F465747

General Info

Members Datasets Scaffolds Average Seq Length
578 246 1156 113

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0732789|Ga0395901_0732789_133_480
Length 115
Sequence MLVSILHRATGIAVSFAGLGMLTWWLFALSSGTDAYASFEAFIDWRAFHVPWVLIVLIAITWSFFQHLLSGIRHLVMDTGAGFELGINKTFAILTIVGSVLLTALMWFYLLGVRK

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
181 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
182 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
183 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
208 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
209 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
210 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
211 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
212 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
213 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
214 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
215 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
216 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
217 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
218 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
219 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
220 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
221 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
222 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
223 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
224 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
225 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
226 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
227 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
228 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
229 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
230 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
231 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
232 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
233 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
234 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
235 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
236 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
237 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
238 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
239 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
240 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
241 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
242 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
246 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 2.94
Rhizosphere 95.85
Stem 0
Stem Tuber 0
Unclassified 10.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0732789 3300038443 Unclassified 983
2 JGI24736J21556_1005298 3300001904 Bacteria 2180
3 JGI24741J21665_1009493 3300001915 Bacteria 1784
4 JGI24741J21665_1012889 3300001915 Unclassified 1427
5 JGI24741J21665_1039574 3300001915 Bacteria 696
6 JGI24741J21665_1043434 3300001915 Bacteria 662
7 JGI24752J21851_1002179 3300001976 Bacteria 2616
8 JGI24740J21852_10005256 3300001979 Bacteria 5496
9 JGI24740J21852_10011162 3300001979 Bacteria 3429
10 JGI24740J21852_10013067 3300001979 Bacteria 3113
11 JGI24739J22299_10034136 3300001989 Bacteria 1735
12 JGI24739J22299_10043840 3300001989 Bacteria 1477
13 JGI24737J22298_10056305 3300001990 Bacteria 1188
14 JGI24737J22298_10145132 3300001990 Unclassified 701
15 JGI24743J22301_10020707 3300001991 Unclassified 1253
16 JGI24735J21928_10006011 3300002067 Bacteria 4011
17 JGI24735J21928_10031058 3300002067 Bacteria 1584
18 JGI24748J21848_1008027 3300002074 Unclassified 1240
19 JGI24738J21930_10035342 3300002075 Unclassified 1018
20 JGI24738J21930_10056325 3300002075 Bacteria 804
21 JGI24034J26672_10001442 3300002239 Bacteria 3159
22 JGI24751J29686_10007721 3300002459 Bacteria 2199
23 Ga0065712_10222260 3300005290 Bacteria 1037
24 Ga0065715_10143068 3300005293 Bacteria 1804
25 Ga0070658_10098292 3300005327 Bacteria 2417
26 Ga0070658_10359130 3300005327 Bacteria 1247
27 Ga0070658_10484610 3300005327 Unclassified 1067
28 Ga0070658_11584704 3300005327 Bacteria 567
29 Ga0070676_10400335 3300005328 Bacteria 955
30 Ga0070676_10415858 3300005328 Unclassified 938
31 Ga0070676_10982371 3300005328 Bacteria 633
32 Ga0070683_100025828 3300005329 Bacteria 5282
33 Ga0070683_100399574 3300005329 Bacteria 1310
34 Ga0070683_101916816 3300005329 Unclassified 569
35 Ga0070690_100136255 3300005330 Bacteria 1663
36 Ga0070670_100006537 3300005331 Bacteria 9873
37 Ga0068869_100134220 3300005334 Bacteria 1905
38 Ga0070666_10000421 3300005335 Bacteria 26263
39 Ga0070666_10003248 3300005335 Bacteria 9874
40 Ga0070666_10026345 3300005335 Bacteria 3797
41 Ga0070666_10059025 3300005335 Bacteria 2594
42 Ga0070666_11102672 3300005335 Bacteria 590
43 Ga0070680_100024830 3300005336 Bacteria 4790
44 Ga0070682_100182485 3300005337 Bacteria 1467
45 Ga0068868_100000688 3300005338 Bacteria 22698
46 Ga0068868_100025142 3300005338 Bacteria 4524
47 Ga0068868_100122558 3300005338 Bacteria 2121
48 Ga0068868_100285565 3300005338 Bacteria 1398
49 Ga0068868_101934553 3300005338 Bacteria 559
50 Ga0070660_100135841 3300005339 Bacteria 1970
51 Ga0070660_100531067 3300005339 Bacteria 980
52 Ga0070691_10003873 3300005341 Bacteria 6764
53 Ga0070691_10394854 3300005341 Bacteria 778
54 Ga0070687_100126848 3300005343 Bacteria 1468
55 Ga0070661_100119835 3300005344 Bacteria 1970
56 Ga0070661_100267584 3300005344 Bacteria 1323
57 Ga0070661_100638402 3300005344 Unclassified 863
58 Ga0070692_10173453 3300005345 Bacteria 1244
59 Ga0070668_100178272 3300005347 Bacteria 1734
60 Ga0070668_101171532 3300005347 Bacteria 695
61 Ga0070669_100021814 3300005353 Bacteria 4579
