025242 Bacteria 463572
148 Ga0209258_100079 3300025242 Bacteria 263132
149 Ga0209148_1000027 3300025254 Bacteria 616374
150 Ga0209148_1000474 3300025254 Bacteria 42596
151 Ga0209148_1000501 3300025254 Bacteria 39942
152 Ga0209148_1001447 3300025254 Bacteria 12057
153 Ga0209129_1006000 3300025258 Bacteria 4079
154 Ga0209233_1008059 3300025261 Bacteria 3289
155 Ga0209565_1018425 3300025263 Bacteria 1510
156 Ga0209455_1000058 3300025272 Bacteria 342028
157 Ga0209455_1001131 3300025272 Bacteria 12961
158 Ga0209455_1011491 3300025272 Bacteria 2176
159 Ga0209673_1000059 3300025273 Bacteria 268892
160 Ga0209673_1001545 3300025273 Bacteria 20787
161 Ga0209130_1000022 3300025284 Bacteria 361244
162 Ga0209130_1000219 3300025284 Bacteria 74906
163 Ga0209564_1000475 3300025295 Bacteria 67102
164 Ga0209758_1000993 3300025297 Bacteria 37839
165 Ga0209758_1007575 3300025297 Bacteria 7335
166 Ga0209256_1037569 3300025299 Bacteria 1260
167 Ga0209256_1044624 3300025299 Bacteria 1106
168 Ga0207426_1000005 3300025302 Bacteria 1037188
169 Ga0207426_1000075 3300025302 Bacteria 321337
170 Ga0209051_1061830 3300025303 Bacteria 1174
171 Ga0209257_1051176 3300025304 Bacteria 1165
172 Ga0207656_10005520 3300025321 Bacteria 4476
173 Ga0207692_10120291 3300025898 Bacteria 1469
174 Ga0207710_10036840 3300025900 Bacteria 2158
175 Ga0207680_10023242 3300025903 Bacteria 3382
176 Ga0207647_10002100 3300025904 Bacteria 15252
177 Ga0207647_10051781 3300025904 Bacteria 2536
178 Ga0207647_10080733 3300025904 Bacteria 1950
179 Ga0207705_10078506 3300025909 Bacteria 2403
180 Ga0207684_10322804 3300025910 Bacteria 1331
181 Ga0207654_10067821 3300025911 Bacteria 2109
182 Ga0207654_10119718 3300025911 Bacteria 1651
183 Ga0207654_10177692 3300025911 Bacteria 1387
184 Ga0207695_10000006 3300025913 Bacteria 1135309
185 Ga0207695_10003507 3300025913 Bacteria 21992
186 Ga0207695_10023432 3300025913 Bacteria 6976
187 Ga0207695_10071449 3300025913 Bacteria 3545
188 Ga0207695_10089774 3300025913 Bacteria 3089
189 Ga0207671_10013654 3300025914 Bacteria 6456
190 Ga0207671_10020670 3300025914 Bacteria 5008
191 Ga0207671_10022161 3300025914 Bacteria 4806
192 Ga0207671_10141456 3300025914 Bacteria 1854
193 Ga0207671_10270888 3300025914 Bacteria 1338
194 Ga0207693_10008068 3300025915 Bacteria 8634
195 Ga0207693_10036970 3300025915 Bacteria 3849
196 Ga0207663_10116032 3300025916 Bacteria 1825
197 Ga0207657_10000001 3300025919 Bacteria 458536
198 Ga0207694_10080842 3300025924 Bacteria 2551
199 Ga0207694_10097732 3300025924 Bacteria 2323
200 Ga0207650_10298737 3300025925 Bacteria 1315
201 Ga0207700_10005940 3300025928 Bacteria 7345
202 Ga0207664_10008161 3300025929 Bacteria 7289
203 Ga0207644_10040268 3300025931 Bacteria 3302
204 Ga0207690_10000072 3300025932 Bacteria 88241
205 Ga0207706_10001636 3300025933 Bacteria 22180
206 Ga0207706_10141303 3300025933 Bacteria 2118
207 Ga0207665_10024914 3300025939 Bacteria 3947
208 Ga0207711_10145182 3300025941 Bacteria 2137
209 Ga0207667_10673808 3300025949 Bacteria 1038
210 Ga0207712_10001146 3300025961 Bacteria 18465
211 Ga0207668_10009192 3300025972 Bacteria 5912
212 Ga0207668_10280590 3300025972 Bacteria 1366
213 Ga0207640_10729532 3300025981 Bacteria 852
214 Ga0207658_10017385 3300025986 Bacteria 4954
215 Ga0207658_10468596 3300025986 Bacteria 1118
216 Ga0207677_10132213 3300026023 Bacteria 1897
217 Ga0207703_10011514 3300026035 Bacteria 6880
218 Ga0207703_10056162 3300026035 Bacteria 3205
219 Ga0207639_10004652 3300026041 Bacteria 9240
220 Ga0207639_10058139 3300026041 Bacteria 2973
221 Ga0207639_10326389 3300026041 Bacteria 1364
222 Ga0207678_10001112 3300026067 Bacteria 24644
223 Ga0207678_10012138 3300026067 Bacteria 7566
224 Ga0207678_10026489 3300026067 Bacteria 5057
225 Ga0207678_10030234 3300026067 Bacteria 4728
226 Ga0207702_10130697 3300026078 Bacteria 2259
227 Ga0207702_10979875 3300026078 Bacteria 838
228 Ga0207641_10252675 3300026088 Bacteria 1647
229 Ga0207648_10331910 3300026089 Bacteria 1368
230 Ga0207674_10046570 3300026116 Bacteria 4452
231 Ga0207674_10267551 3300026116 Bacteria 1657
232 Ga0207675_100292014 3300026118 Bacteria 1586
233 Ga0207698_10187980 3300026142 Bacteria 1836
234 Ga0209371_1000243 3300027312 Bacteria 67855
235 Ga0209371_1002714 3300027312 Bacteria 9553
236 Ga0207428_10000129 3300027907 Bacteria 104467
237 Ga0268266_10000006 3300028379 Bacteria 1410021
238 Ga0268266_10252816 3300028379 Bacteria 1631
239 Ga0268256_1000311 3300030500 Bacteria 48691
240 Ga0265331_10178578 3300031250 Bacteria 959
241 Ga0307516_10000173 3300031730 Bacteria 82288
242 Ga0307410_10138330 3300031852 Bacteria 1798
243 Ga0307409_100042599 3300031995 Bacteria 3401
244 Ga0307414_10515187 3300032004 Bacteria 1061
245 Ga0373947_0298456 3300035725 Unclassified 1074
246 Ga0436365_0265027 3300039437 Bacteria 2672
247 Ga0436365_1822309 3300039437 Bacteria 1165
248 Ga0436360_0537233 3300039438 Bacteria 1466
249 Ga0436360_0695279 3300039438 Bacteria 4157
250 Ga0436360_0722236 3300039438 Plasmid 2700
251 Ga0436360_1172287 3300039438 Bacteria 1605
252 Ga0436361_0087656 3300039447 Bacteria 876
253 Ga0436361_0091426 3300039447 Bacteria 2870
254 Ga0436361_0176654 3300039447 Bacteria 6986
255 Ga0436361_0267995 3300039447 Bacteria 7047
256 Ga0436361_0357323 3300039447 Bacteria 1540
257 Ga0436361_0362812 3300039447 Bacteria 2565
258 Ga0436361_0372030 3300039447 Bacteria 9128
259 Ga0436361_0472884 3300039447 Bacteria 1090
260 Ga0436361_0993041 3300039447 Bacteria 1043
261 Ga0436361_1192548 3300039447 Bacteria 1870
262 Ga0436362_0775664 3300039453 Bacteria 3592
263 Ga0436362_1289511 3300039453 Unclassified 1718
264 Ga0439465_0016516 3300041413 Bacteria 2302
265 Ga0451793_0280828 3300041452 Bacteria 2838
266 Ga0451795_0231223 3300041456 Bacteria 1058
267 Ga0451837_0701287 3300041494 Bacteria 1002
268 Ga0439431_0010234 3300041997 Bacteria 2126
