F465728

General Info

Members Datasets Scaffolds Average Seq Length
578 265 578 72

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_12673382|Ga0157378_126733822
Length 82
Sequence LYDEVRGMISIWFFIGVSLAVNGALIMAAGIYQVVNPPVDPGVVLFNLHANVWWGGTLLVFGLIYSVRFSPARERKRLSGNA

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
104 3300024123 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 Metagenome Unclassified
105 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
106 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
161 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
174 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
175 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
176 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
177 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
178 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
179 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
180 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
183 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
205 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.71
Rhizosphere 93.77
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10012049 3300005293 Unclassified 2524
2 Ga0065715_10291325 3300005293 Bacteria 1062
3 Ga0070676_10758800 3300005328 Bacteria 713
4 Ga0070690_100431156 3300005330 Bacteria 974
5 Ga0070690_100795060 3300005330 Unclassified 733
6 Ga0068869_100143063 3300005334 Bacteria 1849
7 Ga0070666_10231411 3300005335 Bacteria 1305
8 Ga0070666_10559130 3300005335 Bacteria 832
9 Ga0070680_100381016 3300005336 Bacteria 1201
10 Ga0070680_100437425 3300005336 Bacteria 1116
11 Ga0070682_100110346 3300005337 Bacteria 1832
12 Ga0068868_100830957 3300005338 Bacteria 835
13 Ga0070660_100596400 3300005339 Bacteria 923
14 Ga0070691_10105384 3300005341 Bacteria 1405
15 Ga0070687_100300139 3300005343 Bacteria 1019
16 Ga0070661_100004744 3300005344 Bacteria 9350
17 Ga0070692_11105907 3300005345 Bacteria 560
18 Ga0070668_100015991 3300005347 Bacteria 5613
19 Ga0070669_100072940 3300005353 Bacteria 2543
20 Ga0070675_100838139 3300005354 Bacteria 841
21 Ga0070675_100951260 3300005354 Unclassified 788
22 Ga0070674_100289838 3300005356 Bacteria 1301
23 Ga0070659_100090683 3300005366 Unclassified 2449
24 Ga0070667_100056467 3300005367 Unclassified 3316
25 Ga0070709_10000540 3300005434 Bacteria 22135
26 Ga0070709_10077720 3300005434 Bacteria 2158
27 Ga0070709_10338224 3300005434 Bacteria 1109
28 Ga0070709_10516307 3300005434 Bacteria 910
29 Ga0070709_10550133 3300005434 Bacteria 883
30 Ga0070709_10731817 3300005434 Unclassified 772
31 Ga0070709_10875202 3300005434 Bacteria 709
32 Ga0070709_11261560 3300005434 Unclassified 595
33 Ga0070709_11590438 3300005434 Bacteria 532
34 Ga0070714_100199151 3300005435 Bacteria 1831
35 Ga0070714_100273911 3300005435 Unclassified 1566
36 Ga0070714_100674061 3300005435 Bacteria 996
37 Ga0070714_100966012 3300005435 Unclassified 828
38 Ga0070714_101156822 3300005435 Bacteria 754
39 Ga0070714_101750216 3300005435 Unclassified 607
40 Ga0070714_101908540 3300005435 Unclassified 579
41 Ga0070714_101949997 3300005435 Unclassified 573
42 Ga0070713_100000909 3300005436 Bacteria 18927
43 Ga0070713_100001436 3300005436 Bacteria 15282
44 Ga0070713_100011192 3300005436 Bacteria 6524
45 Ga0070713_100102674 3300005436 Bacteria 2480
46 Ga0070713_100279625 3300005436 Bacteria 1531
47 Ga0070713_100283626 3300005436 Bacteria 1520
48 Ga0070713_100378854 3300005436 Bacteria 1318
49 Ga0070713_100385193 3300005436 Bacteria 1307
50 Ga0070713_100634320 3300005436 Bacteria 1017
51 Ga0070713_100880676 3300005436 Unclassified 860
52 Ga0070713_100946419 3300005436 Bacteria 829
53 Ga0070713_101055172 3300005436 Bacteria 785
54 Ga0070713_102111555 3300005436 Unclassified 546
55 Ga0070710_10016640 3300005437 Bacteria 3747
56 Ga0070710_10033073 3300005437 Bacteria 2806
57 Ga0070710_10050045 3300005437 Bacteria 2340
58 Ga0070710_10139218 3300005437 Bacteria 1486
59 Ga0070710_10532351 3300005437 Unclassified 809
60 Ga0070710_11043134 3300005437 Unclassified 598
61 Ga0070710_11117807 3300005437 Bacteria 579
62 Ga0070710_11282272 3300005437 Unclassified 544
63 Ga0070701_10882907 3300005438 Bacteria 616
64 Ga0070711_100000291 3300005439 Bacteria 26041
65 Ga0070711_100006753 3300005439 Bacteria 6945
66 Ga0070711_100008437 3300005439 Bacteria 6311
67 Ga0070711_100037847 3300005439 Bacteria 3239
68 Ga0070711_100045534 3300005439 Bacteria 2985
69 Ga0070711_100067261 3300005439 Bacteria 2513
70 Ga0070711_100170426 3300005439 Bacteria 1659
71 Ga0070711_100267372 3300005439 Bacteria 1348
72 Ga0070711_100388022 3300005439 Bacteria 1131
73 Ga0070711_100924632 3300005439 Bacteria 745
74 Ga0070711_101159458 3300005439 Bacteria 667
75 Ga0070705_100321534 3300005440 Bacteria 1117
76 Ga0070705_100446607 3300005440 Bacteria 969
77 Ga0070700_100135830 3300005441 Bacteria 1665
78 Ga0070694_100115102 3300005444 Bacteria 1921
79 Ga0070708_100002397 3300005445 Bacteria 14522
80 Ga0070708_100025156 3300005445 Bacteria 5088
81 Ga0070708_100152009 3300005445 Bacteria 2153
82 Ga0070708_100497723 3300005445 Unclassified 1150
83 Ga0070663_100082046 3300005455 Bacteria 2371
84 Ga0070678_100775577 3300005456 Bacteria 869
85 Ga0070662_100020862 3300005457 Bacteria 4468
86 Ga0070681_10037931 3300005458 Bacteria 4832
87 Ga0070681_11191591 3300005458 Bacteria 683
88 Ga0068867_100486317 3300005459 Bacteria 1058
89 Ga0070706_100001716 3300005467 Bacteria 22776
90 Ga0070706_100126839 3300005467 Bacteria 2380
91 Ga0070706_100873724 3300005467 Bacteria 831
92 Ga0070707_100017665 3300005468 Bacteria 6711
93 Ga0070707_100215609 3300005468 Bacteria 1870
94 Ga0070707_100247851 3300005468 Bacteria 1733
95 Ga0070707_100260566 3300005468 Bacteria 1687
96 Ga0070707_100631579 3300005468 Bacteria 1034
97 Ga0070698_100115556 3300005471 Bacteria 2648
98 Ga0070698_101053688 3300005471 Bacteria 761
99 Ga0070699_100028157 3300005518 Bacteria 4846
100 Ga0070679_100313843 3300005530 Bacteria 1517
101 Ga0070679_100611341 3300005530 Bacteria 1033
102 Ga0070684_100282935 3300005535 Bacteria 1519
103 Ga0070697_100000739 3300005536 Bacteria 24386
104 Ga0070697_100890866 3300005536 Unclassified 789
105 Ga0068853_100053189 3300005539 Bacteria 3487
106 Ga0068853_102119339 3300005539 Bacteria 545
107 Ga0070686_100289648 3300005544 Bacteria 1211
108 Ga0070695_100066372 3300005545 Bacteria 2351
109 Ga0070696_100078866 3300005546 Unclassified 2329
110 Ga0070696_100081262 3300005546 Bacteria 2296
111 Ga0070696_100449443 3300005546 Bacteria 1016
112 Ga0070693_100526954 3300005547 Bacteria 842
113 Ga0070665_100104443 3300005548 Bacteria 2835
114 Ga0070665_100242687 3300005548 Bacteria 1802
115 Ga0070704_100297322 3300005549 Bacteria 1344
116 Ga0068855_101087309 3300005563 Bacteria 836
117 Ga0068855_101862489 3300005563 Unclassified 610
118 Ga0070664_100275870 3300005564 Bacteria 1515
119 Ga0070664_101728523 3300005564 Unclassified 593
120 Ga0068857_100045939 3300005577 Bacteria 3875
121 Ga0068854_100003948 3300005578 Bacteria 9295
122 Ga0068856_100021745 3300005614 Bacteria 6233
123 Ga0068856_100167306 3300005614 Bacteria 2210
124 Ga0068856_102090018 3300005614 Unclassified 576
125 Ga0068856_102409055 3300005614 Unclassified 534
126 Ga0068852_100025097 3300005616 Bacteria 4825
127 Ga0068859_100344192 3300005617 Bacteria 1585
128 Ga0068864_100091873 3300005618 Unclassified 2678
129 Ga0068864_100627181 3300005618 Unclassified 1045
130 Ga0068866_10020115 3300005718 Bacteria 3053
131 Ga0068851_10009851 3300005834 Bacteria 4451
132 Ga0068863_100083059 3300005841 Unclassified 3035
133 Ga0068863_101239260 3300005841 Bacteria 752
134 Ga0068858_100049514 3300005842 Bacteria 3891
135 Ga0068858_100906379 3300005842 Bacteria 862
136 Ga0068860_100066450 3300005843 Bacteria 3425
137 Ga0068860_100550319 3300005843 Bacteria 1156
138 Ga0068862_100017939 3300005844 Bacteria 5894
139 Ga0081540_1045576 3300005983 Bacteria 2225
140 Ga0081540_1175483 3300005983 Bacteria 809
141 Ga0070717_10001140 3300006028 Bacteria 17941
142 Ga0070717_10011272 3300006028 Bacteria 6784
143 Ga0070717_10030213 3300006028 Unclassified 4353