62 Ga0070669_100488180 3300005353 Bacteria 1020
63 Ga0070675_100065802 3300005354 Bacteria 2997
64 Ga0070675_100374043 3300005354 Bacteria 1267
65 Ga0070675_101766792 3300005354 Unclassified 571
66 Ga0070671_100012377 3300005355 Bacteria 6871
67 Ga0070671_100023437 3300005355 Bacteria 5052
68 Ga0070671_100045422 3300005355 Bacteria 3652
69 Ga0070671_100056564 3300005355 Bacteria 3263
70 Ga0070671_100158189 3300005355 Bacteria 1915
71 Ga0070674_100030741 3300005356 Bacteria 3552
72 Ga0070673_100009724 3300005364 Bacteria 6470
73 Ga0070673_100038330 3300005364 Bacteria 3659
74 Ga0070673_100068247 3300005364 Bacteria 2847
75 Ga0070673_100074185 3300005364 Bacteria 2741
76 Ga0070659_100003051 3300005366 Bacteria 11908
77 Ga0070659_100008511 3300005366 Bacteria 7497
78 Ga0070659_100047768 3300005366 Bacteria 3359
79 Ga0070659_100144557 3300005366 Bacteria 1937
80 Ga0070659_100207104 3300005366 Bacteria 1615
81 Ga0070659_101194747 3300005366 Bacteria 672
82 Ga0070667_100001036 3300005367 Bacteria 25394
83 Ga0070667_100006547 3300005367 Bacteria 9682
84 Ga0070667_100230105 3300005367 Bacteria 1653
85 Ga0070714_100175994 3300005435 Bacteria 1944
86 Ga0070713_100039080 3300005436 Bacteria 3849
87 Ga0070694_100090359 3300005444 Bacteria 2147
88 Ga0070708_101293289 3300005445 Bacteria 681
89 Ga0070663_100067138 3300005455 Bacteria 2600
90 Ga0070663_100095068 3300005455 Bacteria 2214
91 Ga0070663_100108274 3300005455 Bacteria 2084
92 Ga0070663_100182433 3300005455 Bacteria 1629
93 Ga0070663_100217762 3300005455 Bacteria 1498
94 Ga0070663_101412618 3300005455 Bacteria 617
95 Ga0070678_100000375 3300005456 Bacteria 20883
96 Ga0070678_100083261 3300005456 Bacteria 2431
97 Ga0070662_100002723 3300005457 Bacteria 10913
98 Ga0070662_100028417 3300005457 Bacteria 3891
99 Ga0070662_100209781 3300005457 Bacteria 1549
100 Ga0070662_100538127 3300005457 Bacteria 978
101 Ga0070662_100909800 3300005457 Bacteria 751
102 Ga0070662_101067306 3300005457 Unclassified 692
103 Ga0070681_10148161 3300005458 Bacteria 2274
104 Ga0070681_10149403 3300005458 Bacteria 2264
105 Ga0068867_100334459 3300005459 Bacteria 1259
106 Ga0068867_102226637 3300005459 Unclassified 520
107 Ga0070685_10126043 3300005466 Bacteria 1595
108 Ga0070685_10731543 3300005466 Unclassified 724
109 Ga0070679_100217530 3300005530 Bacteria 1872
110 Ga0070679_100317127 3300005530 Bacteria 1508
111 Ga0070679_100560021 3300005530 Unclassified 1087
112 Ga0070684_100020494 3300005535 Bacteria 5485
113 Ga0068853_100136614 3300005539 Bacteria 2198
114 Ga0068853_100227176 3300005539 Bacteria 1706
115 Ga0070672_100002007 3300005543 Bacteria 12789
116 Ga0070672_100127635 3300005543 Bacteria 2088
117 Ga0070686_100098327 3300005544 Bacteria 1972
118 Ga0070695_100220736 3300005545 Bacteria 1365
119 Ga0070665_100022541 3300005548 Bacteria 6338
120 Ga0070665_100062134 3300005548 Bacteria 3745
121 Ga0070665_100194227 3300005548 Bacteria 2030
122 Ga0070665_100400329 3300005548 Bacteria 1381
123 Ga0070704_102262474 3300005549 Unclassified 506
124 Ga0068855_100046269 3300005563 Bacteria 5144
125 Ga0068855_100543428 3300005563 Bacteria 1258
126 Ga0070664_100002321 3300005564 Bacteria 15274
127 Ga0070664_100041608 3300005564 Bacteria 3878
128 Ga0070664_100054608 3300005564 Bacteria 3389
129 Ga0070664_100114553 3300005564 Bacteria 2356
130 Ga0070664_100370812 3300005564 Bacteria 1305
131 Ga0070664_100478735 3300005564 Bacteria 1145
132 Ga0070664_100712576 3300005564 Bacteria 935
133 Ga0068857_100029992 3300005577 Bacteria 4799
134 Ga0068857_100070177 3300005577 Bacteria 3120
135 Ga0068857_100219129 3300005577 Bacteria 1738
136 Ga0068857_100372156 3300005577 Bacteria 1325
137 Ga0068857_101394660 3300005577 Bacteria 681
138 Ga0068854_100017461 3300005578 Bacteria 4800
139 Ga0068854_100132830 3300005578 Bacteria 1902
140 Ga0068854_100229931 3300005578 Bacteria 1471
141 Ga0068856_100025488 3300005614 Bacteria 5767
142 Ga0068856_100215090 3300005614 Bacteria 1937
143 Ga0068856_100257863 3300005614 Bacteria 1759
144 Ga0068852_100065578 3300005616 Bacteria 3169
145 Ga0068852_100080778 3300005616 Bacteria 2884
146 Ga0068852_100156004 3300005616 Bacteria 2127
147 Ga0068852_100198489 3300005616 Bacteria 1897
148 Ga0068859_100624211 3300005617 Bacteria 1170
149 Ga0068864_100003607 3300005618 Bacteria 12796
150 Ga0068864_100209639 3300005618 Bacteria 1794
151 Ga0068864_100307414 3300005618 Bacteria 1486
152 Ga0068866_10122939 3300005718 Bacteria 1465
153 Ga0068861_100613660 3300005719 Bacteria 1000
154 Ga0068851_10012109 3300005834 Bacteria 4061
155 Ga0068851_10074587 3300005834 Bacteria 1761
156 Ga0068863_100001606 3300005841 Bacteria 22340
157 Ga0068863_100003094 3300005841 Bacteria 16438
158 Ga0068863_100954704 3300005841 Unclassified 859
159 Ga0068858_100001226 3300005842 Bacteria 26511
160 Ga0068858_100004712 3300005842 Bacteria 13354
161 Ga0068858_100014049 3300005842 Bacteria 7553
162 Ga0068858_101002162 3300005842 Unclassified 818
163 Ga0068860_100542955 3300005843 Bacteria 1164
164 Ga0068860_100670566 3300005843 Bacteria 1045
165 Ga0068860_102392342 3300005843 Unclassified 548
166 Ga0068862_100868000 3300005844 Unclassified 885
167 Ga0068862_100894408 3300005844 Unclassified 872
168 Ga0068862_101001625 3300005844 Unclassified 826
169 Ga0068862_101937290 3300005844 Bacteria 599
170 Ga0068862_102697375 3300005844 Bacteria 508
171 Ga0081539_10043389 3300005985 Bacteria 2608
172 Ga0070717_11388790 3300006028 Bacteria 638
173 Ga0097621_100079950 3300006237 Bacteria 2718
174 Ga0097621_100120833 3300006237 Bacteria 2222
175 Ga0068871_100099885 3300006358 Bacteria 2430
176 Ga0075428_100238860 3300006844 Bacteria 1961
177 Ga0075433_10003762 3300006852 Bacteria 11744