269 Ga0439431_0044809 3300041997 Bacteria 1135
270 Ga0466972_0014613 3300044658 Bacteria 3930
271 Ga0466972_0016624 3300044658 Bacteria 3678
272 Ga0466961_0122803 3300044693 Bacteria 1630
273 Ga0466968_0002924 3300044735 Bacteria 6310
274 Ga0466968_0217313 3300044735 Bacteria 899
275 Ga0466970_0169722 3300044765 Bacteria 1209
276 Ga0466960_0000523 3300044901 Bacteria 13157
277 Ga0466959_0059664 3300045049 Bacteria 2778
278 Ga0466967_0306456 3300045976 Bacteria 1529
279 Ga0495590_0049862 3300046457 Bacteria 1461
280 Ga0495629_0030964 3300046459 Bacteria 3790
281 Ga0495638_0000019 3300046460 Bacteria 384671
282 Ga0495605_0081139 3300046474 Bacteria 1517
283 Ga0495584_0316806 3300046491 Bacteria 792
284 Ga0495596_0164548 3300046500 Bacteria 862
285 Ga0495606_0017751 3300046507 Bacteria 5366
286 Ga0495606_0055014 3300046507 Bacteria 2575
287 Ga0495606_0097475 3300046507 Bacteria 1796
288 Ga0495610_0002011 3300046512 Bacteria 17382
289 Ga0495610_0068283 3300046512 Bacteria 1666
290 Ga0495616_0102608 3300046513 Bacteria 1340
291 Ga0495628_0189255 3300046516 Bacteria 1554
292 Ga0495628_0267754 3300046516 Bacteria 1272
293 Ga0495643_0015969 3300046522 Bacteria 4420
294 Ga0495643_0053328 3300046522 Bacteria 2168
295 Ga0495643_0057175 3300046522 Bacteria 2079
296 Ga0495648_0162125 3300046524 Bacteria 1155
297 Ga0495648_0288065 3300046524 Bacteria 775
298 Ga0495640_0100321 3300046533 Bacteria 1901
299 Ga0495622_0078556 3300046557 Bacteria 1519
300 Ga0495667_0547230 3300046559 Bacteria 723
301 Ga0495668_0128870 3300046616 Bacteria 1385
302 Ga0495634_0064965 3300046642 Bacteria 2419
303 Ga0495611_0019278 3300046648 Bacteria 2929
304 Ga0495625_0389870 3300046660 Bacteria 872
305 Ga0495635_0003891 3300046663 Bacteria 10376
306 Ga0495657_0012111 3300046675 Bacteria 6418
307 Ga0495624_0043274 3300046690 Bacteria 2873
308 Ga0495671_0309577 3300046692 Bacteria 759
309 Ga0495589_0210396 3300046794 Bacteria 916
310 Ga0495600_0006748 3300046809 Bacteria 6996
311 Ga0495604_0062128 3300047317 Bacteria 2855
312 Ga0495676_0076376 3300047321 Bacteria 2558
313 Ga0495683_0057977 3300047323 Bacteria 1924
314 Ga0495683_0115991 3300047323 Bacteria 1275
315 Ga0495687_041587 3300047443 Bacteria 2015
316 Ga0495673_0030030 3300047469 Bacteria 2559
317 Ga0495686_0000082 3300047472 Bacteria 200115
318 Ga0495686_0000115 3300047472 Bacteria 166876
319 Ga0495626_0043928 3300048091 Bacteria 2095
320 Ga0496100_0381723 3300048903 Bacteria 1070
321 Ga0496101_0012616 3300048904 Bacteria 5643
322 Ga0496101_0159645 3300048904 Bacteria 1729
323 Ga0496102_0153244 3300048905 Bacteria 2166
324 Ga0496102_0195918 3300048905 Bacteria 1904
325 Ga0496104_0140344 3300048907 Bacteria 2321
326 Ga0496104_0195289 3300048907 Bacteria 1936
327 Ga0496104_0372072 3300048907 Bacteria 1341
328 Ga0496105_0001350 3300048908 Bacteria 17227
329 Ga0496105_0136364 3300048908 Bacteria 2022
330 Ga0496106_0015492 3300048909 Bacteria 5641
331 Ga0496106_0023403 3300048909 Bacteria 4589
332 Ga0496109_0396488 3300048912 Bacteria 1304
333 Ga0496111_0166994 3300048914 Bacteria 1635
334 Ga0496111_0243304 3300048914 Bacteria 1336
335 Ga0496111_0427029 3300048914 Bacteria 979
336 Ga0496112_0165784 3300048915 Bacteria 2175
337 Ga0496113_0149569 3300048916 Bacteria 1841
338 Ga0496116_0070663 3300048919 Bacteria 2214
339 Ga0496116_0085461 3300048919 Bacteria 1939
340 Ga0496116_0102306 3300048919 Bacteria 1708
341 Ga0496116_0109707 3300048919 Bacteria 1626
342 Ga0496117_0007273 3300048920 Bacteria 10879
343 Ga0496117_0130036 3300048920 Bacteria 1528
344 Ga0496118_0008990 3300048921 Bacteria 10191
345 Ga0496118_0010965 3300048921 Bacteria 8906
346 Ga0496118_0168112 3300048921 Bacteria 1344
347 Ga0496119_0004102 3300048922 Bacteria 14685
348 Ga0496119_0018244 3300048922 Bacteria 5238
349 Ga0496119_0039200 3300048922 Bacteria 3047
350 Ga0496119_0046340 3300048922 Bacteria 2716
351 Ga0496119_0057536 3300048922 Bacteria 2349
352 Ga0496120_0014557 3300048923 Bacteria 5236
353 Ga0496120_0056098 3300048923 Bacteria 2225
354 Ga0496121_0000022 3300048924 Bacteria 472849
355 Ga0496121_0000523 3300048924 Bacteria 73281
356 Ga0496121_0021639 3300048924 Bacteria 6288
357 Ga0496121_0027976 3300048924 Bacteria 5263
358 Ga0496121_0037444 3300048924 Bacteria 4308
359 Ga0496121_0049552 3300048924 Bacteria 3560
360 Ga0496121_0059791 3300048924 Bacteria 3140
361 Ga0496121_0095254 3300048924 Bacteria 2314
362 Ga0496121_0156446 3300048924 Bacteria 1672
363 Ga0496122_0004397 3300048925 Bacteria 17546
364 Ga0496123_0004520 3300048926 Bacteria 14540
365 Ga0496124_0076382 3300048927 Bacteria 2765
366 Ga0496125_0006913 3300048928 Bacteria 12147
367 Ga0496125_0199253 3300048928 Bacteria 1313
368 Ga0496126_0006108 3300048929 Bacteria 13507
369 Ga0496126_0073507 3300048929 Bacteria 3039
370 Ga0496126_0230731 3300048929 Bacteria 1551
371 Ga0496126_0374000 3300048929 Bacteria 1161
372 Ga0501036_0180150 3300049572 Bacteria 1779
373 Ga0501043_0003245 3300049579 Bacteria 13416
374 Ga0501047_0000197 3300049581 Bacteria 72751
375 Ga0501048_0106838 3300049582 Bacteria 1976
376 Ga0501035_0069454 3300049822 Bacteria 3123
377 Ga0501044_0090088 3300049823 Bacteria 3095
378 nmdc:mga03n38_207978_c1 3300050490 Bacteria 1016
379 nmdc:mga00v17_64043_c1 3300050491 Bacteria 2265
380 nmdc:mga0yw44_150308_c1 3300050492 Bacteria 1519
381 nmdc:mga0yw44_5700_c1 3300050492 Bacteria 5929
382 nmdc:mga0k408_42731_c1 3300050493 Bacteria 2610
383 nmdc:mga06z11_510122_c1 3300050494 Bacteria 729
384 nmdc:mga07m45_91103_c1 3300050496 Bacteria 1747
385 nmdc:mga08y16_51_c1 3300050511 Bacteria 105348
386 nmdc:mga0sz30_179745_c1 3300050516 Bacteria 939
387 Ga0500635_0011635 3300053080 Bacteria 2507
388 Ga0495655_0031192 3300053083 Bacteria 1295
389 Ga0500566_0000029 3300053094 Bacteria 75384
390 Ga0500566_0090729 3300053094 Bacteria 1689
391 Ga0500640_045153 3300053095 Bacteria 1933
392 Ga0500650_0132226 3300053098 Bacteria 1160