144 Ga0070717_10033310 3300006028 Bacteria 4157
145 Ga0070717_10047492 3300006028 Bacteria 3518
146 Ga0070717_10061732 3300006028 Bacteria 3106
147 Ga0070717_10062767 3300006028 Bacteria 3082
148 Ga0070717_10230810 3300006028 Unclassified 1629
149 Ga0070717_10361054 3300006028 Bacteria 1300
150 Ga0070717_10420639 3300006028 Bacteria 1202
151 Ga0070717_10427351 3300006028 Bacteria 1192
152 Ga0070717_11155157 3300006028 Bacteria 705
153 Ga0070717_11386732 3300006028 Unclassified 638
154 Ga0070715_10004799 3300006163 Bacteria 4474
155 Ga0070715_10008869 3300006163 Bacteria 3522
156 Ga0070715_10016622 3300006163 Bacteria 2769
157 Ga0070715_10037375 3300006163 Bacteria 2009
158 Ga0070715_10273394 3300006163 Bacteria 893
159 Ga0070716_100009213 3300006173 Bacteria 4917
160 Ga0070716_100013831 3300006173 Bacteria 4122
161 Ga0070716_100215544 3300006173 Unclassified 1286
162 Ga0070716_100256695 3300006173 Unclassified 1194
163 Ga0070716_100506011 3300006173 Bacteria 892
164 Ga0070716_100749186 3300006173 Unclassified 751
165 Ga0070716_101274812 3300006173 Bacteria 593
166 Ga0070716_101692417 3300006173 Unclassified 522
167 Ga0070712_100000105 3300006175 Bacteria 43144
168 Ga0070712_100000167 3300006175 Bacteria 35889
169 Ga0070712_100001546 3300006175 Bacteria 14064
170 Ga0070712_100085882 3300006175 Bacteria 2292
171 Ga0070712_100107130 3300006175 Bacteria 2079
172 Ga0070712_100452727 3300006175 Bacteria 1069
173 Ga0070712_100833396 3300006175 Unclassified 793
174 Ga0070712_101769337 3300006175 Unclassified 541
175 Ga0097621_100089383 3300006237 Bacteria 2575
176 Ga0097621_100119234 3300006237 Bacteria 2236
177 Ga0068871_100040917 3300006358 Bacteria 3714
178 Ga0068871_100093460 3300006358 Bacteria 2509
179 Ga0075434_100305908 3300006871 Bacteria 1610
180 Ga0075434_100606101 3300006871 Bacteria 1114
181 Ga0068865_100055100 3300006881 Bacteria 2765
182 Ga0075436_100848187 3300006914 Bacteria 682
183 Ga0097620_100344187 3300006931 Bacteria 1585
184 Ga0075435_101608624 3300007076 Unclassified 570
185 Ga0099794_10119078 3300007265 Bacteria 1327
186 Ga0099794_10279955 3300007265 Bacteria 862
187 Ga0099795_10040407 3300007788 Unclassified 1656
188 Ga0099795_10270504 3300007788 Unclassified 739
189 Ga0105240_10016327 3300009093 Bacteria 10056
190 Ga0105240_10069435 3300009093 Bacteria 4361
191 Ga0105240_10500077 3300009093 Bacteria 1352
192 Ga0111539_11571765 3300009094 Bacteria 763
193 Ga0105245_10083509 3300009098 Bacteria 2924
194 Ga0105245_10295071 3300009098 Bacteria 1589
195 Ga0105245_10670765 3300009098 Bacteria 1068
196 Ga0105247_10009972 3300009101 Bacteria 5753
197 Ga0105247_10120940 3300009101 Bacteria 1696
198 Ga0105243_10218951 3300009148 Bacteria 1681
199 Ga0105241_10021957 3300009174 Bacteria 4725
200 Ga0105241_10023682 3300009174 Bacteria 4555
201 Ga0105241_10125772 3300009174 Bacteria 2070
202 Ga0105241_10274684 3300009174 Bacteria 1437
203 Ga0105241_10617455 3300009174 Unclassified 981
204 Ga0105242_10240347 3300009176 Bacteria 1628
205 Ga0105242_10790609 3300009176 Bacteria 938
206 Ga0105242_10897658 3300009176 Bacteria 886
207 Ga0105248_10080374 3300009177 Bacteria 3664
208 Ga0105248_10579232 3300009177 Bacteria 1266
209 Ga0105248_10719704 3300009177 Bacteria 1126
210 Ga0105248_11275876 3300009177 Bacteria 831
211 Ga0105237_10322568 3300009545 Bacteria 1548
212 Ga0105237_11312930 3300009545 Bacteria 730
213 Ga0105237_11563474 3300009545 Unclassified 666
214 Ga0105238_10060895 3300009551 Bacteria 3778
215 Ga0105249_10029405 3300009553 Bacteria 4962
216 Ga0105249_10448742 3300009553 Bacteria 1328
217 Ga0105239_10352112 3300010375 Unclassified 1663
218 Ga0105239_11307801 3300010375 Bacteria 836
219 Ga0105246_10163241 3300011119 Bacteria 1699
220 Ga0105246_10236062 3300011119 Bacteria 1443
221 Ga0105246_11867147 3300011119 Unclassified 576
222 Ga0157339_1063953 3300012505 Unclassified 517
223 Ga0157373_10065315 3300013100 Bacteria 2575
224 Ga0157373_11513686 3300013100 Unclassified 512
225 Ga0157371_10632722 3300013102 Bacteria 797
226 Ga0157370_10141679 3300013104 Bacteria 2240
227 Ga0157369_10181180 3300013105 Bacteria 2216
228 Ga0157374_10048678 3300013296 Bacteria 3934
229 Ga0157374_10319115 3300013296 Bacteria 1539
230 Ga0157374_12583250 3300013296 Unclassified 535
231 Ga0157378_10119838 3300013297 Bacteria 2424
232 Ga0157378_10162477 3300013297 Bacteria 2089
233 Ga0157378_12673382 3300013297 Unclassified 552
234 Ga0163162_10192940 3300013306 Unclassified 2165
235 Ga0163162_10314784 3300013306 Bacteria 1698
236 Ga0163162_10668305 3300013306 Bacteria 1162
237 Ga0163162_12867768 3300013306 Bacteria 555
238 Ga0157372_10023159 3300013307 Bacteria 6730
239 Ga0157372_10084833 3300013307 Bacteria 3591
240 Ga0157372_10389842 3300013307 Bacteria 1623
241 Ga0157372_11413570 3300013307 Unclassified 802
242 Ga0157375_10005603 3300013308 Bacteria 10929
243 Ga0157375_10829528 3300013308 Bacteria 1072
244 Ga0163163_10457767 3300014325 Bacteria 1336
245 Ga0163163_10943311 3300014325 Unclassified 926
246 Ga0157379_10001792 3300014968 Bacteria 17740
247 Ga0157379_10024448 3300014968 Bacteria 5363
248 Ga0157379_10637474 3300014968 Bacteria 997
249 Ga0157379_10845888 3300014968 Bacteria 866
250 Ga0157376_10145599 3300014969 Bacteria 2130
251 Ga0157376_10214636 3300014969 Bacteria 1778
252 Ga0157376_10420982 3300014969 Bacteria 1296
253 Ga0224571_105232 3300022734 Bacteria 851
254 Ga0228600_1016769 3300024123 Unclassified 598
255 Ga0224572_1005093 3300024225 Bacteria 2328
256 Ga0224572_1037668 3300024225 Unclassified 914
257 Ga0228598_1001152 3300024227 Bacteria 5826
258 Ga0228598_1042725 3300024227 Unclassified 896
259 Ga0207656_10036965 3300025321 Bacteria 2052
260 Ga0207682_10088650 3300025893 Bacteria 1338
261 Ga0207692_10003857 3300025898 Bacteria 5888
262 Ga0207692_10020990 3300025898 Bacteria 2981
263 Ga0207692_10324776 3300025898 Bacteria 943
264 Ga0207692_11082665 3300025898 Unclassified 530
265 Ga0207642_10143543 3300025899 Bacteria 1262
266 Ga0207710_10062888 3300025900 Bacteria 1688
267 Ga0207710_10514771 3300025900 Unclassified 622
268 Ga0207647_10219469 3300025904 Bacteria 1096
269 Ga0207685_10001524 3300025905 Bacteria 4903
270 Ga0207685_10057218 3300025905 Unclassified 1529
271 Ga0207685_10145965 3300025905 Bacteria 1066
272 Ga0207685_10630610 3300025905 Unclassified 578
273 Ga0207699_10001136 3300025906 Bacteria 12600
274 Ga0207699_10021811 3300025906 Bacteria 3460
275 Ga0207699_10208864 3300025906 Unclassified 1327
276 Ga0207699_10447781 3300025906 Bacteria 926
277 Ga0207699_10614288 3300025906 Bacteria 792
278 Ga0207699_11148223 3300025906 Bacteria 575
279 Ga0207645_10450626 3300025907 Bacteria 869
280 Ga0207684_10005821 3300025910 Bacteria 11298
281 Ga0207684_10073793 3300025910 Bacteria 2898
282 Ga0207654_10015081 3300025911 Bacteria 4002
283 Ga0207654_10024478 3300025911 Bacteria 3247
284 Ga0207654_10085264 3300025911 Bacteria 1912
285 Ga0207654_10413504 3300025911 Unclassified 940
286 Ga0207707_10027083 3300025912 Bacteria 5011
287 Ga0207707_10098652 3300025912 Bacteria 2553
288 Ga0207707_10474502 3300025912 Bacteria 1069
289 Ga0207695_10133952 3300025913 Bacteria 2433
290 Ga0207695_10137761 3300025913 Bacteria 2393
291 Ga0207695_10560452 3300025913 Bacteria 1024
292 Ga0207671_10098578 3300025914 Bacteria 2211
293 Ga0207671_10297041 3300025914 Unclassified 1276
294 Ga0207671_10981179 3300025914 Unclassified 666
295 Ga0207671_11210490 3300025914 Unclassified 591
296 Ga0207671_11454354 3300025914 Unclassified 530
297 Ga0207693_10000016 3300025915 Bacteria 145892
298 Ga0207693_10000065 3300025915 Bacteria 91476
299 Ga0207693_10000467 3300025915 Bacteria 36905
300 Ga0207693_10097262 3300025915 Bacteria 2308
301 Ga0207693_10225574 3300025915 Bacteria 1472
302 Ga0207693_10301766 3300025915 Bacteria 1254
303 Ga0207693_10367135 3300025915 Bacteria 1126
304 Ga0207693_10567082 3300025915 Bacteria 885
305 Ga0207663_10004470 3300025916 Bacteria 6956
306 Ga0207663_10005038 3300025916 Bacteria 6633
307 Ga0207663_10007570 3300025916 Bacteria 5636
308 Ga0207663_10031586 3300025916 Bacteria 3136
309 Ga0207663_10043257 3300025916 Bacteria 2757
310 Ga0207663_10127199 3300025916 Bacteria 1755
