F465728
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 578 | 265 | 578 | 72 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_12673382|Ga0157378_126733822 |
| Length | 82 |
| Sequence | LYDEVRGMISIWFFIGVSLAVNGALIMAAGIYQVVNPPVDPGVVLFNLHANVWWGGTLLVFGLIYSVRFSPARERKRLSGNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 76 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 104 | 3300024123 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 | Metagenome | Unclassified |
| 105 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 106 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 160 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 161 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 174 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 175 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 176 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 178 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 189 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 204 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 205 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 206 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 207 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 208 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 209 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 210 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 211 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 212 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 254 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.13 |
| Metatranscriptomes | 0.87 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.71 |
| Rhizosphere | 93.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10012049 | 3300005293 | Unclassified | 2524 |
| 2 | Ga0065715_10291325 | 3300005293 | Bacteria | 1062 |
| 3 | Ga0070676_10758800 | 3300005328 | Bacteria | 713 |
| 4 | Ga0070690_100431156 | 3300005330 | Bacteria | 974 |
| 5 | Ga0070690_100795060 | 3300005330 | Unclassified | 733 |
| 6 | Ga0068869_100143063 | 3300005334 | Bacteria | 1849 |
| 7 | Ga0070666_10231411 | 3300005335 | Bacteria | 1305 |
| 8 | Ga0070666_10559130 | 3300005335 | Bacteria | 832 |
| 9 | Ga0070680_100381016 | 3300005336 | Bacteria | 1201 |
| 10 | Ga0070680_100437425 | 3300005336 | Bacteria | 1116 |
| 11 | Ga0070682_100110346 | 3300005337 | Bacteria | 1832 |
| 12 | Ga0068868_100830957 | 3300005338 | Bacteria | 835 |
| 13 | Ga0070660_100596400 | 3300005339 | Bacteria | 923 |
| 14 | Ga0070691_10105384 | 3300005341 | Bacteria | 1405 |
| 15 | Ga0070687_100300139 | 3300005343 | Bacteria | 1019 |
| 16 | Ga0070661_100004744 | 3300005344 | Bacteria | 9350 |
| 17 | Ga0070692_11105907 | 3300005345 | Bacteria | 560 |
| 18 | Ga0070668_100015991 | 3300005347 | Bacteria | 5613 |
| 19 | Ga0070669_100072940 | 3300005353 | Bacteria | 2543 |
| 20 | Ga0070675_100838139 | 3300005354 | Bacteria | 841 |
| 21 | Ga0070675_100951260 | 3300005354 | Unclassified | 788 |
| 22 | Ga0070674_100289838 | 3300005356 | Bacteria | 1301 |
| 23 | Ga0070659_100090683 | 3300005366 | Unclassified | 2449 |
| 24 | Ga0070667_100056467 | 3300005367 | Unclassified | 3316 |
| 25 | Ga0070709_10000540 | 3300005434 | Bacteria | 22135 |
| 26 | Ga0070709_10077720 | 3300005434 | Bacteria | 2158 |
| 27 | Ga0070709_10338224 | 3300005434 | Bacteria | 1109 |
| 28 | Ga0070709_10516307 | 3300005434 | Bacteria | 910 |