393 Ga0500569_003041 3300053109 Bacteria 3377
394 Ga0500572_002243 3300053111 Bacteria 4717
395 Ga0500595_018539 3300053119 Bacteria 2543
396 Ga0500608_250672 3300053122 Bacteria 691
397 Ga0500655_018796 3300053133 Bacteria 1284
398 Ga0500559_0027379 3300053136 Bacteria 2433
399 Ga0500564_016690 3300053138 Bacteria 3328
400 Ga0500568_0045969 3300053139 Bacteria 1735
401 Ga0500590_215444 3300053148 Bacteria 797
402 Ga0500620_006890 3300053155 Bacteria 2765
403 Ga0500622_0002004 3300053156 Bacteria 15220
404 Ga0500638_027971 3300053162 Bacteria 2708
405 Ga0500636_0000420 3300053177 Bacteria 23339
406 Ga0500645_000065 3300053730 Bacteria 82414
407 Ga0500601_000525 3300053737 Bacteria 5772
408 Ga0500661_003363 3300055283 Bacteria 3009
409 Ga0500661_010036 3300055283 Bacteria 1726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_0087656 Ga0436361_0087656_10_627 186
2 iso_pu_bacteria 2874612657 2874617378 186
3 3300009092 Ga0105250_10200063 Ga0105250_102000632 187
4 3300046491 Ga0495584_0316806 Ga0495584_0316806_112_741 188
5 3300046522 Ga0495643_0053328 Ga0495643_0053328_1518_2147 188
6 3300046524 Ga0495648_0288065 Ga0495648_0288065_16_645 188
7 3300046692 Ga0495671_0309577 Ga0495671_0309577_114_743 188
8 3300048903 Ga0496100_0381723 Ga0496100_0381723_404_1021 190
9 3300053122 Ga0500608_250672 Ga0500608_250672_47_664 190
10 3300053148 Ga0500590_215444 Ga0500590_215444_122_739 190
11 3300009176 Ga0105242_10975339 Ga0105242_109753392 195
12 3300046559 Ga0495667_0547230 Ga0495667_0547230_29_700 202
13 iso_pu_bacteria 2888378607 2888379191 203
14 3300050494 nmdc:mga06z11_510122_c1 nmdc:mga06z11_510122_c1_27_692 205
15 3300003322 rootL2_10077760 rootL2_100777602 209
16 3300025254 Ga0209148_1000501 Ga0209148_100050139 209
17 3300039447 Ga0436361_1192548 Ga0436361_1192548_1164_1850 209
18 iso_pu_bacteria 2765235802 2765469231 212
19 3300010159 Ga0099796_10000384 Ga0099796_100003843 213
20 3300039438 Ga0436360_0537233 Ga0436360_0537233_573_1307 213
21 3300021358 Ga0213873_10002417 Ga0213873_100024173 214
22 3300021361 Ga0213872_10020568 Ga0213872_100205683 214
23 3300039438 Ga0436360_0695279 Ga0436360_0695279_293_1027 214
24 3300039447 Ga0436361_0176654 Ga0436361_0176654_2308_3042 214
25 3300039453 Ga0436362_0775664 Ga0436362_0775664_824_1558 214
26 iso_pu_bacteria 8016511872 8016516051 215
27 3300002987 JGI25159J45721_1000678 JGI25159J45721_100067814 216
28 3300003354 JGI25160J50197_1001701 JGI25160J50197_10017016 216
29 3300003374 JGI25161J50226_1000905 JGI25161J50226_10009056 216
30 3300004625 Ga0055543_1000079 Ga0055543_10000796 216
31 3300005262 Ga0065165_1002903 Ga0065165_10029039 216
32 3300010375 Ga0105239_10500869 Ga0105239_105008692 216
33 3300025284 Ga0209130_1000219 Ga0209130_10002194 216
34 3300025302 Ga0207426_1000075 Ga0207426_1000075210 216
35 3300046460 Ga0495638_0000019 Ga0495638_0000019_217651_218379 216
36 3300046507 Ga0495606_0055014 Ga0495606_0055014_714_1430 216
37 3300048919 Ga0496116_0109707 Ga0496116_0109707_844_1560 216
38 3300048922 Ga0496119_0046340 Ga0496119_0046340_473_1189 216
39 3300048924 Ga0496121_0095254 Ga0496121_0095254_624_1340 216
40 3300048928 Ga0496125_0199253 Ga0496125_0199253_143_859 216
41 3300031250 Ga0265331_10178578 Ga0265331_101785782 217
42 iso_pu_bacteria 2808606384 2808970253 217
43 iso_pu_bacteria 2808606390 2809004901 217
44 iso_pu_bacteria 2808606391 2809011959 217
45 3300005347 Ga0070668_100746361 Ga0070668_1007463611 218
46 iso_pu_bacteria 2842698319 2842700627 218
47 iso_pu_bacteria 3005594810 3005595762 218
48 iso_pu_bacteria 2513237104 2513721373 219
49 iso_pu_bacteria 2515154112 2515630076 219
50 iso_pu_bacteria 2519103095 2519458398 219
51 iso_pu_bacteria 2524023205 2524441256 219
52 iso_pu_bacteria 2524023228 2524539455 219
53 iso_pu_bacteria 2545555834 2545672620 219
54 iso_pu_bacteria 2582581311 2585292781 219
55 iso_pu_bacteria 2599185239 2599738274 219
56 iso_pu_bacteria 2599185240 2599742366 219
57 iso_pu_bacteria 2599185355 2600204484 219
58 iso_pu_bacteria 2615840698 2616555366 219
59 iso_pu_bacteria 2617270742 2617382440 219
60 iso_pu_bacteria 2675903129 2676741469 219
61 iso_pu_bacteria 2816332253 2817260593 219
62 iso_pu_bacteria 2816332256 2817278234 219
63 iso_pu_bacteria 2816332286 2817452531 219
64 iso_pu_bacteria 2818991448 2819608139 219
65 iso_pu_bacteria 2818991452 2819633098 219
66 iso_pu_bacteria 2824773399 2824777822 219
67 iso_pu_bacteria 2841949485 2841954920 219
68 iso_pu_bacteria 2841974524 2841980358 219
69 iso_pu_bacteria 2841983080 2841988524 219
70 iso_pu_bacteria 2861691609 2861693026 219
71 iso_pu_bacteria 2863421361 2863422111 219
72 iso_pu_bacteria 2874102143 2874106565 219
73 iso_pu_bacteria 2904699407 2904707000 219
74 iso_pu_bacteria 2928157003 2928159320 219
75 iso_pu_bacteria 2928163908 2928164620 219
76 iso_pu_bacteria 2928170801 2928176553 219
77 iso_pu_bacteria 2935975950 2935981820 219
78 iso_pu_bacteria 2958092219 2958094601 219
79 iso_pu_bacteria 2981990288 2981993743 219
80 iso_pu_bacteria 3005416602 3005420926 219
81 iso_pu_bacteria 641522639 641646936 219
82 iso_pu_bacteria 643348564 643600842 219
83 iso_pu_bacteria 8005314921 8005319339 219
84 iso_pu_bacteria 8005484373 8005487797 219
85 iso_pu_bacteria 8005645114 8005650283 219
86 iso_pu_bacteria 8005682033 8005685753 219
87 iso_pu_bacteria 8006933436 8006934782 219
88 iso_pu_bacteria 8006973647 8006974750 219
89 iso_pu_bacteria 8018845410 8018850586 219
90 iso_pu_bacteria 8019619141 8019620985 219
91 iso_pu_bacteria 8019629233 8019629576 219
92 iso_pu_bacteria 8019638758 8019648778 219
93 iso_pu_bacteria 8019659431 8019659784 219
94 iso_pu_bacteria 8019668869 8019669164 219
95 iso_pu_bacteria 8019678201 8019678236 219
96 iso_pu_bacteria 8020807995 8020808319 219
97 iso_pu_bacteria 8020938398 8020944496 219
98 iso_pu_bacteria 8020945358 8020947036 219
99 iso_pu_bacteria 8020953355 8020960065 219