311 Ga0207663_10153838 3300025916 Bacteria 1616
312 Ga0207663_10972738 3300025916 Unclassified 680
313 Ga0207663_11067688 3300025916 Unclassified 649
314 Ga0207663_11120906 3300025916 Unclassified 633
315 Ga0207663_11333107 3300025916 Unclassified 578
316 Ga0207660_10193107 3300025917 Bacteria 1587
317 Ga0207660_10968177 3300025917 Bacteria 694
318 Ga0207662_11346049 3300025918 Bacteria 507
319 Ga0207657_10011252 3300025919 Bacteria 8891
320 Ga0207649_10049802 3300025920 Bacteria 2589
321 Ga0207649_11203602 3300025920 Bacteria 599
322 Ga0207652_10041858 3300025921 Bacteria 3896
323 Ga0207646_10041544 3300025922 Bacteria 4134
324 Ga0207646_10044708 3300025922 Unclassified 3975
325 Ga0207646_10093939 3300025922 Bacteria 2686
326 Ga0207646_10190236 3300025922 Bacteria 1854
327 Ga0207646_11699762 3300025922 Unclassified 542
328 Ga0207694_10164168 3300025924 Bacteria 1795
329 Ga0207659_10323961 3300025926 Unclassified 1272
330 Ga0207687_10057591 3300025927 Bacteria 2731
331 Ga0207687_10127999 3300025927 Bacteria 1910
332 Ga0207700_10001701 3300025928 Bacteria 12490
333 Ga0207700_10001772 3300025928 Bacteria 12238
334 Ga0207700_10016606 3300025928 Bacteria 4895
335 Ga0207700_10103988 3300025928 Unclassified 2271
336 Ga0207700_10163167 3300025928 Bacteria 1852
337 Ga0207700_10650839 3300025928 Bacteria 939
338 Ga0207700_11021606 3300025928 Unclassified 740
339 Ga0207700_11219047 3300025928 Unclassified 671
340 Ga0207664_10000098 3300025929 Bacteria 80444
341 Ga0207664_10131242 3300025929 Bacteria 2109
342 Ga0207664_10840614 3300025929 Bacteria 825
343 Ga0207690_10574490 3300025932 Bacteria 918
344 Ga0207706_10000590 3300025933 Bacteria 38531
345 Ga0207686_10032810 3300025934 Bacteria 3093
346 Ga0207686_11612060 3300025934 Unclassified 536
347 Ga0207709_10358678 3300025935 Bacteria 1103
348 Ga0207669_10716928 3300025937 Bacteria 823
349 Ga0207665_10005642 3300025939 Bacteria 8344
350 Ga0207665_10017983 3300025939 Bacteria 4647
351 Ga0207665_10025469 3300025939 Bacteria 3903
352 Ga0207665_10043179 3300025939 Bacteria 3014
353 Ga0207665_10047088 3300025939 Bacteria 2890
354 Ga0207665_10182520 3300025939 Bacteria 1520
355 Ga0207665_10194240 3300025939 Bacteria 1476
356 Ga0207665_10234617 3300025939 Bacteria 1349
357 Ga0207665_10485271 3300025939 Bacteria 953
358 Ga0207665_10513089 3300025939 Bacteria 927
359 Ga0207711_10007737 3300025941 Bacteria 8978
360 Ga0207711_10147620 3300025941 Bacteria 2120
361 Ga0207689_10045944 3300025942 Bacteria 3610
362 Ga0207661_10847012 3300025944 Bacteria 842
363 Ga0207679_10403404 3300025945 Bacteria 1203
364 Ga0207667_10086715 3300025949 Bacteria 3239
365 Ga0207712_10282256 3300025961 Bacteria 1356
366 Ga0207668_10010105 3300025972 Bacteria 5688
367 Ga0207640_10545464 3300025981 Bacteria 973
368 Ga0207658_10025179 3300025986 Bacteria 4166
369 Ga0207658_10959131 3300025986 Bacteria 780
370 Ga0207677_10181975 3300026023 Bacteria 1654
371 Ga0207703_10097089 3300026035 Bacteria 2489
372 Ga0207703_11295541 3300026035 Bacteria 701
373 Ga0207703_11430120 3300026035 Unclassified 665
374 Ga0207639_10151750 3300026041 Bacteria 1941
375 Ga0207678_10003766 3300026067 Bacteria 13638
376 Ga0207702_10072978 3300026078 Bacteria 2959
377 Ga0207702_10905238 3300026078 Bacteria 874
378 Ga0207702_11300500 3300026078 Bacteria 721
379 Ga0207702_12121245 3300026078 Unclassified 551
380 Ga0207641_10066111 3300026088 Unclassified 3095
381 Ga0207648_10002534 3300026089 Bacteria 19609
382 Ga0207676_10145695 3300026095 Unclassified 2034
383 Ga0207683_10986382 3300026121 Bacteria 782
384 Ga0207698_10153013 3300026142 Bacteria 2005
385 Ga0207428_10832494 3300027907 Bacteria 654
386 Ga0265356_1029839 3300028017 Unclassified 592
387 Ga0265357_1030986 3300028023 Unclassified 611
388 Ga0268265_10146740 3300028380 Bacteria 1983
389 Ga0268264_10049672 3300028381 Bacteria 3491
390 Ga0268264_10270946 3300028381 Bacteria 1586
391 Ga0268264_11008139 3300028381 Bacteria 839
392 Ga0265338_10000716 3300028800 Bacteria 56718
393 Ga0265338_10101137 3300028800 Bacteria 2348
394 Ga0265338_10135009 3300028800 Bacteria 1941
395 Ga0265338_10157292 3300028800 Bacteria 1759
396 Ga0265338_10277862 3300028800 Unclassified 1225
397 Ga0265762_1002722 3300030760 Bacteria 3161
398 Ga0265762_1011214 3300030760 Bacteria 1603
399 Ga0265770_1013185 3300030878 Bacteria 1233
400 Ga0265760_10031605 3300031090 Bacteria 1561
401 Ga0265760_10290782 3300031090 Unclassified 577
402 Ga0265340_10060646 3300031247 Bacteria 1811
403 Ga0265339_10029063 3300031249 Bacteria 3139
404 Ga0265339_10178648 3300031249 Bacteria 1058
405 Ga0265316_10000652 3300031344 Bacteria 38558
406 Ga0265316_10006032 3300031344 Bacteria 11643
407 Ga0265316_10195675 3300031344 Bacteria 1500
408 Ga0265316_10235101 3300031344 Bacteria 1348
409 Ga0265316_10592316 3300031344 Bacteria 787
410 Ga0265316_10885614 3300031344 Unclassified 624
411 Ga0265316_11262558 3300031344 Unclassified 510
412 Ga0265314_10000572 3300031711 Bacteria 46833
413 Ga0265314_10064871 3300031711 Bacteria 2470
414 Ga0265314_10189439 3300031711 Bacteria 1225
415 Ga0307416_103596955 3300032002 Unclassified 519
416 Ga0316212_1001045 3300033547 Bacteria 3666
417 Ga0373930_0128441 3300034816 Bacteria 622
418 Ga0373950_0073282 3300034818 Bacteria 705
419 Ga0373959_0055771 3300034820 Bacteria 864
420 Ga0373926_0149821 3300035083 Unclassified 888
421 Ga0373926_0311991 3300035083 Unclassified 615
422 Ga0373926_0312920 3300035083 Unclassified 614
423 Ga0373926_0334143 3300035083 Bacteria 594
424 Ga0373928_0070590 3300035084 Bacteria 863
425 Ga0373928_0235671 3300035084 Unclassified 540
426 Ga0373934_0018523 3300035086 Unclassified 2665
427 Ga0373940_0037665 3300035088 Bacteria 1317
428 Ga0373923_0064482 3300035111 Bacteria 1562
429 Ga0373923_0092781 3300035111 Bacteria 1323
430 Ga0373932_0109575 3300035112 Bacteria 908
431 Ga0373936_0006947 3300035113 Bacteria 4260
432 Ga0373936_0010612 3300035113 Bacteria 3477
433 Ga0373945_0007745 3300035116 Bacteria 3484
434 Ga0373945_0048130 3300035116 Unclassified 1561
435 Ga0373953_0021632 3300035117 Unclassified 2416
436 Ga0373954_0035138 3300035118 Bacteria 2323
437 Ga0373956_0116467 3300035119 Unclassified 1246
438 Ga0373957_0062102 3300035120 Unclassified 1449
439 Ga0373960_0121108 3300035121 Bacteria 868
440 Ga0373943_0000652 3300035170 Bacteria 15006
441 Ga0373943_0055244 3300035170 Unclassified 1966
442 Ga0373943_0856913 3300035170 Bacteria 542
443 Ga0373946_0052307 3300035171 Unclassified 1713
444 Ga0373955_0035719 3300035172 Unclassified 2633
445 Ga0373942_0090497 3300035207 Bacteria 921
446 Ga0373961_0331115 3300035241 Bacteria 570
447 Ga0373924_0050754 3300035410 Bacteria 1718
448 Ga0373924_0249398 3300035410 Unclassified 786
449 Ga0373924_0541235 3300035410 Bacteria 524
450 Ga0373931_0041032 3300035691 Bacteria 2430
451 Ga0373931_0380722 3300035691 Bacteria 889
452 Ga0373935_0003067 3300035692 Bacteria 9629
453 Ga0373935_0003233 3300035692 Bacteria 9415
454 Ga0373935_0062609 3300035692 Bacteria 2383
455 Ga0373935_0360671 3300035692 Bacteria 1038
456 Ga0373935_0426497 3300035692 Bacteria 955
457 Ga0373927_0000282 3300035695 Bacteria 40021
458 Ga0373927_0024041 3300035695 Bacteria 3986
459 Ga0373927_0168656 3300035695 Unclassified 1435
460 Ga0373927_0176179 3300035695 Unclassified 1402
461 Ga0373933_0028605 3300035724 Bacteria 3217
462 Ga0373933_0456104 3300035724 Unclassified 836
463 Ga0373947_0001095 3300035725 Bacteria 16615
464 Ga0373947_0385106 3300035725 Unclassified 944
465 Ga0373947_1215164 3300035725 Unclassified 513
466 Ga0373937_0265061 3300036401 Bacteria 1621
467 Ga0373937_0642095 3300036401 Bacteria 1007
468 Ga0373937_0769456 3300036401 Bacteria 910
469 Ga0373937_0910441 3300036401 Bacteria 828
470 Ga0373925_0001335 3300037068 Bacteria 21578
471 Ga0373925_0022875 3300037068 Unclassified 4561
472 Ga0373925_0035759 3300037068 Bacteria 3666
473 Ga0373925_0039815 3300037068 Bacteria 3478
474 Ga0373925_0061179 3300037068 Bacteria 2828
475 Ga0373925_1035447 3300037068 Bacteria 676
476 Ga0395900_1693970 3300037418 Unclassified 543
477 Ga0242420_013682 3300038996 Bacteria 1385
478 Ga0436360_1114409 3300039438 Unclassified 673