178 Ga0075434_100816349 3300006871 Bacteria 948
179 Ga0075434_101359623 3300006871 Bacteria 720
180 Ga0097620_100624214 3300006931 Bacteria 1170
181 Ga0105240_10056830 3300009093 Bacteria 4894
182 Ga0105240_10362388 3300009093 Bacteria 1641
183 Ga0105240_10916207 3300009093 Bacteria 942
184 Ga0105245_10097745 3300009098 Bacteria 2712
185 Ga0105245_10194626 3300009098 Bacteria 1944
186 Ga0105245_11964931 3300009098 Bacteria 638
187 Ga0105247_10741490 3300009101 Unclassified 743
188 Ga0105243_10272767 3300009148 Bacteria 1520
189 Ga0105243_10670655 3300009148 Bacteria 1007
190 Ga0105241_10068600 3300009174 Bacteria 2748
191 Ga0105241_10939888 3300009174 Bacteria 805
192 Ga0105241_11294122 3300009174 Bacteria 694
193 Ga0105248_10005994 3300009177 Bacteria 13341
194 Ga0105248_10025316 3300009177 Bacteria 6597
195 Ga0105248_10025398 3300009177 Bacteria 6586
196 Ga0105248_11702810 3300009177 Bacteria 715
197 Ga0105237_10076810 3300009545 Bacteria 3330
198 Ga0105237_11407550 3300009545 Bacteria 704
199 Ga0105238_10074809 3300009551 Bacteria 3380
200 Ga0105249_10115548 3300009553 Bacteria 2543
201 Ga0105249_10315496 3300009553 Bacteria 1573
202 Ga0105249_10876993 3300009553 Bacteria 964
203 Ga0105249_11422761 3300009553 Bacteria 765
204 Ga0105239_10067547 3300010375 Bacteria 3927
205 Ga0105246_10222434 3300011119 Bacteria 1481
206 Ga0105246_10398023 3300011119 Bacteria 1143
207 Ga0157373_10028772 3300013100 Bacteria 4007
208 Ga0157373_10132200 3300013100 Bacteria 1755
209 Ga0157373_10171060 3300013100 Bacteria 1528
210 Ga0157371_10065472 3300013102 Bacteria 2574
211 Ga0157371_10119969 3300013102 Bacteria 1869
212 Ga0157371_10185808 3300013102 Bacteria 1487
213 Ga0157371_10226068 3300013102 Bacteria 1344
214 Ga0157371_10363424 3300013102 Bacteria 1055
215 Ga0157370_10061059 3300013104 Bacteria 3577
216 Ga0157370_10239860 3300013104 Bacteria 1677
217 Ga0157370_10327487 3300013104 Bacteria 1413
218 Ga0157370_10367458 3300013104 Unclassified 1326
219 Ga0157369_10146218 3300013105 Bacteria 2499
220 Ga0157369_10172277 3300013105 Bacteria 2280
221 Ga0157369_10514118 3300013105 Bacteria 1239
222 Ga0157374_10029839 3300013296 Bacteria 4946
223 Ga0157374_10039227 3300013296 Bacteria 4359
224 Ga0157378_10316468 3300013297 Bacteria 1515
225 Ga0157378_11790687 3300013297 Bacteria 662
226 Ga0163162_10003182 3300013306 Bacteria 15701
227 Ga0163162_10114119 3300013306 Bacteria 2801
228 Ga0163162_10170799 3300013306 Bacteria 2299
229 Ga0163162_12351068 3300013306 Unclassified 612
230 Ga0157372_10045276 3300013307 Bacteria 4880
231 Ga0157372_10283831 3300013307 Bacteria 1925
232 Ga0157372_10363430 3300013307 Bacteria 1687
233 Ga0157372_10682565 3300013307 Unclassified 1195
234 Ga0157372_10832502 3300013307 Bacteria 1071
235 Ga0157372_11029836 3300013307 Bacteria 953
236 Ga0157372_11125611 3300013307 Unclassified 908
237 Ga0157375_10003289 3300013308 Bacteria 13995
238 Ga0157375_10168812 3300013308 Bacteria 2334
239 Ga0157375_10316790 3300013308 Bacteria 1724
240 Ga0157375_10427784 3300013308 Bacteria 1490
241 Ga0163163_10002576 3300014325 Bacteria 15358
242 Ga0163163_10150080 3300014325 Bacteria 2375
243 Ga0157377_10082380 3300014745 Bacteria 1884
244 Ga0157379_10108458 3300014968 Bacteria 2493
245 Ga0157379_10863169 3300014968 Bacteria 857
246 Ga0157376_10754866 3300014969 Bacteria 982
247 Ga0213874_10137031 3300021377 Bacteria 845
248 Ga0213876_10061652 3300021384 Bacteria 1979
249 Ga0207697_10101875 3300025315 Bacteria 1224
250 Ga0207656_10015490 3300025321 Bacteria 2951
251 Ga0207642_10024842 3300025899 Bacteria 2415
252 Ga0207680_10000396 3300025903 Bacteria 20730
253 Ga0207680_10002616 3300025903 Bacteria 8401
254 Ga0207680_10076398 3300025903 Bacteria 2092
255 Ga0207680_10668092 3300025903 Unclassified 744
256 Ga0207680_10987872 3300025903 Bacteria 603
257 Ga0207647_10005921 3300025904 Bacteria 8915
258 Ga0207647_10007890 3300025904 Bacteria 7655
259 Ga0207647_10017146 3300025904 Bacteria 4930
260 Ga0207647_10080151 3300025904 Bacteria 1958
261 Ga0207645_10327212 3300025907 Bacteria 1023
262 Ga0207645_10450526 3300025907 Unclassified 869
263 Ga0207705_10041216 3300025909 Bacteria 3312
264 Ga0207705_10116382 3300025909 Bacteria 1979
265 Ga0207705_10122704 3300025909 Bacteria 1929
266 Ga0207705_10199169 3300025909 Bacteria 1517
267 Ga0207654_10225667 3300025911 Bacteria 1245
268 Ga0207707_10072278 3300025912 Bacteria 3007
269 Ga0207707_11132808 3300025912 Bacteria 636
270 Ga0207695_10006228 3300025913 Bacteria 15537
271 Ga0207695_10254995 3300025913 Bacteria 1653
272 Ga0207695_11009984 3300025913 Bacteria 712
273 Ga0207671_10031488 3300025914 Bacteria 3952
274 Ga0207660_10252847 3300025917 Bacteria 1391
275 Ga0207660_10406148 3300025917 Bacteria 1097
276 Ga0207657_10011983 3300025919 Bacteria 8577
277 Ga0207657_10020708 3300025919 Bacteria 6208
278 Ga0207657_10043311 3300025919 Bacteria 3966
279 Ga0207657_10066881 3300025919 Bacteria 3058
280 Ga0207657_10784419 3300025919 Bacteria 737
281 Ga0207649_10017426 3300025920 Bacteria 4070
282 Ga0207649_10024882 3300025920 Bacteria 3484
283 Ga0207649_10115732 3300025920 Bacteria 1799
284 Ga0207649_10200545 3300025920 Bacteria 1409
285 Ga0207652_10429617 3300025921 Bacteria 1191
286 Ga0207652_10466929 3300025921 Bacteria 1137
287 Ga0207681_11247656 3300025923 Unclassified 624
288 Ga0207694_10012435 3300025924 Bacteria 6415
289 Ga0207650_10003982 3300025925 Bacteria 10109
290 Ga0207650_10243407 3300025925 Bacteria 1454
291 Ga0207650_11614758 3300025925 Bacteria 550
292 Ga0207659_10107919 3300025926 Bacteria 2111
293 Ga0207659_10178241 3300025926 Bacteria 1682
294 Ga0207659_10683026 3300025926 Bacteria 879
295 Ga0207687_10052789 3300025927 Bacteria 2838
296 Ga0207687_10542101 3300025927 Bacteria 975