100 iso_pu_bacteria 8021120328 8021122999 219
101 iso_pu_bacteria 8039098773 8039104180 219
102 iso_pu_bacteria 8040167225 8040172603 219
103 iso_pu_bacteria 8040173305 8040175170 219
104 3300009094 Ga0111539_10000323 Ga0111539_1000032338 220
105 3300021361 Ga0213872_10003532 Ga0213872_100035324 220
106 3300021361 Ga0213872_10024949 Ga0213872_100249494 220
107 3300021361 Ga0213872_10025083 Ga0213872_100250834 220
108 3300021361 Ga0213872_10057011 Ga0213872_100570113 220
109 3300027907 Ga0207428_10000129 Ga0207428_1000012939 220
110 3300039447 Ga0436361_0267995 Ga0436361_0267995_6202_6924 220
111 3300039447 Ga0436361_0357323 Ga0436361_0357323_101_823 220
112 3300039447 Ga0436361_0362812 Ga0436361_0362812_170_892 220
113 3300039447 Ga0436361_0372030 Ga0436361_0372030_103_825 220
114 3300039447 Ga0436361_0993041 Ga0436361_0993041_304_1026 220
115 3300050511 nmdc:mga08y16_51_c1 nmdc:mga08y16_51_c1_53886_54605 220
116 iso_pu_bacteria 2508501042 2508693071 220
117 iso_pu_bacteria 2508501128 2509149467 220
118 iso_pu_bacteria 2513237095 2513649324 220
119 iso_pu_bacteria 2528768022 2528851738 220
120 iso_pu_bacteria 2667528175 2671118198 220
121 iso_pu_bacteria 2744054633 2745082190 220
122 iso_pu_bacteria 2816332527 2818240714 220
123 iso_pu_bacteria 2824661429 2824668184 220
124 iso_pu_bacteria 2874590934 2874594163 220
125 iso_pu_bacteria 2874645413 2874651935 220
126 iso_pu_bacteria 2876771140 2876773609 220
127 iso_pu_bacteria 2876818435 2876824763 220
128 iso_pu_bacteria 2879074833 2879081490 220
129 iso_pu_bacteria 2879099564 2879105198 220
130 iso_pu_bacteria 2888378607 2888380318 220
131 iso_pu_bacteria 2919100787 2919102418 220
132 iso_pu_bacteria 2922368715 2922371705 220
133 iso_pu_bacteria 2932784394 2932790662 220
134 iso_pu_bacteria 2932809354 2932811859 220
135 iso_pu_bacteria 2932818245 2932822655 220
136 iso_pu_bacteria 2932828146 2932835559 220
137 iso_pu_bacteria 2935616580 2935624713 220
138 iso_pu_bacteria 2935638405 2935646156 220
139 iso_pu_bacteria 2935665750 2935670725 220
140 iso_pu_bacteria 2935675223 2935679536 220
141 iso_pu_bacteria 2935675223 2935683579 220
142 iso_pu_bacteria 2935684952 2935691448 220
143 iso_pu_bacteria 2935684952 2935693456 220
144 iso_pu_bacteria 2935694250 2935701905 220
145 iso_pu_bacteria 2935703347 2935704520 220
146 iso_pu_bacteria 2935713505 2935719282 220
147 iso_pu_bacteria 2935713505 2935721646 220
148 iso_pu_bacteria 2935722832 2935729118 220
149 iso_pu_bacteria 2935722832 2935731024 220
150 iso_pu_bacteria 2935732158 2935737641 220
151 iso_pu_bacteria 2935732158 2935740785 220
152 iso_pu_bacteria 2935741537 2935747017 220
153 iso_pu_bacteria 2935741537 2935750049 220
154 iso_pu_bacteria 2935750917 2935758183 220
155 iso_pu_bacteria 2935750917 2935759439 220
156 iso_pu_bacteria 2935760218 2935768860 220
157 iso_pu_bacteria 2935760218 2935769223 220
158 iso_pu_bacteria 2935801545 2935809152 220
159 iso_pu_bacteria 2935810662 2935816494 220
160 iso_pu_bacteria 2935827899 2935835466 220
161 iso_pu_bacteria 2935837841 2935845770 220
162 iso_pu_bacteria 2935855204 2935863374 220
163 iso_pu_bacteria 2935864058 2935871452 220
164 iso_pu_bacteria 2935873716 2935881701 220
165 iso_pu_bacteria 2935992306 2935993879 220
166 iso_pu_bacteria 2936002035 2936009695 220
167 iso_pu_bacteria 2936037263 2936042554 220
168 iso_pu_bacteria 2940556831 2940563906 220
169 iso_pu_bacteria 2940556831 2940565343 220
170 iso_pu_bacteria 2941538514 2941545944 220
171 iso_pu_bacteria 8017057580 8017060465 220
172 iso_pu_bacteria 8019576017 8019579941 220
173 iso_pu_bacteria 8019586578 8019587653 220
174 iso_pu_bacteria 8019597564 8019603675 220
175 iso_pu_bacteria 8019608314 8019614852 220
176 3300045976 Ga0466967_0306456 Ga0466967_0306456_371_1087 221
177 iso_pu_bacteria 2513237102 2513702772 221
178 iso_pu_bacteria 2517093001 2517101011 221
179 iso_pu_bacteria 2524023210 2524464657 221
180 iso_pu_bacteria 2643221595 2643983745 221
181 iso_pu_bacteria 2643221627 2644155878 221
182 iso_pu_bacteria 2643221643 2644238046 221
183 iso_pu_bacteria 2816332527 2818239176 221
184 iso_pu_bacteria 2821443989 2821447278 221
185 iso_pu_bacteria 2824617872 2824620244 221
186 iso_pu_bacteria 2824626560 2824629509 221
187 iso_pu_bacteria 2824635225 2824635829 221
188 iso_pu_bacteria 2824644064 2824646131 221
189 iso_pu_bacteria 2824714736 2824716671 221
190 iso_pu_bacteria 2824723954 2824726628 221
191 iso_pu_bacteria 2842205361 2842211411 221
192 iso_pu_bacteria 2842278818 2842284866 221
193 iso_pu_bacteria 2844533157 2844533325 221
194 iso_pu_bacteria 2881161766 2881167253 221
195 iso_pu_bacteria 2919073203 2919077109 221
196 iso_pu_bacteria 2923556063 2923559078 221
197 iso_pu_bacteria 2935648319 2935650315 221
198 iso_pu_bacteria 2935656913 2935658462 221
199 iso_pu_bacteria 2935769743 2935776873 221
200 iso_pu_bacteria 2935777560 2935778335 221
201 iso_pu_bacteria 2935785616 2935792869 221
202 iso_pu_bacteria 2935793552 2935800989 221
203 iso_pu_bacteria 2936011229 2936013126 221
204 iso_pu_bacteria 2936019824 2936021787 221
205 iso_pu_bacteria 2936028420 2936030419 221
206 iso_pu_bacteria 2936046547 2936047981 221
207 iso_pu_bacteria 8016522445 8016529829 221
208 iso_pu_bacteria 8016530956 8016535063 221
209 iso_pu_bacteria 8016539877 8016548269 221
210 iso_pu_bacteria 8016548790 8016553856 221
211 iso_pu_bacteria 8016557553 8016562231 221
212 iso_pu_bacteria 8016566248 8016573406 221
213 iso_pu_bacteria 8016575299 8016577538 221
214 iso_pu_bacteria 8016595262 8016600047 221
215 iso_pu_bacteria 8016603502 8016610715 221
216 iso_pu_bacteria 8016613128 8016614215 221
217 iso_pu_bacteria 8016622563 8016626769 221
218 iso_pu_bacteria 8019530166 8019534818 221
219 iso_pu_bacteria 8019538911 8019544657 221
220 iso_pu_bacteria 8019547302 8019553880 221
221 3300009174 Ga0105241_10087414 Ga0105241_100874143 222