| 29 | Ga0070709_10550133 | 3300005434 | Bacteria | 883 |
| 30 | Ga0070709_10731817 | 3300005434 | Unclassified | 772 |
| 31 | Ga0070709_10875202 | 3300005434 | Bacteria | 709 |
| 32 | Ga0070709_11261560 | 3300005434 | Unclassified | 595 |
| 33 | Ga0070709_11590438 | 3300005434 | Bacteria | 532 |
| 34 | Ga0070714_100199151 | 3300005435 | Bacteria | 1831 |
| 35 | Ga0070714_100273911 | 3300005435 | Unclassified | 1566 |
| 36 | Ga0070714_100674061 | 3300005435 | Bacteria | 996 |
| 37 | Ga0070714_100966012 | 3300005435 | Unclassified | 828 |
| 38 | Ga0070714_101156822 | 3300005435 | Bacteria | 754 |
| 39 | Ga0070714_101750216 | 3300005435 | Unclassified | 607 |
| 40 | Ga0070714_101908540 | 3300005435 | Unclassified | 579 |
| 41 | Ga0070714_101949997 | 3300005435 | Unclassified | 573 |
| 42 | Ga0070713_100000909 | 3300005436 | Bacteria | 18927 |
| 43 | Ga0070713_100001436 | 3300005436 | Bacteria | 15282 |
| 44 | Ga0070713_100011192 | 3300005436 | Bacteria | 6524 |
| 45 | Ga0070713_100102674 | 3300005436 | Bacteria | 2480 |
| 46 | Ga0070713_100279625 | 3300005436 | Bacteria | 1531 |
| 47 | Ga0070713_100283626 | 3300005436 | Bacteria | 1520 |
| 48 | Ga0070713_100378854 | 3300005436 | Bacteria | 1318 |
| 49 | Ga0070713_100385193 | 3300005436 | Bacteria | 1307 |
| 50 | Ga0070713_100634320 | 3300005436 | Bacteria | 1017 |
| 51 | Ga0070713_100880676 | 3300005436 | Unclassified | 860 |
| 52 | Ga0070713_100946419 | 3300005436 | Bacteria | 829 |
| 53 | Ga0070713_101055172 | 3300005436 | Bacteria | 785 |
| 54 | Ga0070713_102111555 | 3300005436 | Unclassified | 546 |
| 55 | Ga0070710_10016640 | 3300005437 | Bacteria | 3747 |
| 56 | Ga0070710_10033073 | 3300005437 | Bacteria | 2806 |
| 57 | Ga0070710_10050045 | 3300005437 | Bacteria | 2340 |
| 58 | Ga0070710_10139218 | 3300005437 | Bacteria | 1486 |
| 59 | Ga0070710_10532351 | 3300005437 | Unclassified | 809 |
| 60 | Ga0070710_11043134 | 3300005437 | Unclassified | 598 |
| 61 | Ga0070710_11117807 | 3300005437 | Bacteria | 579 |
| 62 | Ga0070710_11282272 | 3300005437 | Unclassified | 544 |
| 63 | Ga0070701_10882907 | 3300005438 | Bacteria | 616 |
| 64 | Ga0070711_100000291 | 3300005439 | Bacteria | 26041 |
| 65 | Ga0070711_100006753 | 3300005439 | Bacteria | 6945 |
| 66 | Ga0070711_100008437 | 3300005439 | Bacteria | 6311 |
| 67 | Ga0070711_100037847 | 3300005439 | Bacteria | 3239 |
| 68 | Ga0070711_100045534 | 3300005439 | Bacteria | 2985 |
| 69 | Ga0070711_100067261 | 3300005439 | Bacteria | 2513 |
| 70 | Ga0070711_100170426 | 3300005439 | Bacteria | 1659 |
| 71 | Ga0070711_100267372 | 3300005439 | Bacteria | 1348 |
| 72 | Ga0070711_100388022 | 3300005439 | Bacteria | 1131 |
| 73 | Ga0070711_100924632 | 3300005439 | Bacteria | 745 |
| 74 | Ga0070711_101159458 | 3300005439 | Bacteria | 667 |
| 75 | Ga0070705_100321534 | 3300005440 | Bacteria | 1117 |
| 76 | Ga0070705_100446607 | 3300005440 | Bacteria | 969 |
| 77 | Ga0070700_100135830 | 3300005441 | Bacteria | 1665 |
| 78 | Ga0070694_100115102 | 3300005444 | Bacteria | 1921 |
| 79 | Ga0070708_100002397 | 3300005445 | Bacteria | 14522 |
| 80 | Ga0070708_100025156 | 3300005445 | Bacteria | 5088 |
| 81 | Ga0070708_100152009 | 3300005445 | Bacteria | 2153 |
| 82 | Ga0070708_100497723 | 3300005445 | Unclassified | 1150 |
| 83 | Ga0070663_100082046 | 3300005455 | Bacteria | 2371 |
| 84 | Ga0070678_100775577 | 3300005456 | Bacteria | 869 |