479 Ga0451577_0339432 3300042876 Bacteria 1363
480 Ga0466966_0735325 3300044684 Bacteria 595
481 Ga0466964_0140527 3300044706 Bacteria 1109
482 Ga0453684_2316560 3300044712 Bacteria 534
483 Ga0451576_0041599 3300045051 Unclassified 4858
484 Ga0451576_0651143 3300045051 Bacteria 1107
485 Ga0451576_2062699 3300045051 Bacteria 587
486 Ga0466967_0150332 3300045976 Bacteria 2176
487 Ga0495592_0481341 3300046454 Unclassified 773
488 Ga0495603_0540385 3300046455 Unclassified 667
489 Ga0495629_0100974 3300046459 Unclassified 2013
490 Ga0495653_0266156 3300046463 Bacteria 1131
491 Ga0495580_0000774 3300046472 Bacteria 27522
492 Ga0495580_0002088 3300046472 Bacteria 17538
493 Ga0495580_0008640 3300046472 Bacteria 8078
494 Ga0495580_0068240 3300046472 Bacteria 2487
495 Ga0495580_0101148 3300046472 Bacteria 2005
496 Ga0495580_0114169 3300046472 Bacteria 1876
497 Ga0495580_0619066 3300046472 Bacteria 714
498 Ga0495582_0006163 3300046473 Bacteria 6676
499 Ga0495582_0068893 3300046473 Bacteria 1956
500 Ga0495582_0536272 3300046473 Unclassified 677
501 Ga0495584_0405051 3300046491 Bacteria 693
502 Ga0495630_0391055 3300046517 Bacteria 1065
503 Ga0495630_0573148 3300046517 Unclassified 865
504 Ga0495630_0587971 3300046517 Unclassified 853
505 Ga0495652_0415069 3300046529 Unclassified 950
506 Ga0495665_0101208 3300046531 Bacteria 1512
507 Ga0495640_0801331 3300046533 Unclassified 561
508 Ga0495586_0363855 3300046535 Unclassified 831
509 Ga0495635_0119034 3300046663 Bacteria 1802
510 Ga0495635_0236981 3300046663 Unclassified 1232
511 Ga0495588_0665229 3300046674 Unclassified 545
512 Ga0495657_0887224 3300046675 Unclassified 507
513 Ga0495599_0539864 3300046678 Unclassified 683
514 Ga0495623_0665915 3300046679 Unclassified 536
515 Ga0495658_0006630 3300046683 Bacteria 5690
516 Ga0495669_0191089 3300046684 Bacteria 977
517 Ga0495624_0690023 3300046690 Bacteria 606
518 Ga0495581_0125259 3300047315 Unclassified 1496
519 Ga0495581_0275983 3300047315 Unclassified 983
520 Ga0495674_0007090 3300047319 Bacteria 10725
521 Ga0495674_0088728 3300047319 Bacteria 2644
522 Ga0495674_0107971 3300047319 Bacteria 2362
523 Ga0495676_0215035 3300047321 Unclassified 1328
524 Ga0495684_0362082 3300047471 Unclassified 1027
525 Ga0495593_0269294 3300047673 Unclassified 852
526 Ga0495593_0581987 3300047673 Unclassified 562
527 Ga0495602_0448048 3300048088 Unclassified 912
528 Ga0496100_0073349 3300048903 Bacteria 2290
529 Ga0496100_1018880 3300048903 Unclassified 652
530 Ga0496101_0024453 3300048904 Bacteria 4181
531 Ga0496101_0198438 3300048904 Bacteria 1550
532 Ga0496101_0502367 3300048904 Bacteria 958
533 Ga0496101_0998519 3300048904 Bacteria 658
534 Ga0496102_0000882 3300048905 Bacteria 28596
535 Ga0496102_0278918 3300048905 Bacteria 1575
536 Ga0496102_0310551 3300048905 Bacteria 1486
537 Ga0496102_0668266 3300048905 Bacteria 962
538 Ga0496103_0010332 3300048906 Bacteria 5524
539 Ga0496103_0019618 3300048906 Bacteria 4059
540 Ga0496104_0079680 3300048907 Unclassified 3122
541 Ga0496104_0164806 3300048907 Bacteria 2125
542 Ga0496105_0057191 3300048908 Bacteria 3221
543 Ga0496105_0069913 3300048908 Bacteria 2902
544 Ga0496105_0468280 3300048908 Bacteria 993
545 Ga0496106_0010794 3300048909 Bacteria 6753
546 Ga0496106_0181497 3300048909 Bacteria 1671
547 Ga0496107_0004478 3300048910 Bacteria 9475
548 Ga0496107_0034006 3300048910 Bacteria 3649
549 Ga0496107_0623884 3300048910 Bacteria 796
550 Ga0496108_0281737 3300048911 Bacteria 1447
551 Ga0496110_1749802 3300048913 Unclassified 532
552 Ga0496111_0300461 3300048914 Bacteria 1190
553 Ga0496112_0367361 3300048915 Bacteria 1380
554 Ga0496113_0628439 3300048916 Bacteria 859
555 Ga0496114_0159719 3300048917 Bacteria 1959
556 Ga0496114_0337848 3300048917 Bacteria 1332
557 Ga0496115_0024296 3300048918 Unclassified 4709
558 Ga0496115_0302514 3300048918 Bacteria 1310
559 Ga0496115_0667439 3300048918 Bacteria 820
560 Ga0496115_0851176 3300048918 Unclassified 706
561 Ga0496126_0328818 3300048929 Unclassified 1255
562 Ga0501032_0930639 3300049569 Unclassified 547
563 Ga0501047_0144467 3300049581 Bacteria 2257
564 Ga0501069_0004579 3300049585 Bacteria 7151
565 Ga0501070_0326842 3300049586 Bacteria 1247
566 Ga0501044_0000602 3300049823 Bacteria 43645
567 Ga0501044_0001219 3300049823 Bacteria 30541
568 nmdc:mga08y16_1128749_c1 3300050511 Bacteria 758
569 nmdc:mga0n895_213062_c1 3300050512 Bacteria 1962
570 nmdc:mga0rr50_1201033_c1 3300050513 Unclassified 644
571 nmdc:mga0rr50_1272758_c1 3300050513 Bacteria 624
572 nmdc:mga0rr50_298416_c1 3300050513 Bacteria 1347
573 nmdc:mga08x19_105104_c1 3300050514 Bacteria 1877
574 Ga0495601_0407885 3300053077 Unclassified 880
575 Ga0495619_0043233 3300053085 Bacteria 2953
576 Ga0495619_0626984 3300053085 Unclassified 735
577 Ga0495619_0664253 3300053085 Unclassified 710
578 Ga0501082_0016497 3300060353 Bacteria 6356

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0144467 Ga0501047_0144467_688_921 57
2 3300049586 Ga0501070_0326842 Ga0501070_0326842_704_937 57
3 3300049823 Ga0501044_0000602 Ga0501044_0000602_34383_34616 57
4 3300049823 Ga0501044_0001219 Ga0501044_0001219_16732_16965 57
5 3300049569 Ga0501032_0930639 Ga0501032_0930639_45_278 58
6 3300049585 Ga0501069_0004579 Ga0501069_0004579_23_202 58
7 3300060353 Ga0501082_0016497 Ga0501082_0016497_24_203 58
8 3300005354 Ga0070675_100951260 Ga0070675_1009512601 62
9 3300005618 Ga0068864_100627181 Ga0068864_1006271812 62
10 3300005841 Ga0068863_101239260 Ga0068863_1012392602 62
11 3300009177 Ga0105248_10579232 Ga0105248_105792322 62
12 3300013296 Ga0157374_10319115 Ga0157374_103191152 62
13 3300013306 Ga0163162_12867768 Ga0163162_128677682 62
14 3300013308 Ga0157375_10829528 Ga0157375_108295282 62
15 3300014325 Ga0163163_10943311 Ga0163163_109433112 62
16 3300025941 Ga0207711_10147620 Ga0207711_101476202 62
17 3300026095 Ga0207676_10145695 Ga0207676_101456952 62
18 3300048913 Ga0496110_1749802 Ga0496110_1749802_218_421 62
19 3300005539 Ga0068853_102119339 Ga0068853_1021193392 63
20 3300032002 Ga0307416_103596955 Ga0307416_1035969552 63
21 3300005436 Ga0070713_102111555 Ga0070713_1021115551 66
22 3300045051 Ga0451576_2062699 Ga0451576_2062699_58_276 66
23 3300005336 Ga0070680_100381016 Ga0070680_1003810162 67
24 3300005434 Ga0070709_10000540 Ga0070709_1000054012 67
25 3300005434 Ga0070709_10338224 Ga0070709_103382241 67
26 3300005434 Ga0070709_10516307 Ga0070709_105163072 67
27 3300005434 Ga0070709_10875202 Ga0070709_108752021 67
28 3300005434 Ga0070709_11261560 Ga0070709_112615602 67
29 3300005435 Ga0070714_100199151 Ga0070714_1001991512 67
30 3300005435 Ga0070714_100674061 Ga0070714_1006740612 67
31 3300005435 Ga0070714_100966012 Ga0070714_1009660122 67
32 3300005435 Ga0070714_101156822 Ga0070714_1011568221 67
33 3300005435 Ga0070714_101908540 Ga0070714_1019085401 67
34 3300005435 Ga0070714_101949997 Ga0070714_1019499971 67
35 3300005436 Ga0070713_100000909 Ga0070713_1000009094 67
36 3300005436 Ga0070713_100001436 Ga0070713_1000014367 67
37 3300005436 Ga0070713_100011192 Ga0070713_1000111924 67
38 3300005436 Ga0070713_100279625 Ga0070713_1002796252 67
39 3300005436 Ga0070713_100283626 Ga0070713_1002836262 67
40 3300005436 Ga0070713_100378854 Ga0070713_1003788541 67
41 3300005436 Ga0070713_100385193 Ga0070713_1003851932 67
42 3300005436 Ga0070713_100880676 Ga0070713_1008806762 67
43 3300005436 Ga0070713_100946419 Ga0070713_1009464192 67
44 3300005437 Ga0070710_10016640 Ga0070710_100166403 67
45 3300005437 Ga0070710_10033073 Ga0070710_100330732 67
46 3300005437 Ga0070710_10139218 Ga0070710_101392182 67
47 3300005437 Ga0070710_10532351 Ga0070710_105323512 67
48 3300005437 Ga0070710_11282272 Ga0070710_112822722 67
49 3300005439 Ga0070711_100000291 Ga0070711_10000029110 67
50 3300005439 Ga0070711_100006753 Ga0070711_1000067536 67
51 3300005439 Ga0070711_100037847 Ga0070711_1000378472 67
52 3300005439 Ga0070711_100045534 Ga0070711_1000455342 67
53 3300005439 Ga0070711_100267372 Ga0070711_1002673722 67
54 3300005439 Ga0070711_100388022 Ga0070711_1003880222 67
55 3300005439 Ga0070711_101159458 Ga0070711_1011594582 67
56 3300005445 Ga0070708_100002397 Ga0070708_1000023973 67
57 3300005445 Ga0070708_100152009 Ga0070708_1001520092 67