222 3300010375 Ga0105239_10129037 Ga0105239_101290374 222
223 3300048924 Ga0496121_0000523 Ga0496121_0000523_54387_55109 222
224 3300003320 rootH2_10005012 rootH2_100050124 223
225 3300003322 rootL2_10006749 rootL2_1000674910 223
226 3300003323 rootH1_10109858 rootH1_101098585 223
227 3300003323 rootH1_10164832 rootH1_101648321 223
228 3300003323 rootH1_10164833 rootH1_101648332 223
229 3300003758 Ga0055532_1000954 Ga0055532_100095410 223
230 3300003760 Ga0055527_1000519 Ga0055527_100051910 223
231 3300003761 Ga0055535_1001606 Ga0055535_10016064 223
232 3300003761 Ga0055535_1001639 Ga0055535_10016394 223
233 3300003762 Ga0055542_1001602 Ga0055542_10016024 223
234 3300003762 Ga0055542_1004740 Ga0055542_10047401 223
235 3300003763 Ga0055529_1001193 Ga0055529_10011934 223
236 3300003790 Ga0055528_1005415 Ga0055528_10054153 223
237 3300003856 Ga0058692_1016950 Ga0058692_10169502 223
238 3300005339 Ga0070660_100000028 Ga0070660_10000002867 223
239 3300005344 Ga0070661_100042078 Ga0070661_1000420784 223
240 3300005366 Ga0070659_100000230 Ga0070659_10000023031 223
241 3300005455 Ga0070663_100003063 Ga0070663_1000030632 223
242 3300005563 Ga0068855_100177750 Ga0068855_1001777503 223
243 3300005564 Ga0070664_100141871 Ga0070664_1001418712 223
244 3300005614 Ga0068856_101010871 Ga0068856_1010108711 223
245 3300005616 Ga0068852_100029923 Ga0068852_1000299233 223
246 3300009093 Ga0105240_10014261 Ga0105240_100142614 223
247 3300009093 Ga0105240_10070943 Ga0105240_100709434 223
248 3300009148 Ga0105243_10164959 Ga0105243_101649592 223
249 3300009545 Ga0105237_10004870 Ga0105237_1000487016 223
250 3300009545 Ga0105237_10018112 Ga0105237_100181128 223
251 3300009545 Ga0105237_10395808 Ga0105237_103958082 223
252 3300009545 Ga0105237_10530513 Ga0105237_105305132 223
253 3300009551 Ga0105238_10025999 Ga0105238_100259994 223
254 3300025225 Ga0209566_100904 Ga0209566_10090415 223
255 3300025228 Ga0209672_100019 Ga0209672_100019174 223
256 3300025228 Ga0209672_100069 Ga0209672_100069139 223
257 3300025229 Ga0209147_100026 Ga0209147_100026174 223
258 3300025229 Ga0209147_100044 Ga0209147_100044128 223
259 3300025229 Ga0209147_100128 Ga0209147_10012896 223
260 3300025242 Ga0209258_100031 Ga0209258_100031207 223
261 3300025242 Ga0209258_100079 Ga0209258_10007962 223
262 3300025254 Ga0209148_1000027 Ga0209148_1000027207 223
263 3300025254 Ga0209148_1000474 Ga0209148_100047423 223
264 3300025254 Ga0209148_1001447 Ga0209148_100144710 223
265 3300025261 Ga0209233_1008059 Ga0209233_10080594 223
266 3300025263 Ga0209565_1018425 Ga0209565_10184251 223
267 3300025272 Ga0209455_1000058 Ga0209455_1000058165 223
268 3300025272 Ga0209455_1001131 Ga0209455_10011316 223
269 3300025272 Ga0209455_1011491 Ga0209455_10114914 223
270 3300025273 Ga0209673_1000059 Ga0209673_1000059145 223
271 3300025297 Ga0209758_1000993 Ga0209758_100099320 223
272 3300025904 Ga0207647_10051781 Ga0207647_100517813 223
273 3300025909 Ga0207705_10078506 Ga0207705_100785062 223
274 3300025913 Ga0207695_10003507 Ga0207695_100035074 223
275 3300025913 Ga0207695_10071449 Ga0207695_100714492 223
276 3300025914 Ga0207671_10022161 Ga0207671_100221614 223
277 3300025914 Ga0207671_10141456 Ga0207671_101414562 223
278 3300025919 Ga0207657_10000001 Ga0207657_10000001168 223
279 3300025924 Ga0207694_10080842 Ga0207694_100808422 223
280 3300025932 Ga0207690_10000072 Ga0207690_1000007256 223
281 3300026041 Ga0207639_10326389 Ga0207639_103263892 223
282 3300026067 Ga0207678_10001112 Ga0207678_1000111219 223
283 3300026078 Ga0207702_10979875 Ga0207702_109798751 223
284 3300027312 Ga0209371_1000243 Ga0209371_100024338 223
285 3300027312 Ga0209371_1002714 Ga0209371_10027144 223
286 3300030500 Ga0268256_1000311 Ga0268256_100031121 223
287 3300039437 Ga0436365_1822309 Ga0436365_1822309_357_1064 223
288 3300044658 Ga0466972_0014613 Ga0466972_0014613_3166_3903 223
289 3300044658 Ga0466972_0016624 Ga0466972_0016624_2088_2816 223
290 3300044693 Ga0466961_0122803 Ga0466961_0122803_689_1417 223
291 3300044735 Ga0466968_0002924 Ga0466968_0002924_2689_3426 223
292 3300044735 Ga0466968_0217313 Ga0466968_0217313_46_774 223
293 3300044901 Ga0466960_0000523 Ga0466960_0000523_4500_5237 223
294 3300046459 Ga0495629_0030964 Ga0495629_0030964_2138_2875 223
295 3300046516 Ga0495628_0189255 Ga0495628_0189255_204_941 223
296 3300046533 Ga0495640_0100321 Ga0495640_0100321_204_941 223
297 3300046557 Ga0495622_0078556 Ga0495622_0078556_70_807 223
298 3300046642 Ga0495634_0064965 Ga0495634_0064965_852_1589 223
299 3300046663 Ga0495635_0003891 Ga0495635_0003891_8879_9616 223
300 3300046675 Ga0495657_0012111 Ga0495657_0012111_5651_6388 223
301 3300046690 Ga0495624_0043274 Ga0495624_0043274_559_1296 223
302 3300046809 Ga0495600_0006748 Ga0495600_0006748_5811_6548 223
303 3300047321 Ga0495676_0076376 Ga0495676_0076376_459_1196 223
304 3300047469 Ga0495673_0030030 Ga0495673_0030030_789_1511 223
305 3300047472 Ga0495686_0000082 Ga0495686_0000082_63368_64090 223
306 3300048905 Ga0496102_0195918 Ga0496102_0195918_745_1488 223
307 3300048907 Ga0496104_0140344 Ga0496104_0140344_106_843 223
308 3300048908 Ga0496105_0001350 Ga0496105_0001350_15028_15765 223
309 3300048914 Ga0496111_0427029 Ga0496111_0427029_147_884 223
310 3300048916 Ga0496113_0149569 Ga0496113_0149569_43_780 223
311 3300048920 Ga0496117_0007273 Ga0496117_0007273_342_1064 223
312 3300048921 Ga0496118_0010965 Ga0496118_0010965_5265_5987 223
313 3300048922 Ga0496119_0039200 Ga0496119_0039200_364_1101 223
314 3300048923 Ga0496120_0014557 Ga0496120_0014557_492_1229 223
315 3300048924 Ga0496121_0000022 Ga0496121_0000022_289909_290625 223
316 3300048924 Ga0496121_0059791 Ga0496121_0059791_590_1333 223
317 3300048929 Ga0496126_0374000 Ga0496126_0374000_223_966 223
318 3300049572 Ga0501036_0180150 Ga0501036_0180150_708_1430 223
319 3300049579 Ga0501043_0003245 Ga0501043_0003245_3017_3739 223