297 Ga0207700_10019909 3300025928 Bacteria 4543
298 Ga0207664_10132855 3300025929 Bacteria 2097
299 Ga0207644_10000771 3300025931 Bacteria 20267
300 Ga0207644_10016545 3300025931 Bacteria 4962
301 Ga0207644_10062707 3300025931 Bacteria 2697
302 Ga0207644_10072638 3300025931 Bacteria 2520
303 Ga0207644_10293529 3300025931 Unclassified 1308
304 Ga0207644_10706291 3300025931 Bacteria 841
305 Ga0207690_10002599 3300025932 Bacteria 10892
306 Ga0207690_10005471 3300025932 Bacteria 7490
307 Ga0207690_10052718 3300025932 Bacteria 2726
308 Ga0207690_10262657 3300025932 Bacteria 1338
309 Ga0207690_11813754 3300025932 Bacteria 509
310 Ga0207706_10002426 3300025933 Bacteria 18188
311 Ga0207706_10019160 3300025933 Bacteria 6154
312 Ga0207706_10032191 3300025933 Bacteria 4670
313 Ga0207706_10185382 3300025933 Bacteria 1827
314 Ga0207706_10213120 3300025933 Bacteria 1692
315 Ga0207706_10261551 3300025933 Bacteria 1511
316 Ga0207706_10354274 3300025933 Bacteria 1276
317 Ga0207709_10083723 3300025935 Bacteria 2063
318 Ga0207709_10475424 3300025935 Bacteria 971
319 Ga0207670_10096980 3300025936 Bacteria 2098
320 Ga0207670_10215586 3300025936 Bacteria 1466
321 Ga0207669_10002423 3300025937 Bacteria 7953
322 Ga0207704_10046636 3300025938 Bacteria 2584
323 Ga0207691_10000916 3300025940 Bacteria 29221
324 Ga0207691_10025023 3300025940 Bacteria 5609
325 Ga0207691_10209054 3300025940 Bacteria 1696
326 Ga0207691_10910410 3300025940 Unclassified 736
327 Ga0207711_10000107 3300025941 Bacteria 87146
328 Ga0207711_10001043 3300025941 Bacteria 26500
329 Ga0207711_10005374 3300025941 Bacteria 10843
330 Ga0207711_10139027 3300025941 Bacteria 2184
331 Ga0207689_10036743 3300025942 Bacteria 4065
332 Ga0207661_10074687 3300025944 Bacteria 2779
333 Ga0207661_10085149 3300025944 Bacteria 2620
334 Ga0207661_10112094 3300025944 Bacteria 2308
335 Ga0207661_10353540 3300025944 Bacteria 1326
336 Ga0207679_10010212 3300025945 Bacteria 6039
337 Ga0207679_10053977 3300025945 Bacteria 2956
338 Ga0207679_10117135 3300025945 Bacteria 2113
339 Ga0207679_10202891 3300025945 Bacteria 1658
340 Ga0207679_10207386 3300025945 Bacteria 1641
341 Ga0207667_10014131 3300025949 Bacteria 9112
342 Ga0207667_10450520 3300025949 Bacteria 1308
343 Ga0207667_10710196 3300025949 Bacteria 1007
344 Ga0207651_10001349 3300025960 Bacteria 11099
345 Ga0207651_10077632 3300025960 Bacteria 2378
346 Ga0207651_10127846 3300025960 Bacteria 1939
347 Ga0207651_10299208 3300025960 Bacteria 1337
348 Ga0207712_10000974 3300025961 Bacteria 20541
349 Ga0207712_10115808 3300025961 Bacteria 2018
350 Ga0207712_10198198 3300025961 Bacteria 1590
351 Ga0207712_11160748 3300025961 Bacteria 688
352 Ga0207668_11457295 3300025972 Unclassified 617
353 Ga0207640_10054875 3300025981 Bacteria 2607
354 Ga0207640_10281170 3300025981 Bacteria 1307
355 Ga0207640_10409678 3300025981 Bacteria 1106
356 Ga0207640_10443261 3300025981 Unclassified 1068
357 Ga0207658_10007344 3300025986 Bacteria 7511
358 Ga0207658_10023546 3300025986 Bacteria 4300
359 Ga0207658_10123415 3300025986 Bacteria 2069
360 Ga0207658_11466542 3300025986 Bacteria 624
361 Ga0207677_10001518 3300026023 Bacteria 12268
362 Ga0207677_10005529 3300026023 Bacteria 6862
363 Ga0207677_10408488 3300026023 Bacteria 1153
364 Ga0207677_10669810 3300026023 Bacteria 918
365 Ga0207677_11653041 3300026023 Bacteria 593
366 Ga0207703_10000959 3300026035 Bacteria 27891
367 Ga0207703_10004369 3300026035 Bacteria 11617
368 Ga0207703_10006455 3300026035 Bacteria 9368
369 Ga0207639_10023622 3300026041 Bacteria 4440
370 Ga0207639_10120471 3300026041 Bacteria 2155
371 Ga0207639_10124590 3300026041 Bacteria 2123
372 Ga0207639_10923616 3300026041 Bacteria 816
373 Ga0207678_10010845 3300026067 Bacteria 8008
374 Ga0207678_10025986 3300026067 Bacteria 5109
375 Ga0207678_10081820 3300026067 Bacteria 2764
376 Ga0207678_10090604 3300026067 Bacteria 2613
377 Ga0207678_10212777 3300026067 Bacteria 1654
378 Ga0207702_10022001 3300026078 Bacteria 5281
379 Ga0207702_10025173 3300026078 Bacteria 4938
380 Ga0207702_10116514 3300026078 Bacteria 2384
381 Ga0207702_10140561 3300026078 Bacteria 2184
382 Ga0207702_10589141 3300026078 Bacteria 1090
383 Ga0207702_11481356 3300026078 Bacteria 672
384 Ga0207641_10006821 3300026088 Bacteria 9565
385 Ga0207641_10046984 3300026088 Bacteria 3639
386 Ga0207641_10155868 3300026088 Bacteria 2072
387 Ga0207648_10392144 3300026089 Bacteria 1257
388 Ga0207676_10003203 3300026095 Bacteria 11656
389 Ga0207676_10333851 3300026095 Bacteria 1396
390 Ga0207676_10433060 3300026095 Bacteria 1236
391 Ga0207676_10645785 3300026095 Bacteria 1021
392 Ga0207676_12336953 3300026095 Bacteria 532
393 Ga0207674_10000065 3300026116 Bacteria 109485
394 Ga0207674_10009484 3300026116 Bacteria 11115
395 Ga0207674_10009520 3300026116 Bacteria 11089
396 Ga0207674_10026104 3300026116 Bacteria 6214
397 Ga0207674_10052580 3300026116 Bacteria 4154
398 Ga0207674_10230011 3300026116 Bacteria 1802
399 Ga0207675_101386333 3300026118 Bacteria 724
400 Ga0207683_10000976 3300026121 Bacteria 26222
401 Ga0207683_10106999 3300026121 Bacteria 2502
402 Ga0207698_10002465 3300026142 Bacteria 10976
403 Ga0207698_10021471 3300026142 Bacteria 4466
404 Ga0207698_10029715 3300026142 Bacteria 3918
405 Ga0207698_10076767 3300026142 Bacteria 2675
406 Ga0207698_10260349 3300026142 Bacteria 1593
407 Ga0207698_10261084 3300026142 Bacteria 1591
408 Ga0207698_10369892 3300026142 Bacteria 1360
409 Ga0268266_10026301 3300028379 Bacteria 4951
410 Ga0268266_10704291 3300028379 Bacteria 973
411 Ga0268265_10111157 3300028380 Bacteria 2237
412 Ga0268265_10532204 3300028380 Bacteria 1112
413 Ga0268265_10611958 3300028380 Bacteria 1042
414 Ga0268264_10000546 3300028381 Bacteria 47268
415 Ga0268264_10568584 3300028381 Bacteria 1114