58 3300005458 Ga0070681_10037931 Ga0070681_100379314 67
59 3300005467 Ga0070706_100126839 Ga0070706_1001268392 67
60 3300005467 Ga0070706_100873724 Ga0070706_1008737242 67
61 3300005468 Ga0070707_100260566 Ga0070707_1002605662 67
62 3300005471 Ga0070698_100115556 Ga0070698_1001155562 67
63 3300005530 Ga0070679_100611341 Ga0070679_1006113411 67
64 3300005564 Ga0070664_101728523 Ga0070664_1017285232 67
65 3300005614 Ga0068856_102409055 Ga0068856_1024090552 67
66 3300005983 Ga0081540_1045576 Ga0081540_10455763 67
67 3300006028 Ga0070717_10001140 Ga0070717_100011406 67
68 3300006028 Ga0070717_10011272 Ga0070717_100112722 67
69 3300006028 Ga0070717_10030213 Ga0070717_100302132 67
70 3300006028 Ga0070717_10033310 Ga0070717_100333102 67
71 3300006028 Ga0070717_10047492 Ga0070717_100474922 67
72 3300006028 Ga0070717_10061732 Ga0070717_100617322 67
73 3300006028 Ga0070717_10062767 Ga0070717_100627672 67
74 3300006028 Ga0070717_10420639 Ga0070717_104206392 67
75 3300006028 Ga0070717_10427351 Ga0070717_104273512 67
76 3300006163 Ga0070715_10004799 Ga0070715_100047992 67
77 3300006163 Ga0070715_10008869 Ga0070715_100088692 67
78 3300006173 Ga0070716_100009213 Ga0070716_1000092131 67
79 3300006173 Ga0070716_100215544 Ga0070716_1002155442 67
80 3300006173 Ga0070716_100256695 Ga0070716_1002566952 67
81 3300006173 Ga0070716_100749186 Ga0070716_1007491862 67
82 3300006175 Ga0070712_100000105 Ga0070712_10000010533 67
83 3300006175 Ga0070712_100001546 Ga0070712_1000015465 67
84 3300006175 Ga0070712_100107130 Ga0070712_1001071302 67
85 3300006175 Ga0070712_100452727 Ga0070712_1004527272 67
86 3300006175 Ga0070712_100833396 Ga0070712_1008333962 67
87 3300007076 Ga0075435_101608624 Ga0075435_1016086242 67
88 3300007788 Ga0099795_10040407 Ga0099795_100404072 67
89 3300009093 Ga0105240_10016327 Ga0105240_100163276 67
90 3300009174 Ga0105241_10125772 Ga0105241_101257722 67
91 3300009545 Ga0105237_10322568 Ga0105237_103225682 67
92 3300011119 Ga0105246_11867147 Ga0105246_118671472 67
93 3300012505 Ga0157339_1063953 Ga0157339_10639531 67
94 3300013100 Ga0157373_11513686 Ga0157373_115136862 67
95 3300013307 Ga0157372_10023159 Ga0157372_100231595 67
96 3300013307 Ga0157372_10389842 Ga0157372_103898422 67
97 3300014969 Ga0157376_10420982 Ga0157376_104209822 67
98 3300024225 Ga0224572_1037668 Ga0224572_10376682 67
99 3300025898 Ga0207692_10003857 Ga0207692_100038574 67
100 3300025898 Ga0207692_10020990 Ga0207692_100209902 67
101 3300025898 Ga0207692_10324776 Ga0207692_103247762 67
102 3300025905 Ga0207685_10001524 Ga0207685_100015242 67
103 3300025906 Ga0207699_10001136 Ga0207699_100011364 67
104 3300025906 Ga0207699_10208864 Ga0207699_102088642 67
105 3300025906 Ga0207699_10614288 Ga0207699_106142882 67
106 3300025910 Ga0207684_10073793 Ga0207684_100737933 67
107 3300025911 Ga0207654_10413504 Ga0207654_104135042 67
108 3300025912 Ga0207707_10098652 Ga0207707_100986522 67
109 3300025912 Ga0207707_10474502 Ga0207707_104745021 67
110 3300025913 Ga0207695_10137761 Ga0207695_101377612 67
111 3300025914 Ga0207671_11210490 Ga0207671_112104902 67
112 3300025915 Ga0207693_10000016 Ga0207693_10000016113 67
113 3300025915 Ga0207693_10000065 Ga0207693_1000006537 67
114 3300025915 Ga0207693_10225574 Ga0207693_102255742 67
115 3300025915 Ga0207693_10301766 Ga0207693_103017662 67
116 3300025915 Ga0207693_10367135 Ga0207693_103671352 67
117 3300025916 Ga0207663_10004470 Ga0207663_100044706 67
118 3300025916 Ga0207663_10007570 Ga0207663_100075702 67
119 3300025916 Ga0207663_10031586 Ga0207663_100315863 67
120 3300025916 Ga0207663_10043257 Ga0207663_100432572 67
121 3300025916 Ga0207663_10153838 Ga0207663_101538382 67
122 3300025916 Ga0207663_11067688 Ga0207663_110676882 67
123 3300025917 Ga0207660_10193107 Ga0207660_101931072 67
124 3300025922 Ga0207646_10093939 Ga0207646_100939393 67
125 3300025928 Ga0207700_10001701 Ga0207700_100017012 67
126 3300025928 Ga0207700_10001772 Ga0207700_100017728 67
127 3300025928 Ga0207700_10016606 Ga0207700_100166064 67
128 3300025928 Ga0207700_10103988 Ga0207700_101039882 67
129 3300025928 Ga0207700_10163167 Ga0207700_101631672 67
130 3300025928 Ga0207700_10650839 Ga0207700_106508392 67
131 3300025928 Ga0207700_11021606 Ga0207700_110216062 67
132 3300025929 Ga0207664_10000098 Ga0207664_1000009828 67
133 3300025929 Ga0207664_10131242 Ga0207664_101312422 67
134 3300025929 Ga0207664_10840614 Ga0207664_108406142 67
135 3300025939 Ga0207665_10005642 Ga0207665_100056426 67
136 3300025939 Ga0207665_10025469 Ga0207665_100254694 67
137 3300025939 Ga0207665_10043179 Ga0207665_100431793 67
138 3300025939 Ga0207665_10047088 Ga0207665_100470883 67
139 3300025939 Ga0207665_10234617 Ga0207665_102346172 67
140 3300025939 Ga0207665_10485271 Ga0207665_104852711 67
141 3300025944 Ga0207661_10847012 Ga0207661_108470122 67
142 3300025945 Ga0207679_10403404 Ga0207679_104034042 67
143 3300026078 Ga0207702_10905238 Ga0207702_109052382 67
144 3300028800 Ga0265338_10000716 Ga0265338_1000071627 67
145 3300028800 Ga0265338_10101137 Ga0265338_101011372 67
146 3300028800 Ga0265338_10135009 Ga0265338_101350091 67
147 3300028800 Ga0265338_10157292 Ga0265338_101572922 67
148 3300031249 Ga0265339_10178648 Ga0265339_101786481 67
149 3300031344 Ga0265316_10006032 Ga0265316_100060327 67
150 3300031344 Ga0265316_10195675 Ga0265316_101956752 67
151 3300031344 Ga0265316_10235101 Ga0265316_102351012 67
152 3300031344 Ga0265316_10592316 Ga0265316_105923162 67
153 3300031344 Ga0265316_11262558 Ga0265316_112625582 67
154 3300035083 Ga0373926_0149821 Ga0373926_0149821_84_323 67
155 3300035083 Ga0373926_0311991 Ga0373926_0311991_77_316 67
156 3300035083 Ga0373926_0334143 Ga0373926_0334143_23_226 67
157 3300035086 Ga0373934_0018523 Ga0373934_0018523_206_445 67
158 3300035111 Ga0373923_0064482 Ga0373923_0064482_876_1115 67
159 3300035113 Ga0373936_0006947 Ga0373936_0006947_2924_3163 67
160 3300035113 Ga0373936_0010612 Ga0373936_0010612_2912_3151 67
161 3300035116 Ga0373945_0007745 Ga0373945_0007745_2108_2347 67
162 3300035116 Ga0373945_0048130 Ga0373945_0048130_569_808 67
163 3300035117 Ga0373953_0021632 Ga0373953_0021632_2157_2396 67
164 3300035118 Ga0373954_0035138 Ga0373954_0035138_1099_1338 67
165 3300035119 Ga0373956_0116467 Ga0373956_0116467_338_577 67
166 3300035120 Ga0373957_0062102 Ga0373957_0062102_460_699 67
167 3300035170 Ga0373943_0000652 Ga0373943_0000652_1755_1994 67
168 3300035170 Ga0373943_0055244 Ga0373943_0055244_1429_1668 67
169 3300035170 Ga0373943_0856913 Ga0373943_0856913_204_407 67
170 3300035171 Ga0373946_0052307 Ga0373946_0052307_255_494 67
171 3300035172 Ga0373955_0035719 Ga0373955_0035719_1593_1832 67
172 3300035410 Ga0373924_0050754 Ga0373924_0050754_654_893 67
173 3300035410 Ga0373924_0249398 Ga0373924_0249398_53_292 67
174 3300035410 Ga0373924_0541235 Ga0373924_0541235_25_228 67
175 3300035692 Ga0373935_0003067 Ga0373935_0003067_2746_2985 67
176 3300035692 Ga0373935_0003233 Ga0373935_0003233_8813_9052 67
177 3300035692 Ga0373935_0062609 Ga0373935_0062609_1796_2035 67
178 3300035692 Ga0373935_0360671 Ga0373935_0360671_342_581 67
179 3300035695 Ga0373927_0000282 Ga0373927_0000282_26133_26372 67
180 3300035695 Ga0373927_0168656 Ga0373927_0168656_626_829 67
181 3300035695 Ga0373927_0176179 Ga0373927_0176179_680_919 67
182 3300035724 Ga0373933_0028605 Ga0373933_0028605_306_545 67
183 3300035724 Ga0373933_0456104 Ga0373933_0456104_144_383 67
184 3300035725 Ga0373947_0001095 Ga0373947_0001095_2570_2809 67
185 3300035725 Ga0373947_0385106 Ga0373947_0385106_110_349 67
186 3300036401 Ga0373937_0265061 Ga0373937_0265061_70_309 67
187 3300036401 Ga0373937_0642095 Ga0373937_0642095_496_735 67
188 3300036401 Ga0373937_0769456 Ga0373937_0769456_29_244 67
189 3300036401 Ga0373937_0910441 Ga0373937_0910441_434_673 67
190 3300037068 Ga0373925_0001335 Ga0373925_0001335_7792_8031 67
191 3300037068 Ga0373925_0022875 Ga0373925_0022875_817_1020 67
192 3300037068 Ga0373925_0035759 Ga0373925_0035759_1923_2162 67
193 3300037418 Ga0395900_1693970 Ga0395900_1693970_272_493 67
194 3300044706 Ga0466964_0140527 Ga0466964_0140527_530_769 67
195 3300045976 Ga0466967_0150332 Ga0466967_0150332_793_1032 67