320 3300049581 Ga0501047_0000197 Ga0501047_0000197_26167_26889 223
321 3300049582 Ga0501048_0106838 Ga0501048_0106838_1096_1818 223
322 3300049822 Ga0501035_0069454 Ga0501035_0069454_54_776 223
323 3300049823 Ga0501044_0090088 Ga0501044_0090088_631_1353 223
324 3300053136 Ga0500559_0027379 Ga0500559_0027379_901_1638 223
325 3300003215 JGI25153J46596_10018033 JGI25153J46596_100180334 224
326 3300005331 Ga0070670_100318602 Ga0070670_1003186022 224
327 3300005335 Ga0070666_10112887 Ga0070666_101128872 224
328 3300005347 Ga0070668_100015221 Ga0070668_1000152214 224
329 3300005347 Ga0070668_100179605 Ga0070668_1001796052 224
330 3300005434 Ga0070709_10001293 Ga0070709_100012933 224
331 3300005435 Ga0070714_100045562 Ga0070714_1000455624 224
332 3300005436 Ga0070713_100009193 Ga0070713_1000091935 224
333 3300005437 Ga0070710_10000282 Ga0070710_1000028211 224
334 3300005439 Ga0070711_100014925 Ga0070711_1000149256 224
335 3300005455 Ga0070663_100023282 Ga0070663_1000232823 224
336 3300005457 Ga0070662_100058201 Ga0070662_1000582013 224
337 3300005548 Ga0070665_100097993 Ga0070665_1000979932 224
338 3300005563 Ga0068855_100310437 Ga0068855_1003104372 224
339 3300005614 Ga0068856_100327522 Ga0068856_1003275221 224
340 3300005617 Ga0068859_100318350 Ga0068859_1003183502 224
341 3300005842 Ga0068858_100319541 Ga0068858_1003195411 224
342 3300005843 Ga0068860_100243394 Ga0068860_1002433943 224
343 3300006028 Ga0070717_10271883 Ga0070717_102718832 224
344 3300006048 Ga0075363_100063664 Ga0075363_1000636641 224
345 3300006051 Ga0075364_10020082 Ga0075364_100200824 224
346 3300006175 Ga0070712_100005683 Ga0070712_1000056834 224
347 3300006177 Ga0075362_10129195 Ga0075362_101291952 224
348 3300006178 Ga0075367_10185266 Ga0075367_101852662 224
349 3300006195 Ga0075366_10021738 Ga0075366_100217382 224
350 3300006353 Ga0075370_10006671 Ga0075370_100066717 224
351 3300006931 Ga0097620_100318339 Ga0097620_1003183392 224
352 3300009092 Ga0105250_10092105 Ga0105250_100921052 224
353 3300009093 Ga0105240_10001146 Ga0105240_1000114610 224
354 3300009101 Ga0105247_10014641 Ga0105247_100146414 224
355 3300009174 Ga0105241_10065423 Ga0105241_100654234 224
356 3300009177 Ga0105248_10079304 Ga0105248_100793042 224
357 3300009545 Ga0105237_10001621 Ga0105237_1000162125 224
358 3300009545 Ga0105237_10016195 Ga0105237_100161952 224
359 3300009551 Ga0105238_10075985 Ga0105238_100759853 224
360 3300009551 Ga0105238_10503897 Ga0105238_105038972 224
361 3300010375 Ga0105239_10174566 Ga0105239_101745662 224
362 3300011119 Ga0105246_10072109 Ga0105246_100721093 224
363 3300013306 Ga0163162_10010810 Ga0163162_100108102 224
364 3300013308 Ga0157375_10416230 Ga0157375_104162302 224
365 3300021384 Ga0213876_10150635 Ga0213876_101506351 224
366 3300025258 Ga0209129_1006000 Ga0209129_10060004 224
367 3300025297 Ga0209758_1007575 Ga0209758_10075753 224
368 3300025299 Ga0209256_1037569 Ga0209256_10375692 224
369 3300025303 Ga0209051_1061830 Ga0209051_10618302 224
370 3300025304 Ga0209257_1051176 Ga0209257_10511762 224
371 3300025898 Ga0207692_10120291 Ga0207692_101202912 224
372 3300025900 Ga0207710_10036840 Ga0207710_100368403 224
373 3300025904 Ga0207647_10080733 Ga0207647_100807332 224
374 3300025911 Ga0207654_10119718 Ga0207654_101197182 224
375 3300025911 Ga0207654_10177692 Ga0207654_101776922 224
376 3300025913 Ga0207695_10000006 Ga0207695_10000006279 224
377 3300025914 Ga0207671_10013654 Ga0207671_100136544 224
378 3300025914 Ga0207671_10270888 Ga0207671_102708882 224
379 3300025915 Ga0207693_10008068 Ga0207693_100080683 224
380 3300025928 Ga0207700_10005940 Ga0207700_100059404 224
381 3300025929 Ga0207664_10008161 Ga0207664_100081616 224
382 3300025931 Ga0207644_10040268 Ga0207644_100402683 224
383 3300025933 Ga0207706_10141303 Ga0207706_101413033 224
384 3300025939 Ga0207665_10024914 Ga0207665_100249143 224
385 3300025941 Ga0207711_10145182 Ga0207711_101451823 224
386 3300025972 Ga0207668_10009192 Ga0207668_100091923 224
387 3300025972 Ga0207668_10280590 Ga0207668_102805902 224
388 3300025981 Ga0207640_10729532 Ga0207640_107295321 224
389 3300025986 Ga0207658_10468596 Ga0207658_104685962 224
390 3300026023 Ga0207677_10132213 Ga0207677_101322132 224
391 3300026035 Ga0207703_10056162 Ga0207703_100561623 224
392 3300026041 Ga0207639_10058139 Ga0207639_100581392 224
393 3300026067 Ga0207678_10012138 Ga0207678_100121388 224
394 3300026067 Ga0207678_10030234 Ga0207678_100302344 224
395 3300026116 Ga0207674_10046570 Ga0207674_100465704 224
396 3300026118 Ga0207675_100292014 Ga0207675_1002920142 224
397 3300028379 Ga0268266_10252816 Ga0268266_102528161 224
398 3300031730 Ga0307516_10000173 Ga0307516_1000017311 224
399 3300039437 Ga0436365_0265027 Ga0436365_0265027_623_1345 224
400 3300044765 Ga0466970_0169722 Ga0466970_0169722_84_824 224
401 3300045049 Ga0466959_0059664 Ga0466959_0059664_1101_1841 224
402 3300046457 Ga0495590_0049862 Ga0495590_0049862_396_1112 224
403 3300046474 Ga0495605_0081139 Ga0495605_0081139_108_848 224
404 3300046500 Ga0495596_0164548 Ga0495596_0164548_75_815 224
405 3300046507 Ga0495606_0017751 Ga0495606_0017751_4031_4771 224
406 3300046507 Ga0495606_0097475 Ga0495606_0097475_140_856 224
407 3300046512 Ga0495610_0068283 Ga0495610_0068283_370_1086 224
408 3300046513 Ga0495616_0102608 Ga0495616_0102608_539_1279 224
409 3300046516 Ga0495628_0267754 Ga0495628_0267754_404_1144 224
410 3300046522 Ga0495643_0015969 Ga0495643_0015969_3081_3797 224
411 3300046522 Ga0495643_0057175 Ga0495643_0057175_609_1349 224
412 3300046524 Ga0495648_0162125 Ga0495648_0162125_358_1098 224
413 3300046648 Ga0495611_0019278 Ga0495611_0019278_614_1354 224
414 3300046660 Ga0495625_0389870 Ga0495625_0389870_85_825 224
415 3300046794 Ga0495589_0210396 Ga0495589_0210396_147_887 224
416 3300047317 Ga0495604_0062128 Ga0495604_0062128_591_1331 224
417 3300047323 Ga0495683_0057977 Ga0495683_0057977_919_1659 224