416 Ga0268264_12623342 3300028381 Unclassified 508
417 Ga0307408_100011093 3300031548 Bacteria 5951
418 Ga0307405_10650079 3300031731 Bacteria 867
419 Ga0307413_10012246 3300031824 Bacteria 4260
420 Ga0307413_11839516 3300031824 Bacteria 543
421 Ga0307410_10020890 3300031852 Bacteria 4016
422 Ga0307410_10942659 3300031852 Unclassified 742
423 Ga0307406_10208353 3300031901 Bacteria 1444
424 Ga0307406_11270033 3300031901 Bacteria 642
425 Ga0307407_10041206 3300031903 Bacteria 2580
426 Ga0307407_10787213 3300031903 Bacteria 723
427 Ga0307409_100309437 3300031995 Bacteria 1473
428 Ga0307409_101616482 3300031995 Bacteria 676
429 Ga0307416_100277708 3300032002 Bacteria 1649
430 Ga0307414_11037343 3300032004 Bacteria 756
431 Ga0307411_10000956 3300032005 Bacteria 11041
432 Ga0307411_10542587 3300032005 Bacteria 991
433 Ga0307411_10909453 3300032005 Bacteria 782
434 Ga0307415_100220008 3300032126 Bacteria 1521
435 Ga0307415_100334059 3300032126 Bacteria 1269
436 Ga0373940_0168362 3300035088 Bacteria 707
437 Ga0373939_0035084 3300035114 Bacteria 1476
438 Ga0395899_0007054 3300037312 Bacteria 8694
439 Ga0395899_0011333 3300037312 Bacteria 6829
440 Ga0395899_0078961 3300037312 Bacteria 2398
441 Ga0395899_0099079 3300037312 Bacteria 2106
442 Ga0395899_0100807 3300037312 Bacteria 2085
443 Ga0395899_0123294 3300037312 Bacteria 1854
444 Ga0395899_0156970 3300037312 Bacteria 1609
445 Ga0395899_0163042 3300037312 Bacteria 1574
446 Ga0395900_0014323 3300037418 Bacteria 8096
447 Ga0395900_0032140 3300037418 Bacteria 5395
448 Ga0395900_0038071 3300037418 Bacteria 4958
449 Ga0395900_0079822 3300037418 Bacteria 3362
450 Ga0395900_0091321 3300037418 Bacteria 3129
451 Ga0395900_0097521 3300037418 Bacteria 3020
452 Ga0395900_0103897 3300037418 Bacteria 2918
453 Ga0395900_0112436 3300037418 Bacteria 2796
454 Ga0395900_0124850 3300037418 Bacteria 2639
455 Ga0395900_0259846 3300037418 Bacteria 1735
456 Ga0395900_0363805 3300037418 Bacteria 1417
457 Ga0395900_0593682 3300037418 Unclassified 1048
458 Ga0395900_0722524 3300037418 Unclassified 928
459 Ga0395898_0004083 3300037466 Bacteria 16011
460 Ga0395898_0006331 3300037466 Bacteria 12650
461 Ga0395898_0022731 3300037466 Bacteria 6347
462 Ga0395898_0090569 3300037466 Bacteria 2943
463 Ga0395898_0099374 3300037466 Bacteria 2794
464 Ga0395898_0130499 3300037466 Bacteria 2407
465 Ga0395898_0268600 3300037466 Bacteria 1627
466 Ga0395898_0307592 3300037466 Bacteria 1512
467 Ga0395898_0909256 3300037466 Bacteria 818
468 Ga0395898_1068392 3300037466 Bacteria 741
469 Ga0395905_0000533 3300037471 Bacteria 52133
470 Ga0395905_0006103 3300037471 Bacteria 12175
471 Ga0395905_0017575 3300037471 Bacteria 6786
472 Ga0395905_0025023 3300037471 Bacteria 5630
473 Ga0395905_0026998 3300037471 Bacteria 5414
474 Ga0395905_0124147 3300037471 Bacteria 2427
475 Ga0395905_0199295 3300037471 Bacteria 1877
476 Ga0395905_0241859 3300037471 Bacteria 1686
477 Ga0395905_0347315 3300037471 Bacteria 1375
478 Ga0395905_0353662 3300037471 Bacteria 1361
479 Ga0395905_0408781 3300037471 Bacteria 1252
480 Ga0395905_0526932 3300037471 Bacteria 1082
481 Ga0395905_0575851 3300037471 Bacteria 1027
482 Ga0395905_1036453 3300037471 Bacteria 723
483 Ga0395901_0018414 3300038443 Bacteria 7128
484 Ga0395901_0028858 3300038443 Bacteria 5707
485 Ga0395901_0032051 3300038443 Bacteria 5422
486 Ga0395901_0071433 3300038443 Bacteria 3617
487 Ga0395901_0079642 3300038443 Bacteria 3421
488 Ga0395901_0101765 3300038443 Bacteria 3015
489 Ga0395901_0494715 3300038443 Unclassified 1245
490 Ga0395901_0980134 3300038443 Unclassified 822
491 Ga0395901_1044444 3300038443 Unclassified 790
492 Ga0395901_1361124 3300038443 Bacteria 669
493 Ga0395901_1370295 3300038443 Unclassified 667
494 Ga0395901_1397797 3300038443 Bacteria 658
495 Ga0395901_1874302 3300038443 Bacteria 548
496 Ga0436365_0215337 3300039437 Unclassified 696
497 Ga0436363_0171609 3300039450 Bacteria 1978
498 Ga0439465_0024766 3300041413 Bacteria 1892
499 Ga0439432_080304 3300042006 Bacteria 988
500 Ga0439449_0020316 3300042007 Bacteria 2489
501 Ga0450893_0015741 3300042532 Bacteria 1277
502 Ga0466972_0209962 3300044658 Bacteria 911
503 Ga0466972_0392549 3300044658 Unclassified 650
504 Ga0466966_0415804 3300044684 Bacteria 808
505 Ga0466963_0071106 3300044694 Bacteria 2341
506 Ga0466963_0128562 3300044694 Bacteria 1748
507 Ga0466963_0714493 3300044694 Unclassified 707
508 Ga0466964_0318233 3300044706 Unclassified 790
509 Ga0466971_0240046 3300044719 Unclassified 862
510 Ga0466971_0268052 3300044719 Unclassified 816
511 Ga0466971_0287439 3300044719 Bacteria 788
512 Ga0466959_0654694 3300045049 Bacteria 705
513 Ga0466958_0122916 3300045836 Bacteria 1626
514 Ga0466958_0238024 3300045836 Bacteria 1163
515 Ga0466967_0024155 3300045976 Bacteria 4993
516 Ga0466967_0241135 3300045976 Bacteria 1725
517 Ga0466967_0246434 3300045976 Bacteria 1705
518 Ga0466967_0380595 3300045976 Bacteria 1370
519 Ga0495668_0188692 3300046616 Bacteria 1129
520 Ga0495669_0027699 3300046684 Bacteria 2480
521 Ga0496100_0685414 3300048903 Unclassified 799
522 Ga0496101_0010432 3300048904 Bacteria 6135
523 Ga0496101_0152273 3300048904 Bacteria 1769
524 Ga0496102_0558454 3300048905 Unclassified 1067
525 Ga0496102_1841186 3300048905 Unclassified 522
526 Ga0496103_0206665 3300048906 Bacteria 1263
527 Ga0496106_0442844 3300048909 Bacteria 1044
528 Ga0496107_0026319 3300048910 Bacteria 4122
529 Ga0496108_0005967 3300048911 Bacteria 9869
530 Ga0496109_0004603 3300048912 Bacteria 11513
531 Ga0496110_0000687 3300048913 Bacteria 23304
532 Ga0496111_0027544 3300048914 Bacteria 4021
533 Ga0496111_0482972 3300048914 Bacteria 913
534 Ga0496112_0002520 3300048915 Bacteria 14785
535 Ga0496112_0389336 3300048915 Bacteria 1334