196 3300046454 Ga0495592_0481341 Ga0495592_0481341_243_482 67
197 3300046455 Ga0495603_0540385 Ga0495603_0540385_93_332 67
198 3300046459 Ga0495629_0100974 Ga0495629_0100974_1359_1598 67
199 3300046463 Ga0495653_0266156 Ga0495653_0266156_462_701 67
200 3300046472 Ga0495580_0000774 Ga0495580_0000774_25097_25336 67
201 3300046472 Ga0495580_0068240 Ga0495580_0068240_42_281 67
202 3300046472 Ga0495580_0101148 Ga0495580_0101148_1751_1990 67
203 3300046472 Ga0495580_0114169 Ga0495580_0114169_1360_1563 67
204 3300046472 Ga0495580_0619066 Ga0495580_0619066_104_343 67
205 3300046473 Ga0495582_0006163 Ga0495582_0006163_2697_2936 67
206 3300046473 Ga0495582_0536272 Ga0495582_0536272_386_625 67
207 3300046491 Ga0495584_0405051 Ga0495584_0405051_280_519 67
208 3300046517 Ga0495630_0573148 Ga0495630_0573148_307_546 67
209 3300046517 Ga0495630_0587971 Ga0495630_0587971_170_409 67
210 3300046529 Ga0495652_0415069 Ga0495652_0415069_248_487 67
211 3300046535 Ga0495586_0363855 Ga0495586_0363855_117_356 67
212 3300046663 Ga0495635_0119034 Ga0495635_0119034_328_567 67
213 3300046663 Ga0495635_0236981 Ga0495635_0236981_401_640 67
214 3300046674 Ga0495588_0665229 Ga0495588_0665229_235_474 67
215 3300046675 Ga0495657_0887224 Ga0495657_0887224_24_263 67
216 3300046678 Ga0495599_0539864 Ga0495599_0539864_31_270 67
217 3300046679 Ga0495623_0665915 Ga0495623_0665915_156_395 67
218 3300046683 Ga0495658_0006630 Ga0495658_0006630_863_1102 67
219 3300046690 Ga0495624_0690023 Ga0495624_0690023_336_575 67
220 3300047315 Ga0495581_0125259 Ga0495581_0125259_702_941 67
221 3300047319 Ga0495674_0007090 Ga0495674_0007090_6043_6282 67
222 3300047319 Ga0495674_0088728 Ga0495674_0088728_1685_1924 67
223 3300047319 Ga0495674_0107971 Ga0495674_0107971_1479_1718 67
224 3300047321 Ga0495676_0215035 Ga0495676_0215035_730_969 67
225 3300047471 Ga0495684_0362082 Ga0495684_0362082_226_465 67
226 3300047673 Ga0495593_0269294 Ga0495593_0269294_573_812 67
227 3300047673 Ga0495593_0581987 Ga0495593_0581987_116_355 67
228 3300048088 Ga0495602_0448048 Ga0495602_0448048_317_556 67
229 3300048904 Ga0496101_0502367 Ga0496101_0502367_541_780 67
230 3300048907 Ga0496104_0079680 Ga0496104_0079680_938_1177 67
231 3300048908 Ga0496105_0069913 Ga0496105_0069913_812_1051 67
232 3300048917 Ga0496114_0337848 Ga0496114_0337848_948_1187 67
233 3300048918 Ga0496115_0024296 Ga0496115_0024296_3739_3978 67
234 3300048918 Ga0496115_0667439 Ga0496115_0667439_564_803 67
235 3300050513 nmdc:mga0rr50_1201033_c1 nmdc:mga0rr50_1201033_c1_66_272 67
236 3300053077 Ga0495601_0407885 Ga0495601_0407885_189_428 67
237 3300053085 Ga0495619_0626984 Ga0495619_0626984_104_343 67
238 3300053085 Ga0495619_0664253 Ga0495619_0664253_359_598 67
239 3300005293 Ga0065715_10012049 Ga0065715_100120493 68
240 3300005293 Ga0065715_10291325 Ga0065715_102913252 68
241 3300005328 Ga0070676_10758800 Ga0070676_107588001 68
242 3300005330 Ga0070690_100431156 Ga0070690_1004311562 68
243 3300005330 Ga0070690_100795060 Ga0070690_1007950601 68
244 3300005334 Ga0068869_100143063 Ga0068869_1001430632 68
245 3300005335 Ga0070666_10231411 Ga0070666_102314112 68
246 3300005335 Ga0070666_10559130 Ga0070666_105591302 68
247 3300005336 Ga0070680_100437425 Ga0070680_1004374252 68
248 3300005337 Ga0070682_100110346 Ga0070682_1001103462 68
249 3300005338 Ga0068868_100830957 Ga0068868_1008309572 68
250 3300005339 Ga0070660_100596400 Ga0070660_1005964002 68
251 3300005341 Ga0070691_10105384 Ga0070691_101053842 68
252 3300005343 Ga0070687_100300139 Ga0070687_1003001392 68
253 3300005344 Ga0070661_100004744 Ga0070661_1000047446 68
254 3300005345 Ga0070692_11105907 Ga0070692_111059072 68
255 3300005347 Ga0070668_100015991 Ga0070668_1000159915 68
256 3300005353 Ga0070669_100072940 Ga0070669_1000729402 68
257 3300005354 Ga0070675_100838139 Ga0070675_1008381392 68
258 3300005356 Ga0070674_100289838 Ga0070674_1002898381 68
259 3300005366 Ga0070659_100090683 Ga0070659_1000906832 68
260 3300005367 Ga0070667_100056467 Ga0070667_1000564673 68
261 3300005434 Ga0070709_10077720 Ga0070709_100777201 68
262 3300005434 Ga0070709_10550133 Ga0070709_105501332 68
263 3300005434 Ga0070709_10731817 Ga0070709_107318172 68
264 3300005434 Ga0070709_11590438 Ga0070709_115904382 68
265 3300005435 Ga0070714_100273911 Ga0070714_1002739112 68
266 3300005435 Ga0070714_101750216 Ga0070714_1017502162 68
267 3300005436 Ga0070713_100102674 Ga0070713_1001026742 68
268 3300005436 Ga0070713_100634320 Ga0070713_1006343202 68
269 3300005436 Ga0070713_101055172 Ga0070713_1010551722 68
270 3300005437 Ga0070710_10050045 Ga0070710_100500453 68
271 3300005437 Ga0070710_11043134 Ga0070710_110431341 68
272 3300005437 Ga0070710_11117807 Ga0070710_111178071 68
273 3300005438 Ga0070701_10882907 Ga0070701_108829072 68
274 3300005439 Ga0070711_100008437 Ga0070711_1000084373 68
275 3300005439 Ga0070711_100067261 Ga0070711_1000672612 68
276 3300005439 Ga0070711_100170426 Ga0070711_1001704262 68
277 3300005439 Ga0070711_100924632 Ga0070711_1009246321 68
278 3300005440 Ga0070705_100321534 Ga0070705_1003215342 68
279 3300005440 Ga0070705_100446607 Ga0070705_1004466072 68
280 3300005441 Ga0070700_100135830 Ga0070700_1001358302 68
281 3300005444 Ga0070694_100115102 Ga0070694_1001151022 68
282 3300005445 Ga0070708_100025156 Ga0070708_1000251563 68
283 3300005445 Ga0070708_100497723 Ga0070708_1004977231 68
284 3300005455 Ga0070663_100082046 Ga0070663_1000820462 68
285 3300005456 Ga0070678_100775577 Ga0070678_1007755772 68
286 3300005457 Ga0070662_100020862 Ga0070662_1000208623 68
287 3300005458 Ga0070681_11191591 Ga0070681_111915911 68
288 3300005459 Ga0068867_100486317 Ga0068867_1004863172 68
289 3300005467 Ga0070706_100001716 Ga0070706_10000171614 68
290 3300005468 Ga0070707_100017665 Ga0070707_1000176652 68
291 3300005468 Ga0070707_100215609 Ga0070707_1002156092 68
292 3300005468 Ga0070707_100247851 Ga0070707_1002478512 68
293 3300005468 Ga0070707_100631579 Ga0070707_1006315792 68
294 3300005471 Ga0070698_101053688 Ga0070698_1010536882 68
295 3300005518 Ga0070699_100028157 Ga0070699_1000281572 68
296 3300005530 Ga0070679_100313843 Ga0070679_1003138432 68
297 3300005535 Ga0070684_100282935 Ga0070684_1002829352 68
298 3300005536 Ga0070697_100000739 Ga0070697_1000007399 68
299 3300005536 Ga0070697_100890866 Ga0070697_1008908662 68
300 3300005539 Ga0068853_100053189 Ga0068853_1000531894 68
301 3300005544 Ga0070686_100289648 Ga0070686_1002896482 68
302 3300005545 Ga0070695_100066372 Ga0070695_1000663722 68
303 3300005546 Ga0070696_100078866 Ga0070696_1000788662 68
304 3300005546 Ga0070696_100081262 Ga0070696_1000812622 68
305 3300005546 Ga0070696_100449443 Ga0070696_1004494432 68
306 3300005547 Ga0070693_100526954 Ga0070693_1005269542 68
307 3300005548 Ga0070665_100104443 Ga0070665_1001044433 68
308 3300005548 Ga0070665_100242687 Ga0070665_1002426872 68
309 3300005549 Ga0070704_100297322 Ga0070704_1002973222 68
310 3300005563 Ga0068855_101087309 Ga0068855_1010873092 68
311 3300005563 Ga0068855_101862489 Ga0068855_1018624892 68
312 3300005564 Ga0070664_100275870 Ga0070664_1002758702 68
313 3300005577 Ga0068857_100045939 Ga0068857_1000459392 68
314 3300005578 Ga0068854_100003948 Ga0068854_1000039482 68
315 3300005614 Ga0068856_100021745 Ga0068856_1000217452 68
316 3300005614 Ga0068856_100167306 Ga0068856_1001673062 68
317 3300005614 Ga0068856_102090018 Ga0068856_1020900182 68
318 3300005616 Ga0068852_100025097 Ga0068852_1000250974 68
319 3300005617 Ga0068859_100344192 Ga0068859_1003441922 68
320 3300005618 Ga0068864_100091873 Ga0068864_1000918732 68
321 3300005718 Ga0068866_10020115 Ga0068866_100201152 68
322 3300005834 Ga0068851_10009851 Ga0068851_100098513 68
323 3300005841 Ga0068863_100083059 Ga0068863_1000830592 68
324 3300005842 Ga0068858_100049514 Ga0068858_1000495142 68
325 3300005842 Ga0068858_100906379 Ga0068858_1009063792 68
326 3300005843 Ga0068860_100066450 Ga0068860_1000664503 68
327 3300005843 Ga0068860_100550319 Ga0068860_1005503192 68
328 3300005844 Ga0068862_100017939 Ga0068862_1000179393 68
329 3300005983 Ga0081540_1175483 Ga0081540_11754832 68
330 3300006028 Ga0070717_10230810 Ga0070717_102308102 68
331 3300006028 Ga0070717_10361054 Ga0070717_103610541 68