418 3300047323 Ga0495683_0115991 Ga0495683_0115991_425_1165 224
419 3300047443 Ga0495687_041587 Ga0495687_041587_1069_1809 224
420 3300048091 Ga0495626_0043928 Ga0495626_0043928_1207_1923 224
421 3300048904 Ga0496101_0012616 Ga0496101_0012616_234_974 224
422 3300048904 Ga0496101_0159645 Ga0496101_0159645_674_1414 224
423 3300048905 Ga0496102_0153244 Ga0496102_0153244_1232_1972 224
424 3300048907 Ga0496104_0372072 Ga0496104_0372072_240_980 224
425 3300048908 Ga0496105_0136364 Ga0496105_0136364_674_1414 224
426 3300048909 Ga0496106_0015492 Ga0496106_0015492_4324_5064 224
427 3300048914 Ga0496111_0166994 Ga0496111_0166994_527_1267 224
428 3300048914 Ga0496111_0243304 Ga0496111_0243304_372_1112 224
429 3300048915 Ga0496112_0165784 Ga0496112_0165784_465_1205 224
430 3300048919 Ga0496116_0070663 Ga0496116_0070663_1177_1917 224
431 3300048919 Ga0496116_0102306 Ga0496116_0102306_474_1190 224
432 3300048920 Ga0496117_0130036 Ga0496117_0130036_792_1508 224
433 3300048921 Ga0496118_0008990 Ga0496118_0008990_7852_8592 224
434 3300048921 Ga0496118_0168112 Ga0496118_0168112_591_1313 224
435 3300048922 Ga0496119_0018244 Ga0496119_0018244_376_1116 224
436 3300048922 Ga0496119_0057536 Ga0496119_0057536_353_1075 224
437 3300048924 Ga0496121_0021639 Ga0496121_0021639_3844_4566 224
438 3300048924 Ga0496121_0027976 Ga0496121_0027976_3573_4313 224
439 3300048924 Ga0496121_0037444 Ga0496121_0037444_2205_2921 224
440 3300048924 Ga0496121_0049552 Ga0496121_0049552_1791_2531 224
441 3300048924 Ga0496121_0156446 Ga0496121_0156446_300_1025 224
442 3300048927 Ga0496124_0076382 Ga0496124_0076382_1583_2299 224
443 3300048928 Ga0496125_0006913 Ga0496125_0006913_8410_9126 224
444 3300048929 Ga0496126_0073507 Ga0496126_0073507_595_1335 224
445 3300050490 nmdc:mga03n38_207978_c1 nmdc:mga03n38_207978_c1_242_982 224
446 3300050491 nmdc:mga00v17_64043_c1 nmdc:mga00v17_64043_c1_396_1136 224
447 3300050492 nmdc:mga0yw44_150308_c1 nmdc:mga0yw44_150308_c1_170_910 224
448 3300050492 nmdc:mga0yw44_5700_c1 nmdc:mga0yw44_5700_c1_2816_3556 224
449 3300050493 nmdc:mga0k408_42731_c1 nmdc:mga0k408_42731_c1_377_1117 224
450 3300050496 nmdc:mga07m45_91103_c1 nmdc:mga07m45_91103_c1_121_861 224
451 3300050516 nmdc:mga0sz30_179745_c1 nmdc:mga0sz30_179745_c1_13_753 224
452 3300053080 Ga0500635_0011635 Ga0500635_0011635_1575_2294 224
453 3300053083 Ga0495655_0031192 Ga0495655_0031192_506_1246 224
454 3300053094 Ga0500566_0090729 Ga0500566_0090729_495_1214 224
455 3300053095 Ga0500640_045153 Ga0500640_045153_1078_1797 224
456 3300053098 Ga0500650_0132226 Ga0500650_0132226_260_979 224
457 3300053109 Ga0500569_003041 Ga0500569_003041_465_1184 224
458 3300053111 Ga0500572_002243 Ga0500572_002243_2318_3037 224
459 3300053119 Ga0500595_018539 Ga0500595_018539_142_861 224
460 3300053133 Ga0500655_018796 Ga0500655_018796_327_1046 224
461 3300053138 Ga0500564_016690 Ga0500564_016690_1316_2035 224
462 3300053155 Ga0500620_006890 Ga0500620_006890_1849_2568 224
463 3300053156 Ga0500622_0002004 Ga0500622_0002004_6711_7427 224
464 3300053162 Ga0500638_027971 Ga0500638_027971_862_1581 224
465 3300053177 Ga0500636_0000420 Ga0500636_0000420_8515_9234 224
466 3300053737 Ga0500601_000525 Ga0500601_000525_1535_2254 224
467 3300055283 Ga0500661_003363 Ga0500661_003363_1834_2574 224
468 3300055283 Ga0500661_010036 Ga0500661_010036_483_1202 224
469 3300002739 JGI25158J39367_1000838 JGI25158J39367_10008386 225
470 3300002773 JGI25152J39213_1007085 JGI25152J39213_10070852 225
471 3300002987 JGI25159J45721_1002059 JGI25159J45721_10020594 225
472 3300003215 JGI25153J46596_10000288 JGI25153J46596_100002889 225
473 3300003215 JGI25153J46596_10001586 JGI25153J46596_1000158610 225
474 3300003215 JGI25153J46596_10041756 JGI25153J46596_100417561 225
475 3300003354 JGI25160J50197_1000413 JGI25160J50197_100041310 225
476 3300003354 JGI25160J50197_1022434 JGI25160J50197_10224342 225
477 3300003374 JGI25161J50226_1000567 JGI25161J50226_10005676 225
478 3300003374 JGI25161J50226_1000572 JGI25161J50226_10005726 225
479 3300003775 Ga0055524_1007133 Ga0055524_10071332 225
480 3300003790 Ga0055528_1001484 Ga0055528_100148411 225
481 3300003792 Ga0055540_1002714 Ga0055540_10027143 225
482 3300004625 Ga0055543_1000116 Ga0055543_100011644 225
483 3300004625 Ga0055543_1002291 Ga0055543_10022915 225
484 3300005262 Ga0065165_1036443 Ga0065165_10364431 225
485 3300005331 Ga0070670_100009469 Ga0070670_1000094691 225
486 3300005335 Ga0070666_10033261 Ga0070666_100332613 225
487 3300005344 Ga0070661_100070332 Ga0070661_1000703323 225
488 3300005434 Ga0070709_10026169 Ga0070709_100261693 225
489 3300005437 Ga0070710_10231800 Ga0070710_102318002 225
490 3300005439 Ga0070711_100134613 Ga0070711_1001346132 225
491 3300005445 Ga0070708_100284339 Ga0070708_1002843392 225
492 3300005457 Ga0070662_100007492 Ga0070662_1000074925 225
493 3300005548 Ga0070665_100000465 Ga0070665_10000046539 225
494 3300005548 Ga0070665_100003470 Ga0070665_1000034706 225
495 3300005834 Ga0068851_10002327 Ga0068851_100023272 225
496 3300005841 Ga0068863_100299783 Ga0068863_1002997832 225
497 3300005842 Ga0068858_100013390 Ga0068858_1000133904 225
498 3300005844 Ga0068862_100107747 Ga0068862_1001077471 225
499 3300005983 Ga0081540_1009036 Ga0081540_10090362 225
500 3300005983 Ga0081540_1018480 Ga0081540_10184805 225
501 3300006881 Ga0068865_100311329 Ga0068865_1003113292 225
502 3300007265 Ga0099794_10013003 Ga0099794_100130034 225
503 3300009093 Ga0105240_10042503 Ga0105240_100425036 225
504 3300009093 Ga0105240_10457071 Ga0105240_104570712 225
505 3300009174 Ga0105241_10074884 Ga0105241_100748844 225
506 3300009545 Ga0105237_10115232 Ga0105237_101152324 225
507 3300009545 Ga0105237_10213030 Ga0105237_102130303 225
508 3300009553 Ga0105249_10007619 Ga0105249_1000761910 225
509 3300010375 Ga0105239_10045380 Ga0105239_100453802 225
510 3300010375 Ga0105239_10078794 Ga0105239_100787944 225