536 Ga0496114_0014506 3300048917 Bacteria 6329
537 Ga0496115_0878418 3300048918 Unclassified 693
538 Ga0501295_151354 3300049518 Bacteria 573
539 Ga0501202_142900 3300049652 Bacteria 620
540 Ga0501206_081492 3300049653 Unclassified 562
541 Ga0501207_113769 3300049654 Bacteria 555
542 Ga0501209_146150 3300049656 Bacteria 710
543 Ga0501216_036816 3300049660 Unclassified 923
544 Ga0501217_019901 3300049661 Bacteria 1571
545 Ga0501223_030369 3300049663 Unclassified 1051
546 Ga0501224_001538 3300049664 Bacteria 3073
547 Ga0501227_010706 3300049665 Bacteria 1990
548 Ga0501235_009166 3300049669 Bacteria 2162
549 Ga0501236_021636 3300049670 Bacteria 955
550 Ga0501242_007929 3300049674 Bacteria 1234
551 Ga0501247_004365 3300049677 Bacteria 1544
552 Ga0501249_029537 3300049679 Bacteria 1219
553 Ga0501250_026254 3300049680 Bacteria 784
554 Ga0501252_016256 3300049682 Bacteria 935
555 Ga0501253_009657 3300049683 Bacteria 1429
556 Ga0501256_030076 3300049685 Unclassified 608
557 Ga0501257_014468 3300049686 Bacteria 1816
558 Ga0501258_006015 3300049687 Bacteria 1192
559 Ga0501221_002911 3300049704 Bacteria 2820
560 Ga0501225_0009638 3300049705 Bacteria 2744
561 Ga0501234_010432 3300049707 Bacteria 1447
562 Ga0501245_016134 3300049708 Bacteria 1130
563 Ga0501262_000830 3300049759 Bacteria 3548
564 Ga0501263_010075 3300049760 Bacteria 1154
565 Ga0501265_118849 3300049762 Unclassified 501
566 Ga0501268_010343 3300049765 Bacteria 1451
567 Ga0501270_005539 3300049767 Bacteria 1472
568 Ga0501271_068660 3300049768 Bacteria 509
569 Ga0501273_003825 3300049770 Bacteria 1624
570 Ga0501279_009411 3300049775 Bacteria 1308
571 Ga0501283_014150 3300049779 Bacteria 1216
572 Ga0501204_022252 3300049850 Bacteria 835
573 Ga0501212_016814 3300049851 Bacteria 1102
574 nmdc:mga0k408_754890_c1 3300050493 Bacteria 568
575 nmdc:mga0k408_846382_c1 3300050493 Bacteria 532
576 nmdc:mga0a205_5138_c1 3300050515 Bacteria 11772
577 nmdc:mga0sz30_125686_c1 3300050516 Bacteria 1128
578 Ga0466962_0236969 3300061719 Unclassified 895
579 Ga0395901_0732789
580 JGI24736J21556_1005298
581 JGI24741J21665_1009493
582 JGI24741J21665_1012889
583 JGI24741J21665_1039574
584 JGI24741J21665_1043434
585 JGI24752J21851_1002179
586 JGI24740J21852_10005256
587 JGI24740J21852_10011162
588 JGI24740J21852_10013067
589 JGI24739J22299_10034136
590 JGI24739J22299_10043840
591 JGI24737J22298_10056305
592 JGI24737J22298_10145132
593 JGI24743J22301_10020707
594 JGI24735J21928_10006011
595 JGI24735J21928_10031058
596 JGI24748J21848_1008027
597 JGI24738J21930_10035342
598 JGI24738J21930_10056325
599 JGI24034J26672_10001442
600 JGI24751J29686_10007721
601 Ga0065712_10222260
602 Ga0065715_10143068
603 Ga0070658_10098292
604 Ga0070658_10359130
605 Ga0070658_10484610
606 Ga0070658_11584704
607 Ga0070676_10400335
608 Ga0070676_10415858
609 Ga0070676_10982371
610 Ga0070683_100025828
611 Ga0070683_100399574
612 Ga0070683_101916816
613 Ga0070690_100136255
614 Ga0070670_100006537
615 Ga0068869_100134220
616 Ga0070666_10000421
617 Ga0070666_10003248
618 Ga0070666_10026345
619 Ga0070666_10059025
620 Ga0070666_11102672
621 Ga0070680_100024830
622 Ga0070682_100182485
623 Ga0068868_100000688
624 Ga0068868_100025142
625 Ga0068868_100122558
626 Ga0068868_100285565
627 Ga0068868_101934553
628 Ga0070660_100135841
629 Ga0070660_100531067
630 Ga0070691_10003873
631 Ga0070691_10394854
632 Ga0070687_100126848
633 Ga0070661_100119835
634 Ga0070661_100267584
635 Ga0070661_100638402
636 Ga0070692_10173453
637 Ga0070668_100178272
638 Ga0070668_101171532
639 Ga0070669_100021814
640 Ga0070669_100488180
641 Ga0070675_100065802
642 Ga0070675_100374043
643 Ga0070675_101766792
644 Ga0070671_100012377
645 Ga0070671_100023437
646 Ga0070671_100045422
647 Ga0070671_100056564
648 Ga0070671_100158189
649 Ga0070674_100030741
650 Ga0070673_100009724
651 Ga0070673_100038330
652 Ga0070673_100068247
653 Ga0070673_100074185
654 Ga0070659_100003051
655 Ga0070659_100008511
656 Ga0070659_100047768
657 Ga0070659_100144557
658 Ga0070659_100207104
659 Ga0070659_101194747
660 Ga0070667_100001036
661 Ga0070667_100006547
662 Ga0070667_100230105
663 Ga0070714_100175994
664 Ga0070713_100039080
665 Ga0070694_100090359
666 Ga0070708_101293289
667 Ga0070663_100067138
668 Ga0070663_100095068
669 Ga0070663_100108274
670 Ga0070663_100182433
671 Ga0070663_100217762
672 Ga0070663_101412618
673 Ga0070678_100000375
674 Ga0070678_100083261
675 Ga0070662_100002723
676 Ga0070662_100028417
677 Ga0070662_100209781
678 Ga0070662_100538127
679 Ga0070662_100909800
680 Ga0070662_101067306
681 Ga0070681_10148161
682 Ga0070681_10149403
683 Ga0068867_100334459
684 Ga0068867_102226637
685 Ga0070685_10126043
686 Ga0070685_10731543
687 Ga0070679_100217530
688 Ga0070679_100317127
689 Ga0070679_100560021
690 Ga0070684_100020494
691 Ga0068853_100136614
692 Ga0068853_100227176
693 Ga0070672_100002007
694 Ga0070672_100127635
695 Ga0070686_100098327
696 Ga0070695_100220736
697 Ga0070665_100022541
698 Ga0070665_100062134
699 Ga0070665_100194227
700 Ga0070665_100400329
701 Ga0070704_102262474
702 Ga0068855_100046269
703 Ga0068855_100543428
704 Ga0070664_100002321
705 Ga0070664_100041608
706 Ga0070664_100054608
707 Ga0070664_100114553
708 Ga0070664_100370812
709 Ga0070664_100478735
710 Ga0070664_100712576
711 Ga0068857_100029992
712 Ga0068857_100070177
713 Ga0068857_100219129
714 Ga0068857_100372156
715 Ga0068857_101394660
716 Ga0068854_100017461
717 Ga0068854_100132830
718 Ga0068854_100229931
719 Ga0068856_100025488
720 Ga0068856_100215090
721 Ga0068856_100257863
722 Ga0068852_100065578
723 Ga0068852_100080778
724 Ga0068852_100156004
725 Ga0068852_100198489
726 Ga0068859_100624211
727 Ga0068864_100003607
728 Ga0068864_100209639
729 Ga0068864_100307414