332 3300006028 Ga0070717_11155157 Ga0070717_111551572 68
333 3300006028 Ga0070717_11386732 Ga0070717_113867322 68
334 3300006163 Ga0070715_10016622 Ga0070715_100166222 68
335 3300006163 Ga0070715_10037375 Ga0070715_100373752 68
336 3300006163 Ga0070715_10273394 Ga0070715_102733942 68
337 3300006173 Ga0070716_100013831 Ga0070716_1000138314 68
338 3300006173 Ga0070716_100506011 Ga0070716_1005060112 68
339 3300006173 Ga0070716_101274812 Ga0070716_1012748122 68
340 3300006173 Ga0070716_101692417 Ga0070716_1016924172 68
341 3300006175 Ga0070712_100000167 Ga0070712_1000001677 68
342 3300006175 Ga0070712_100085882 Ga0070712_1000858822 68
343 3300006175 Ga0070712_101769337 Ga0070712_1017693371 68
344 3300006237 Ga0097621_100089383 Ga0097621_1000893833 68
345 3300006237 Ga0097621_100119234 Ga0097621_1001192342 68
346 3300006358 Ga0068871_100040917 Ga0068871_1000409173 68
347 3300006358 Ga0068871_100093460 Ga0068871_1000934603 68
348 3300006871 Ga0075434_100305908 Ga0075434_1003059082 68
349 3300006871 Ga0075434_100606101 Ga0075434_1006061012 68
350 3300006881 Ga0068865_100055100 Ga0068865_1000551001 68
351 3300006914 Ga0075436_100848187 Ga0075436_1008481872 68
352 3300006931 Ga0097620_100344187 Ga0097620_1003441872 68
353 3300007265 Ga0099794_10119078 Ga0099794_101190782 68
354 3300007265 Ga0099794_10279955 Ga0099794_102799552 68
355 3300007788 Ga0099795_10270504 Ga0099795_102705042 68
356 3300009093 Ga0105240_10069435 Ga0105240_100694353 68
357 3300009093 Ga0105240_10500077 Ga0105240_105000772 68
358 3300009094 Ga0111539_11571765 Ga0111539_115717652 68
359 3300009098 Ga0105245_10083509 Ga0105245_100835092 68
360 3300009098 Ga0105245_10295071 Ga0105245_102950712 68
361 3300009098 Ga0105245_10670765 Ga0105245_106707652 68
362 3300009101 Ga0105247_10009972 Ga0105247_100099725 68
363 3300009101 Ga0105247_10120940 Ga0105247_101209401 68
364 3300009148 Ga0105243_10218951 Ga0105243_102189512 68
365 3300009174 Ga0105241_10021957 Ga0105241_100219573 68
366 3300009174 Ga0105241_10023682 Ga0105241_100236825 68
367 3300009174 Ga0105241_10274684 Ga0105241_102746842 68
368 3300009174 Ga0105241_10617455 Ga0105241_106174552 68
369 3300009176 Ga0105242_10240347 Ga0105242_102403472 68
370 3300009176 Ga0105242_10790609 Ga0105242_107906092 68
371 3300009176 Ga0105242_10897658 Ga0105242_108976582 68
372 3300009177 Ga0105248_10080374 Ga0105248_100803742 68
373 3300009177 Ga0105248_10719704 Ga0105248_107197042 68
374 3300009177 Ga0105248_11275876 Ga0105248_112758762 68
375 3300009545 Ga0105237_11312930 Ga0105237_113129302 68
376 3300009545 Ga0105237_11563474 Ga0105237_115634741 68
377 3300009551 Ga0105238_10060895 Ga0105238_100608952 68
378 3300009553 Ga0105249_10029405 Ga0105249_100294052 68
379 3300009553 Ga0105249_10448742 Ga0105249_104487422 68
380 3300010375 Ga0105239_10352112 Ga0105239_103521122 68
381 3300010375 Ga0105239_11307801 Ga0105239_113078012 68
382 3300011119 Ga0105246_10163241 Ga0105246_101632412 68
383 3300011119 Ga0105246_10236062 Ga0105246_102360622 68
384 3300013100 Ga0157373_10065315 Ga0157373_100653152 68
385 3300013102 Ga0157371_10632722 Ga0157371_106327221 68
386 3300013104 Ga0157370_10141679 Ga0157370_101416793 68
387 3300013105 Ga0157369_10181180 Ga0157369_101811802 68
388 3300013296 Ga0157374_10048678 Ga0157374_100486783 68
389 3300013296 Ga0157374_12583250 Ga0157374_125832502 68
390 3300013297 Ga0157378_10119838 Ga0157378_101198383 68
391 3300013297 Ga0157378_10162477 Ga0157378_101624772 68
392 3300013297 Ga0157378_12673382 Ga0157378_126733822 68
393 3300013306 Ga0163162_10192940 Ga0163162_101929402 68
394 3300013306 Ga0163162_10314784 Ga0163162_103147842 68
395 3300013306 Ga0163162_10668305 Ga0163162_106683052 68
396 3300013307 Ga0157372_10084833 Ga0157372_100848332 68
397 3300013307 Ga0157372_11413570 Ga0157372_114135701 68
398 3300013308 Ga0157375_10005603 Ga0157375_100056034 68
399 3300014325 Ga0163163_10457767 Ga0163163_104577672 68
400 3300014968 Ga0157379_10001792 Ga0157379_100017926 68
401 3300014968 Ga0157379_10024448 Ga0157379_100244482 68
402 3300014968 Ga0157379_10637474 Ga0157379_106374742 68
403 3300014968 Ga0157379_10845888 Ga0157379_108458882 68
404 3300014969 Ga0157376_10145599 Ga0157376_101455992 68
405 3300014969 Ga0157376_10214636 Ga0157376_102146362 68
406 3300022734 Ga0224571_105232 Ga0224571_1052322 68
407 3300024123 Ga0228600_1016769 Ga0228600_10167692 68
408 3300024225 Ga0224572_1005093 Ga0224572_10050932 68
409 3300024227 Ga0228598_1001152 Ga0228598_10011523 68
410 3300024227 Ga0228598_1042725 Ga0228598_10427252 68
411 3300025321 Ga0207656_10036965 Ga0207656_100369652 68
412 3300025893 Ga0207682_10088650 Ga0207682_100886502 68
413 3300025898 Ga0207692_11082665 Ga0207692_110826651 68
414 3300025899 Ga0207642_10143543 Ga0207642_101435432 68
415 3300025900 Ga0207710_10062888 Ga0207710_100628882 68
416 3300025900 Ga0207710_10514771 Ga0207710_105147712 68
417 3300025904 Ga0207647_10219469 Ga0207647_102194691 68
418 3300025905 Ga0207685_10057218 Ga0207685_100572182 68
419 3300025905 Ga0207685_10145965 Ga0207685_101459652 68
420 3300025905 Ga0207685_10630610 Ga0207685_106306101 68
421 3300025906 Ga0207699_10021811 Ga0207699_100218113 68
422 3300025906 Ga0207699_10447781 Ga0207699_104477812 68
423 3300025906 Ga0207699_11148223 Ga0207699_111482232 68
424 3300025907 Ga0207645_10450626 Ga0207645_104506262 68
425 3300025910 Ga0207684_10005821 Ga0207684_100058217 68
426 3300025911 Ga0207654_10015081 Ga0207654_100150812 68
427 3300025911 Ga0207654_10024478 Ga0207654_100244782 68
428 3300025911 Ga0207654_10085264 Ga0207654_100852642 68
429 3300025912 Ga0207707_10027083 Ga0207707_100270832 68
430 3300025913 Ga0207695_10133952 Ga0207695_101339522 68
431 3300025913 Ga0207695_10560452 Ga0207695_105604521 68
432 3300025914 Ga0207671_10098578 Ga0207671_100985781 68
433 3300025914 Ga0207671_10297041 Ga0207671_102970412 68
434 3300025914 Ga0207671_10981179 Ga0207671_109811791 68
435 3300025914 Ga0207671_11454354 Ga0207671_114543542 68
436 3300025915 Ga0207693_10000467 Ga0207693_1000046718 68
437 3300025915 Ga0207693_10097262 Ga0207693_100972622 68
438 3300025915 Ga0207693_10567082 Ga0207693_105670821 68
439 3300025916 Ga0207663_10005038 Ga0207663_100050384 68
440 3300025916 Ga0207663_10127199 Ga0207663_101271992 68
441 3300025916 Ga0207663_10972738 Ga0207663_109727381 68
442 3300025916 Ga0207663_11120906 Ga0207663_111209061 68
443 3300025916 Ga0207663_11333107 Ga0207663_113331071 68
444 3300025917 Ga0207660_10968177 Ga0207660_109681772 68
445 3300025918 Ga0207662_11346049 Ga0207662_113460492 68
446 3300025919 Ga0207657_10011252 Ga0207657_100112525 68
447 3300025920 Ga0207649_10049802 Ga0207649_100498022 68
448 3300025920 Ga0207649_11203602 Ga0207649_112036022 68
449 3300025921 Ga0207652_10041858 Ga0207652_100418583 68
450 3300025922 Ga0207646_10041544 Ga0207646_100415442 68
451 3300025922 Ga0207646_10044708 Ga0207646_100447082 68
452 3300025922 Ga0207646_10190236 Ga0207646_101902362 68
453 3300025922 Ga0207646_11699762 Ga0207646_116997621 68
454 3300025924 Ga0207694_10164168 Ga0207694_101641682 68
455 3300025926 Ga0207659_10323961 Ga0207659_103239613 68
456 3300025927 Ga0207687_10057591 Ga0207687_100575913 68
457 3300025927 Ga0207687_10127999 Ga0207687_101279993 68
458 3300025928 Ga0207700_11219047 Ga0207700_112190472 68
459 3300025932 Ga0207690_10574490 Ga0207690_105744902 68
460 3300025933 Ga0207706_10000590 Ga0207706_100005904 68
461 3300025934 Ga0207686_10032810 Ga0207686_100328102 68
462 3300025934 Ga0207686_11612060 Ga0207686_116120602 68
463 3300025935 Ga0207709_10358678 Ga0207709_103586782 68
464 3300025937 Ga0207669_10716928 Ga0207669_107169281 68
465 3300025939 Ga0207665_10017983 Ga0207665_100179831 68
466 3300025939 Ga0207665_10182520 Ga0207665_101825202 68
467 3300025939 Ga0207665_10194240 Ga0207665_101942402 68
468 3300025939 Ga0207665_10513089 Ga0207665_105130891 68
469 3300025941 Ga0207711_10007737 Ga0207711_100077374 68
470 3300025942 Ga0207689_10045944 Ga0207689_100459443 68
471 3300025949 Ga0207667_10086715 Ga0207667_100867152 68
472 3300025961 Ga0207712_10282256 Ga0207712_102822562 68
473 3300025972 Ga0207668_10010105 Ga0207668_100101052 68