511 3300010375 Ga0105239_11372141 Ga0105239_113721411 225
512 3300013297 Ga0157378_10807274 Ga0157378_108072742 225
513 3300014325 Ga0163163_10956599 Ga0163163_109565992 225
514 3300014497 Ga0182008_10000113 Ga0182008_1000011317 225
515 3300015262 Ga0182007_10000213 Ga0182007_1000021317 225
516 3300021361 Ga0213872_10018759 Ga0213872_100187592 225
517 3300025208 Ga0209436_100066 Ga0209436_10006625 225
518 3300025273 Ga0209673_1001545 Ga0209673_100154512 225
519 3300025284 Ga0209130_1000022 Ga0209130_100002261 225
520 3300025295 Ga0209564_1000475 Ga0209564_100047548 225
521 3300025299 Ga0209256_1044624 Ga0209256_10446242 225
522 3300025302 Ga0207426_1000005 Ga0207426_1000005185 225
523 3300025321 Ga0207656_10005520 Ga0207656_100055204 225
524 3300025903 Ga0207680_10023242 Ga0207680_100232423 225
525 3300025904 Ga0207647_10002100 Ga0207647_1000210013 225
526 3300025910 Ga0207684_10322804 Ga0207684_103228042 225
527 3300025911 Ga0207654_10067821 Ga0207654_100678212 225
528 3300025913 Ga0207695_10023432 Ga0207695_100234327 225
529 3300025913 Ga0207695_10089774 Ga0207695_100897744 225
530 3300025914 Ga0207671_10020670 Ga0207671_100206704 225
531 3300025915 Ga0207693_10036970 Ga0207693_100369704 225
532 3300025916 Ga0207663_10116032 Ga0207663_101160322 225
533 3300025924 Ga0207694_10097732 Ga0207694_100977323 225
534 3300025925 Ga0207650_10298737 Ga0207650_102987371 225
535 3300025933 Ga0207706_10001636 Ga0207706_1000163624 225
536 3300025949 Ga0207667_10673808 Ga0207667_106738081 225
537 3300025961 Ga0207712_10001146 Ga0207712_100011464 225
538 3300025986 Ga0207658_10017385 Ga0207658_100173854 225
539 3300026035 Ga0207703_10011514 Ga0207703_100115144 225
540 3300026041 Ga0207639_10004652 Ga0207639_100046522 225
541 3300026067 Ga0207678_10026489 Ga0207678_100264894 225
542 3300026078 Ga0207702_10130697 Ga0207702_101306973 225
543 3300026088 Ga0207641_10252675 Ga0207641_102526752 225
544 3300026089 Ga0207648_10331910 Ga0207648_103319101 225
545 3300026116 Ga0207674_10267551 Ga0207674_102675512 225
546 3300026142 Ga0207698_10187980 Ga0207698_101879801 225
547 3300028379 Ga0268266_10000006 Ga0268266_10000006989 225
548 3300031852 Ga0307410_10138330 Ga0307410_101383301 225
549 3300031995 Ga0307409_100042599 Ga0307409_1000425991 225
550 3300032004 Ga0307414_10515187 Ga0307414_105151872 225
551 3300035725 Ga0373947_0298456 Ga0373947_0298456_141_869 225
552 3300039438 Ga0436360_0722236 Ga0436360_0722236_159_884 225
553 3300039438 Ga0436360_1172287 Ga0436360_1172287_565_1290 225
554 3300039447 Ga0436361_0091426 Ga0436361_0091426_1787_2512 225
555 3300039447 Ga0436361_0472884 Ga0436361_0472884_61_786 225
556 3300039453 Ga0436362_1289511 Ga0436362_1289511_662_1387 225
557 3300041413 Ga0439465_0016516 Ga0439465_0016516_1320_2039 225
558 3300041452 Ga0451793_0280828 Ga0451793_0280828_2025_2759 225
559 3300041456 Ga0451795_0231223 Ga0451795_0231223_11_745 225
560 3300041494 Ga0451837_0701287 Ga0451837_0701287_179_901 225
561 3300041997 Ga0439431_0010234 Ga0439431_0010234_751_1491 225
562 3300041997 Ga0439431_0044809 Ga0439431_0044809_384_1124 225
563 3300046512 Ga0495610_0002011 Ga0495610_0002011_13438_14178 225
564 3300046616 Ga0495668_0128870 Ga0495668_0128870_80_805 225
565 3300047472 Ga0495686_0000115 Ga0495686_0000115_66485_67219 225
566 3300048907 Ga0496104_0195289 Ga0496104_0195289_579_1301 225
567 3300048909 Ga0496106_0023403 Ga0496106_0023403_3818_4543 225
568 3300048912 Ga0496109_0396488 Ga0496109_0396488_149_874 225
569 3300048919 Ga0496116_0085461 Ga0496116_0085461_1116_1883 225
570 3300048922 Ga0496119_0004102 Ga0496119_0004102_185_904 225
571 3300048923 Ga0496120_0056098 Ga0496120_0056098_846_1568 225
572 3300048925 Ga0496122_0004397 Ga0496122_0004397_2519_3250 225
573 3300048926 Ga0496123_0004520 Ga0496123_0004520_8719_9450 225
574 3300048929 Ga0496126_0006108 Ga0496126_0006108_10389_11156 225
575 3300048929 Ga0496126_0230731 Ga0496126_0230731_788_1507 225
576 3300053094 Ga0500566_0000029 Ga0500566_0000029_65648_66370 225
577 3300053139 Ga0500568_0045969 Ga0500568_0045969_793_1533 225
578 3300053730 Ga0500645_000065 Ga0500645_000065_51675_52400 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06833

MdcE

Malonate decarboxylase gamma subunit

46

251

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9i-assembly1.cif.gz_A crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.7908 1 208
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.7882 1 208
5kdr-assembly1.cif.gz_A-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.7845 1 202
4fb8-assembly1.cif.gz_B crystal structure of apo acyl-coa carboxylase 0.7799 7 140
5inf-assembly1.cif.gz_F structural basis for acyl-coa carboxylase-mediated assembly of unusual polyketide synthase extender units incorporated into the stambomycin antibiotics 0.7789 4 208
ID Description Score Start End Superfamily
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7843 1 202 3.90.226.10
af_P49158_165_424_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7815 22 201 3.90.226.10
5kdrB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.778 22 203 3.90.226.10
af_O53578_265_515_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7723 5 197 3.90.226.10
af_A4HUX0_281_535_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7681 1 201 3.90.226.10
ID Description Score Start End GO Terms
AF-F0G5D1-F1-model_v4 Malonate decarboxylase, gamma subunit 0.9457 1 124
AF-F0G5D1-F1-model_v4 Malonate decarboxylase, gamma subunit 0.9312 1 124
AF-A0A520HR39-F1-model_v4 Biotin-independent malonate decarboxylase subunit gamma 0.9307 1 146 GO:0016020
AF-A0A520HR39-F1-model_v4 Biotin-independent malonate decarboxylase subunit gamma 0.9246 1 146 GO:0016020
AF-A0A5E8TF07-F1-model_v4 deleted 0.9182 1 204

Feature Viewer

pLDDT pTM Quality
87.95 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map