| 85 | Ga0070662_100020862 | 3300005457 | Bacteria | 4468 |
| 86 | Ga0070681_10037931 | 3300005458 | Bacteria | 4832 |
| 87 | Ga0070681_11191591 | 3300005458 | Bacteria | 683 |
| 88 | Ga0068867_100486317 | 3300005459 | Bacteria | 1058 |
| 89 | Ga0070706_100001716 | 3300005467 | Bacteria | 22776 |
| 90 | Ga0070706_100126839 | 3300005467 | Bacteria | 2380 |
| 91 | Ga0070706_100873724 | 3300005467 | Bacteria | 831 |
| 92 | Ga0070707_100017665 | 3300005468 | Bacteria | 6711 |
| 93 | Ga0070707_100215609 | 3300005468 | Bacteria | 1870 |
| 94 | Ga0070707_100247851 | 3300005468 | Bacteria | 1733 |
| 95 | Ga0070707_100260566 | 3300005468 | Bacteria | 1687 |
| 96 | Ga0070707_100631579 | 3300005468 | Bacteria | 1034 |
| 97 | Ga0070698_100115556 | 3300005471 | Bacteria | 2648 |
| 98 | Ga0070698_101053688 | 3300005471 | Bacteria | 761 |
| 99 | Ga0070699_100028157 | 3300005518 | Bacteria | 4846 |
| 100 | Ga0070679_100313843 | 3300005530 | Bacteria | 1517 |
| 101 | Ga0070679_100611341 | 3300005530 | Bacteria | 1033 |
| 102 | Ga0070684_100282935 | 3300005535 | Bacteria | 1519 |
| 103 | Ga0070697_100000739 | 3300005536 | Bacteria | 24386 |
| 104 | Ga0070697_100890866 | 3300005536 | Unclassified | 789 |
| 105 | Ga0068853_100053189 | 3300005539 | Bacteria | 3487 |
| 106 | Ga0068853_102119339 | 3300005539 | Bacteria | 545 |
| 107 | Ga0070686_100289648 | 3300005544 | Bacteria | 1211 |
| 108 | Ga0070695_100066372 | 3300005545 | Bacteria | 2351 |
| 109 | Ga0070696_100078866 | 3300005546 | Unclassified | 2329 |
| 110 | Ga0070696_100081262 | 3300005546 | Bacteria | 2296 |
| 111 | Ga0070696_100449443 | 3300005546 | Bacteria | 1016 |
| 112 | Ga0070693_100526954 | 3300005547 | Bacteria | 842 |
| 113 | Ga0070665_100104443 | 3300005548 | Bacteria | 2835 |
| 114 | Ga0070665_100242687 | 3300005548 | Bacteria | 1802 |
| 115 | Ga0070704_100297322 | 3300005549 | Bacteria | 1344 |
| 116 | Ga0068855_101087309 | 3300005563 | Bacteria | 836 |
| 117 | Ga0068855_101862489 | 3300005563 | Unclassified | 610 |
| 118 | Ga0070664_100275870 | 3300005564 | Bacteria | 1515 |
| 119 | Ga0070664_101728523 | 3300005564 | Unclassified | 593 |
| 120 | Ga0068857_100045939 | 3300005577 | Bacteria | 3875 |
| 121 | Ga0068854_100003948 | 3300005578 | Bacteria | 9295 |
| 122 | Ga0068856_100021745 | 3300005614 | Bacteria | 6233 |
| 123 | Ga0068856_100167306 | 3300005614 | Bacteria | 2210 |
| 124 | Ga0068856_102090018 | 3300005614 | Unclassified | 576 |
| 125 | Ga0068856_102409055 | 3300005614 | Unclassified | 534 |
| 126 | Ga0068852_100025097 | 3300005616 | Bacteria | 4825 |
| 127 | Ga0068859_100344192 | 3300005617 | Bacteria | 1585 |
| 128 | Ga0068864_100091873 | 3300005618 | Unclassified | 2678 |
| 129 | Ga0068864_100627181 | 3300005618 | Unclassified | 1045 |
| 130 | Ga0068866_10020115 | 3300005718 | Bacteria | 3053 |
| 131 | Ga0068851_10009851 | 3300005834 | Bacteria | 4451 |
| 132 | Ga0068863_100083059 | 3300005841 | Unclassified | 3035 |
| 133 | Ga0068863_101239260 | 3300005841 | Bacteria | 752 |
| 134 | Ga0068858_100049514 | 3300005842 | Bacteria | 3891 |
| 135 | Ga0068858_100906379 | 3300005842 | Bacteria | 862 |
| 136 | Ga0068860_100066450 | 3300005843 | Bacteria | 3425 |
| 137 | Ga0068860_100550319 | 3300005843 | Bacteria | 1156 |
| 138 | Ga0068862_100017939 | 3300005844 | Bacteria | 5894 |
| 139 | Ga0081540_1045576 | 3300005983 | Bacteria | 2225 |