474 3300025981 Ga0207640_10545464 Ga0207640_105454642 68
475 3300025986 Ga0207658_10025179 Ga0207658_100251792 68
476 3300025986 Ga0207658_10959131 Ga0207658_109591312 68
477 3300026023 Ga0207677_10181975 Ga0207677_101819752 68
478 3300026035 Ga0207703_10097089 Ga0207703_100970893 68
479 3300026035 Ga0207703_11295541 Ga0207703_112955412 68
480 3300026035 Ga0207703_11430120 Ga0207703_114301202 68
481 3300026041 Ga0207639_10151750 Ga0207639_101517502 68
482 3300026067 Ga0207678_10003766 Ga0207678_100037662 68
483 3300026078 Ga0207702_10072978 Ga0207702_100729783 68
484 3300026078 Ga0207702_11300500 Ga0207702_113005002 68
485 3300026078 Ga0207702_12121245 Ga0207702_121212452 68
486 3300026088 Ga0207641_10066111 Ga0207641_100661113 68
487 3300026089 Ga0207648_10002534 Ga0207648_100025348 68
488 3300026121 Ga0207683_10986382 Ga0207683_109863822 68
489 3300026142 Ga0207698_10153013 Ga0207698_101530132 68
490 3300027907 Ga0207428_10832494 Ga0207428_108324941 68
491 3300028017 Ga0265356_1029839 Ga0265356_10298392 68
492 3300028023 Ga0265357_1030986 Ga0265357_10309862 68
493 3300028380 Ga0268265_10146740 Ga0268265_101467402 68
494 3300028381 Ga0268264_10049672 Ga0268264_100496723 68
495 3300028381 Ga0268264_10270946 Ga0268264_102709462 68
496 3300028381 Ga0268264_11008139 Ga0268264_110081392 68
497 3300028800 Ga0265338_10277862 Ga0265338_102778622 68
498 3300030760 Ga0265762_1002722 Ga0265762_10027223 68
499 3300030760 Ga0265762_1011214 Ga0265762_10112142 68
500 3300030878 Ga0265770_1013185 Ga0265770_10131852 68
501 3300031090 Ga0265760_10031605 Ga0265760_100316052 68
502 3300031090 Ga0265760_10290782 Ga0265760_102907821 68
503 3300031247 Ga0265340_10060646 Ga0265340_100606462 68
504 3300031249 Ga0265339_10029063 Ga0265339_100290633 68
505 3300031344 Ga0265316_10000652 Ga0265316_1000065215 68
506 3300031344 Ga0265316_10885614 Ga0265316_108856141 68
507 3300031711 Ga0265314_10000572 Ga0265314_1000057217 68
508 3300031711 Ga0265314_10064871 Ga0265314_100648712 68
509 3300031711 Ga0265314_10189439 Ga0265314_101894392 68
510 3300033547 Ga0316212_1001045 Ga0316212_10010452 68
511 3300034816 Ga0373930_0128441 Ga0373930_0128441_246_452 68
512 3300034818 Ga0373950_0073282 Ga0373950_0073282_71_277 68
513 3300034820 Ga0373959_0055771 Ga0373959_0055771_584_790 68
514 3300035083 Ga0373926_0312920 Ga0373926_0312920_89_295 68
515 3300035084 Ga0373928_0070590 Ga0373928_0070590_100_306 68
516 3300035084 Ga0373928_0235671 Ga0373928_0235671_131_337 68
517 3300035088 Ga0373940_0037665 Ga0373940_0037665_117_323 68
518 3300035111 Ga0373923_0092781 Ga0373923_0092781_746_958 68
519 3300035112 Ga0373932_0109575 Ga0373932_0109575_389_595 68
520 3300035121 Ga0373960_0121108 Ga0373960_0121108_142_348 68
521 3300035207 Ga0373942_0090497 Ga0373942_0090497_201_407 68
522 3300035241 Ga0373961_0331115 Ga0373961_0331115_25_231 68
523 3300035691 Ga0373931_0041032 Ga0373931_0041032_115_321 68
524 3300035691 Ga0373931_0380722 Ga0373931_0380722_271_477 68
525 3300035692 Ga0373935_0426497 Ga0373935_0426497_183_395 68
526 3300035695 Ga0373927_0024041 Ga0373927_0024041_3647_3859 68
527 3300035725 Ga0373947_1215164 Ga0373947_1215164_187_393 68
528 3300037068 Ga0373925_0039815 Ga0373925_0039815_1962_2174 68
529 3300037068 Ga0373925_0061179 Ga0373925_0061179_1151_1357 68
530 3300037068 Ga0373925_1035447 Ga0373925_1035447_440_652 68
531 3300038996 Ga0242420_013682 Ga0242420_013682_72_278 68
532 3300039438 Ga0436360_1114409 Ga0436360_1114409_94_333 68
533 3300042876 Ga0451577_0339432 Ga0451577_0339432_20_226 68
534 3300044684 Ga0466966_0735325 Ga0466966_0735325_142_348 68
535 3300044712 Ga0453684_2316560 Ga0453684_2316560_159_365 68
536 3300045051 Ga0451576_0041599 Ga0451576_0041599_2343_2552 68
537 3300045051 Ga0451576_0651143 Ga0451576_0651143_64_270 68
538 3300046472 Ga0495580_0002088 Ga0495580_0002088_1947_2159 68
539 3300046472 Ga0495580_0008640 Ga0495580_0008640_3489_3716 68
540 3300046473 Ga0495582_0068893 Ga0495582_0068893_286_498 68
541 3300046517 Ga0495630_0391055 Ga0495630_0391055_779_991 68
542 3300046531 Ga0495665_0101208 Ga0495665_0101208_46_258 68
543 3300046533 Ga0495640_0801331 Ga0495640_0801331_107_313 68
544 3300046684 Ga0495669_0191089 Ga0495669_0191089_729_938 68
545 3300047315 Ga0495581_0275983 Ga0495581_0275983_708_920 68
546 3300048903 Ga0496100_0073349 Ga0496100_0073349_358_564 68
547 3300048903 Ga0496100_1018880 Ga0496100_1018880_384_590 68
548 3300048904 Ga0496101_0024453 Ga0496101_0024453_3883_4089 68
549 3300048904 Ga0496101_0198438 Ga0496101_0198438_46_252 68
550 3300048904 Ga0496101_0998519 Ga0496101_0998519_375_581 68
551 3300048905 Ga0496102_0000882 Ga0496102_0000882_15573_15779 68
552 3300048905 Ga0496102_0278918 Ga0496102_0278918_1239_1445 68
553 3300048905 Ga0496102_0310551 Ga0496102_0310551_1190_1396 68
554 3300048905 Ga0496102_0668266 Ga0496102_0668266_122_328 68
555 3300048906 Ga0496103_0010332 Ga0496103_0010332_65_271 68
556 3300048906 Ga0496103_0019618 Ga0496103_0019618_1215_1421 68
557 3300048907 Ga0496104_0164806 Ga0496104_0164806_788_994 68
558 3300048908 Ga0496105_0057191 Ga0496105_0057191_1250_1456 68
559 3300048908 Ga0496105_0468280 Ga0496105_0468280_674_880 68
560 3300048909 Ga0496106_0010794 Ga0496106_0010794_462_668 68
561 3300048909 Ga0496106_0181497 Ga0496106_0181497_252_458 68
562 3300048910 Ga0496107_0004478 Ga0496107_0004478_6558_6764 68
563 3300048910 Ga0496107_0034006 Ga0496107_0034006_1956_2162 68
564 3300048910 Ga0496107_0623884 Ga0496107_0623884_335_541 68
565 3300048911 Ga0496108_0281737 Ga0496108_0281737_55_261 68
566 3300048914 Ga0496111_0300461 Ga0496111_0300461_84_290 68
567 3300048915 Ga0496112_0367361 Ga0496112_0367361_563_769 68
568 3300048916 Ga0496113_0628439 Ga0496113_0628439_65_271 68
569 3300048917 Ga0496114_0159719 Ga0496114_0159719_22_228 68
570 3300048918 Ga0496115_0302514 Ga0496115_0302514_475_681 68
571 3300048918 Ga0496115_0851176 Ga0496115_0851176_289_519 68
572 3300048929 Ga0496126_0328818 Ga0496126_0328818_661_891 68
573 3300050511 nmdc:mga08y16_1128749_c1 nmdc:mga08y16_1128749_c1_337_546 68
574 3300050512 nmdc:mga0n895_213062_c1 nmdc:mga0n895_213062_c1_1446_1652 68
575 3300050513 nmdc:mga0rr50_1272758_c1 nmdc:mga0rr50_1272758_c1_292_498 68
576 3300050513 nmdc:mga0rr50_298416_c1 nmdc:mga0rr50_298416_c1_237_443 68
577 3300050514 nmdc:mga08x19_105104_c1 nmdc:mga08x19_105104_c1_844_1050 68
578 3300053085 Ga0495619_0043233 Ga0495619_0043233_2664_2870 68

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p3r-assembly1.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8819 5 62
6grj-assembly1.cif.gz_I structure of the ahlb pore of the tripartite alpha-pore forming toxin, ahl, from aeromonas hydrophila. 0.8216 2 67
6h2f-assembly1.cif.gz_D structure of the pre-pore ahlb of the tripartite alpha-pore forming toxin, ahl, from aeromonas hydrophila. 0.8126 6 67
7a0g-assembly1.cif.gz_III structure of the smhb pore of the tripartite alpha-pore forming toxin, smh, from serratia marcescens. 0.8042 2 67
8esv-assembly1.cif.gz_B structure of human adam10-tspan15 complex bound to 11g2 vfab 0.7986 5 67
ID Description Score Start End Superfamily
af_P27701_1_107_1.20.5.780 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin 0.8939 5 67 1.20.5.780
af_O70352_1_107_1.20.5.780 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin 0.8858 5 67 1.20.5.780
af_P40237_1_107_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.8808 5 67 1.20.5.110
af_P11049_12_272_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8725 5 61 1.20.1070.10
af_O60635_1_114_1.20.5.780 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin 0.8636 3 67 1.20.5.780
ID Description Score Start End GO Terms
AF-A0A2J6WF35-F1-model_v4 DUF5671 domain-containing protein 0.9432 6 62 GO:0016020
AF-A0A2M8Q0J6-F1-model_v4 NERD domain-containing protein 0.9286 5 61 GO:0016020
AF-A0A2T1A392-F1-model_v4 Uncharacterized protein 0.9071 5 61 GO:0016020
AF-A0A3N5W4J4-F1-model_v4 DUF2207 domain-containing protein 0.9054 5 63 GO:0016020
AF-A0A1I7RLE2-F1-model_v4 (pine wood nematode) hypothetical protein 0.9015 5 61 GO:0016020

Feature Viewer

pLDDT pTM Quality
76.98 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map