730 Ga0068866_10122939
731 Ga0068861_100613660
732 Ga0068851_10012109
733 Ga0068851_10074587
734 Ga0068863_100001606
735 Ga0068863_100003094
736 Ga0068863_100954704
737 Ga0068858_100001226
738 Ga0068858_100004712
739 Ga0068858_100014049
740 Ga0068858_101002162
741 Ga0068860_100542955
742 Ga0068860_100670566
743 Ga0068860_102392342
744 Ga0068862_100868000
745 Ga0068862_100894408
746 Ga0068862_101001625
747 Ga0068862_101937290
748 Ga0068862_102697375
749 Ga0081539_10043389
750 Ga0070717_11388790
751 Ga0097621_100079950
752 Ga0097621_100120833
753 Ga0068871_100099885
754 Ga0075428_100238860
755 Ga0075433_10003762
756 Ga0075434_100816349
757 Ga0075434_101359623
758 Ga0097620_100624214
759 Ga0105240_10056830
760 Ga0105240_10362388
761 Ga0105240_10916207
762 Ga0105245_10097745
763 Ga0105245_10194626
764 Ga0105245_11964931
765 Ga0105247_10741490
766 Ga0105243_10272767
767 Ga0105243_10670655
768 Ga0105241_10068600
769 Ga0105241_10939888
770 Ga0105241_11294122
771 Ga0105248_10005994
772 Ga0105248_10025316
773 Ga0105248_10025398
774 Ga0105248_11702810
775 Ga0105237_10076810
776 Ga0105237_11407550
777 Ga0105238_10074809
778 Ga0105249_10115548
779 Ga0105249_10315496
780 Ga0105249_10876993
781 Ga0105249_11422761
782 Ga0105239_10067547
783 Ga0105246_10222434
784 Ga0105246_10398023
785 Ga0157373_10028772
786 Ga0157373_10132200
787 Ga0157373_10171060
788 Ga0157371_10065472
789 Ga0157371_10119969
790 Ga0157371_10185808
791 Ga0157371_10226068
792 Ga0157371_10363424
793 Ga0157370_10061059
794 Ga0157370_10239860
795 Ga0157370_10327487
796 Ga0157370_10367458
797 Ga0157369_10146218
798 Ga0157369_10172277
799 Ga0157369_10514118
800 Ga0157374_10029839
801 Ga0157374_10039227
802 Ga0157378_10316468
803 Ga0157378_11790687
804 Ga0163162_10003182
805 Ga0163162_10114119
806 Ga0163162_10170799
807 Ga0163162_12351068
808 Ga0157372_10045276
809 Ga0157372_10283831
810 Ga0157372_10363430
811 Ga0157372_10682565
812 Ga0157372_10832502
813 Ga0157372_11029836
814 Ga0157372_11125611
815 Ga0157375_10003289
816 Ga0157375_10168812
817 Ga0157375_10316790
818 Ga0157375_10427784
819 Ga0163163_10002576
820 Ga0163163_10150080
821 Ga0157377_10082380
822 Ga0157379_10108458
823 Ga0157379_10863169
824 Ga0157376_10754866
825 Ga0213874_10137031
826 Ga0213876_10061652
827 Ga0207697_10101875
828 Ga0207656_10015490
829 Ga0207642_10024842
830 Ga0207680_10000396
831 Ga0207680_10002616
832 Ga0207680_10076398
833 Ga0207680_10668092
834 Ga0207680_10987872
835 Ga0207647_10005921
836 Ga0207647_10007890
837 Ga0207647_10017146
838 Ga0207647_10080151
839 Ga0207645_10327212
840 Ga0207645_10450526
841 Ga0207705_10041216
842 Ga0207705_10116382
843 Ga0207705_10122704
844 Ga0207705_10199169
845 Ga0207654_10225667
846 Ga0207707_10072278
847 Ga0207707_11132808
848 Ga0207695_10006228
849 Ga0207695_10254995
850 Ga0207695_11009984
851 Ga0207671_10031488
852 Ga0207660_10252847
853 Ga0207660_10406148
854 Ga0207657_10011983
855 Ga0207657_10020708
856 Ga0207657_10043311
857 Ga0207657_10066881
858 Ga0207657_10784419
859 Ga0207649_10017426
860 Ga0207649_10024882
861 Ga0207649_10115732
862 Ga0207649_10200545
863 Ga0207652_10429617
864 Ga0207652_10466929
865 Ga0207681_11247656
866 Ga0207694_10012435
867 Ga0207650_10003982
868 Ga0207650_10243407
869 Ga0207650_11614758
870 Ga0207659_10107919
871 Ga0207659_10178241
872 Ga0207659_10683026
873 Ga0207687_10052789
874 Ga0207687_10542101
875 Ga0207700_10019909
876 Ga0207664_10132855
877 Ga0207644_10000771
878 Ga0207644_10016545
879 Ga0207644_10062707
880 Ga0207644_10072638
881 Ga0207644_10293529
882 Ga0207644_10706291
883 Ga0207690_10002599
884 Ga0207690_10005471
885 Ga0207690_10052718
886 Ga0207690_10262657
887 Ga0207690_11813754
888 Ga0207706_10002426
889 Ga0207706_10019160
890 Ga0207706_10032191
891 Ga0207706_10185382
892 Ga0207706_10213120
893 Ga0207706_10261551
894 Ga0207706_10354274
895 Ga0207709_10083723
896 Ga0207709_10475424
897 Ga0207670_10096980
898 Ga0207670_10215586
899 Ga0207669_10002423
900 Ga0207704_10046636
901 Ga0207691_10000916
902 Ga0207691_10025023
903 Ga0207691_10209054
904 Ga0207691_10910410
905 Ga0207711_10000107
906 Ga0207711_10001043
907 Ga0207711_10005374
908 Ga0207711_10139027
909 Ga0207689_10036743
910 Ga0207661_10074687
911 Ga0207661_10085149
912 Ga0207661_10112094
913 Ga0207661_10353540
914 Ga0207679_10010212
915 Ga0207679_10053977
916 Ga0207679_10117135
917 Ga0207679_10202891
918 Ga0207679_10207386
919 Ga0207667_10014131
920 Ga0207667_10450520
921 Ga0207667_10710196
922 Ga0207651_10001349
923 Ga0207651_10077632
924 Ga0207651_10127846
925 Ga0207651_10299208
926 Ga0207712_10000974
927 Ga0207712_10115808
928 Ga0207712_10198198
929 Ga0207712_11160748
930 Ga0207668_11457295
931 Ga0207640_10054875
932 Ga0207640_10281170
933 Ga0207640_10409678
934 Ga0207640_10443261
935 Ga0207658_10007344
936 Ga0207658_10023546
937 Ga0207658_10123415
938 Ga0207658_11466542
939 Ga0207677_10001518
940 Ga0207677_10005529
941 Ga0207677_10408488
942 Ga0207677_10669810
943 Ga0207677_11653041
944 Ga0207703_10000959
945 Ga0207703_10004369
946 Ga0207703_10006455
947 Ga0207639_10023622
948 Ga0207639_10120471
949 Ga0207639_10124590
950 Ga0207639_10923616
951 Ga0207678_10010845
952 Ga0207678_10025986
953 Ga0207678_10081820
954 Ga0207678_10090604
955 Ga0207678_10212777
956 Ga0207702_10022001
957 Ga0207702_10025173
958 Ga0207702_10116514
959 Ga0207702_10140561
960 Ga0207702_10589141
961 Ga0207702_11481356
962 Ga0207641_10006821
963 Ga0207641_10046984
964 Ga0207641_10155868
965 Ga0207648_10392144
966 Ga0207676_10003203
967 Ga0207676_10333851
968 Ga0207676_10433060
969 Ga0207676_10645785
970 Ga0207676_12336953
971 Ga0207674_10000065
972 Ga0207674_10009484
973 Ga0207674_10009520
974 Ga0207674_10026104
975 Ga0207674_10052580
976 Ga0207674_10230011
977 Ga0207675_101386333
978 Ga0207683_10000976
979 Ga0207683_10106999
980 Ga0207698_10002465
981 Ga0207698_10021471
982 Ga0207698_10029715
983 Ga0207698_10076767
984 Ga0207698_10260349
985 Ga0207698_10261084
986 Ga0207698_10369892
987 Ga0268266_10026301
988 Ga0268266_10704291
989 Ga0268265_10111157
990 Ga0268265_10532204
991 Ga0268265_10611958
992 Ga0268264_10000546
993 Ga0268264_10568584
994 Ga0268264_12623342
995 Ga0307408_100011093
996 Ga0307405_10650079
997 Ga0307413_10012246
998 Ga0307413_11839516
999 Ga0307410_10020890
1000 Ga0307410_10942659
1001 Ga0307406_10208353
1002 Ga0307406_11270033
1003 Ga0307407_10041206
1004 Ga0307407_10787213
1005 Ga0307409_100309437
1006 Ga0307409_101616482
1007 Ga0307416_100277708
1008 Ga0307414_11037343
1009 Ga0307411_10000956
1010 Ga0307411_10542587
1011 Ga0307411_10909453
1012 Ga0307415_100220008
1013 Ga0307415_100334059
1014 Ga0373940_0168362
1015 Ga0373939_0035084
1016 Ga0395899_0007054
1017 Ga0395899_0011333
1018 Ga0395899_0078961
1019 Ga0395899_0099079
1020 Ga0395899_0100807
1021 Ga0395899_0123294
1022 Ga0395899_0156970
1023 Ga0395899_0163042
1024 Ga0395900_0014323
1025 Ga0395900_0032140
1026 Ga0395900_0038071
1027 Ga0395900_0079822
1028 Ga0395900_0091321
1029 Ga0395900_0097521
1030 Ga0395900_0103897
1031 Ga0395900_0112436
1032 Ga0395900_0124850
1033 Ga0395900_0259846
1034 Ga0395900_0363805
1035 Ga0395900_0593682
1036 Ga0395900_0722524
1037 Ga0395898_0004083
1038 Ga0395898_0006331
1039 Ga0395898_0022731
1040 Ga0395898_0090569
1041 Ga0395898_0099374
1042 Ga0395898_0130499
1043 Ga0395898_0268600
1044 Ga0395898_0307592
1045 Ga0395898_0909256
1046 Ga0395898_1068392
1047 Ga0395905_0000533
1048 Ga0395905_0006103
1049 Ga0395905_0017575
1050 Ga0395905_0025023
1051 Ga0395905_0026998
1052 Ga0395905_0124147
1053 Ga0395905_0199295
1054 Ga0395905_0241859
1055 Ga0395905_0347315
1056 Ga0395905_0353662
1057 Ga0395905_0408781
1058 Ga0395905_0526932
1059 Ga0395905_0575851
1060 Ga0395905_1036453
1061 Ga0395901_0018414
1062 Ga0395901_0028858
1063 Ga0395901_0032051
1064 Ga0395901_0071433
1065 Ga0395901_0079642
1066 Ga0395901_0101765
1067 Ga0395901_0494715
1068 Ga0395901_0980134
1069 Ga0395901_1044444
1070 Ga0395901_1361124
1071 Ga0395901_1370295
1072 Ga0395901_1397797
1073 Ga0395901_1874302
1074 Ga0436365_0215337
1075 Ga0436363_0171609
1076 Ga0439465_0024766
1077 Ga0439432_080304
1078 Ga0439449_0020316
1079 Ga0450893_0015741
1080 Ga0466972_0209962
1081 Ga0466972_0392549
1082 Ga0466966_0415804
1083 Ga0466963_0071106
1084 Ga0466963_0128562
1085 Ga0466963_0714493
1086 Ga0466964_0318233
1087 Ga0466971_0240046
1088 Ga0466971_0268052
1089 Ga0466971_0287439
1090 Ga0466959_0654694
1091 Ga0466958_0122916
1092 Ga0466958_0238024
1093 Ga0466967_0024155
1094 Ga0466967_0241135
1095 Ga0466967_0246434
1096 Ga0466967_0380595
1097 Ga0495668_0188692
1098 Ga0495669_0027699
1099 Ga0496100_0685414
1100 Ga0496101_0010432
1101 Ga0496101_0152273
1102 Ga0496102_0558454
1103 Ga0496102_1841186
1104 Ga0496103_0206665
1105 Ga0496106_0442844
1106 Ga0496107_0026319
1107 Ga0496108_0005967
1108 Ga0496109_0004603
1109 Ga0496110_0000687
1110 Ga0496111_0027544
1111 Ga0496111_0482972
1112 Ga0496112_0002520
1113 Ga0496112_0389336
1114 Ga0496114_0014506
1115 Ga0496115_0878418
1116 Ga0501295_151354
1117 Ga0501202_142900
1118 Ga0501206_081492
1119 Ga0501207_113769
1120 Ga0501209_146150
1121 Ga0501216_036816
1122 Ga0501217_019901
1123 Ga0501223_030369
1124 Ga0501224_001538
1125 Ga0501227_010706
1126 Ga0501235_009166
1127 Ga0501236_021636
1128 Ga0501242_007929
1129 Ga0501247_004365
1130 Ga0501249_029537
1131 Ga0501250_026254
1132 Ga0501252_016256
1133 Ga0501253_009657
1134 Ga0501256_030076
1135 Ga0501257_014468
1136 Ga0501258_006015
1137 Ga0501221_002911
1138 Ga0501225_0009638
1139 Ga0501234_010432
1140 Ga0501245_016134
1141 Ga0501262_000830
1142 Ga0501263_010075
1143 Ga0501265_118849
1144 Ga0501268_010343
1145 Ga0501270_005539
1146 Ga0501271_068660
1147 Ga0501273_003825
1148 Ga0501279_009411
1149 Ga0501283_014150
1150 Ga0501204_022252
1151 Ga0501212_016814
1152 nmdc:mga0k408_754890_c1
1153 nmdc:mga0k408_846382_c1
1154 nmdc:mga0a205_5138_c1
1155 nmdc:mga0sz30_125686_c1
1156 Ga0466962_0236969

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

1

106

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jz2-assembly1.cif.gz_C succinate: quinone oxidoreductase sqr from e.coli k12 0.8378 2 101
6wu6-assembly1.cif.gz_C succinate-coenzyme q reductase 0.8249 2 100
2wdv-assembly1.cif.gz_C e. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket 0.8071 2 100
7jz2-assembly1.cif.gz_C succinate: quinone oxidoreductase sqr from e.coli k12 0.7633 2 101
6wu6-assembly1.cif.gz_C succinate-coenzyme q reductase 0.7458 2 100
ID Description Score Start End Superfamily
1nenC00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8385 2 100 1.20.1300.10
2ws3C00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8326 2 100 1.20.1300.10
2wdvK00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8312 2 100 1.20.1300.10
1nenC00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7572 2 100 1.20.1300.10
2ws3C00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7525 2 100 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A2E6X6G2-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9464 21 107 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A411ZBF2-F1-model_v4 deleted 0.9445 15 107
AF-A0A833FTU7-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9375 24 107 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A537QNU6-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9329 16 107 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A531L779-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9241 21 110 GO:0006099
GO:0009055
GO:0016020
GO:0046872

Map