| 140 | Ga0081540_1175483 | 3300005983 | Bacteria | 809 |
| 141 | Ga0070717_10001140 | 3300006028 | Bacteria | 17941 |
| 142 | Ga0070717_10011272 | 3300006028 | Bacteria | 6784 |
| 143 | Ga0070717_10030213 | 3300006028 | Unclassified | 4353 |
| 144 | Ga0070717_10033310 | 3300006028 | Bacteria | 4157 |
| 145 | Ga0070717_10047492 | 3300006028 | Bacteria | 3518 |
| 146 | Ga0070717_10061732 | 3300006028 | Bacteria | 3106 |
| 147 | Ga0070717_10062767 | 3300006028 | Bacteria | 3082 |
| 148 | Ga0070717_10230810 | 3300006028 | Unclassified | 1629 |
| 149 | Ga0070717_10361054 | 3300006028 | Bacteria | 1300 |
| 150 | Ga0070717_10420639 | 3300006028 | Bacteria | 1202 |
| 151 | Ga0070717_10427351 | 3300006028 | Bacteria | 1192 |
| 152 | Ga0070717_11155157 | 3300006028 | Bacteria | 705 |
| 153 | Ga0070717_11386732 | 3300006028 | Unclassified | 638 |
| 154 | Ga0070715_10004799 | 3300006163 | Bacteria | 4474 |
| 155 | Ga0070715_10008869 | 3300006163 | Bacteria | 3522 |
| 156 | Ga0070715_10016622 | 3300006163 | Bacteria | 2769 |
| 157 | Ga0070715_10037375 | 3300006163 | Bacteria | 2009 |
| 158 | Ga0070715_10273394 | 3300006163 | Bacteria | 893 |
| 159 | Ga0070716_100009213 | 3300006173 | Bacteria | 4917 |
| 160 | Ga0070716_100013831 | 3300006173 | Bacteria | 4122 |
| 161 | Ga0070716_100215544 | 3300006173 | Unclassified | 1286 |
| 162 | Ga0070716_100256695 | 3300006173 | Unclassified | 1194 |
| 163 | Ga0070716_100506011 | 3300006173 | Bacteria | 892 |
| 164 | Ga0070716_100749186 | 3300006173 | Unclassified | 751 |
| 165 | Ga0070716_101274812 | 3300006173 | Bacteria | 593 |
| 166 | Ga0070716_101692417 | 3300006173 | Unclassified | 522 |
| 167 | Ga0070712_100000105 | 3300006175 | Bacteria | 43144 |
| 168 | Ga0070712_100000167 | 3300006175 | Bacteria | 35889 |
| 169 | Ga0070712_100001546 | 3300006175 | Bacteria | 14064 |
| 170 | Ga0070712_100085882 | 3300006175 | Bacteria | 2292 |
| 171 | Ga0070712_100107130 | 3300006175 | Bacteria | 2079 |
| 172 | Ga0070712_100452727 | 3300006175 | Bacteria | 1069 |
| 173 | Ga0070712_100833396 | 3300006175 | Unclassified | 793 |
| 174 | Ga0070712_101769337 | 3300006175 | Unclassified | 541 |
| 175 | Ga0097621_100089383 | 3300006237 | Bacteria | 2575 |
| 176 | Ga0097621_100119234 | 3300006237 | Bacteria | 2236 |
| 177 | Ga0068871_100040917 | 3300006358 | Bacteria | 3714 |
| 178 | Ga0068871_100093460 | 3300006358 | Bacteria | 2509 |
| 179 | Ga0075434_100305908 | 3300006871 | Bacteria | 1610 |
| 180 | Ga0075434_100606101 | 3300006871 | Bacteria | 1114 |
| 181 | Ga0068865_100055100 | 3300006881 | Bacteria | 2765 |
| 182 | Ga0075436_100848187 | 3300006914 | Bacteria | 682 |
| 183 | Ga0097620_100344187 | 3300006931 | Bacteria | 1585 |
| 184 | Ga0075435_101608624 | 3300007076 | Unclassified | 570 |
| 185 | Ga0099794_10119078 | 3300007265 | Bacteria | 1327 |
| 186 | Ga0099794_10279955 | 3300007265 | Bacteria | 862 |
| 187 | Ga0099795_10040407 | 3300007788 | Unclassified | 1656 |
| 188 | Ga0099795_10270504 | 3300007788 | Unclassified | 739 |
| 189 | Ga0105240_10016327 | 3300009093 | Bacteria | 10056 |
| 190 | Ga0105240_10069435 | 3300009093 | Bacteria | 4361 |
| 191 | Ga0105240_10500077 | 3300009093 | Bacteria | 1352 |
| 192 | Ga0111539_11571765 | 3300009094 | Bacteria | 763 |
| 193 | Ga0105245_10083509 | 3300009098 | Bacteria | 2924 |
| 194 | Ga0105245_10295071 | 3300009098 | Bacteria | 1589 |
| 195 | Ga0105245_10670765 | 3300009098 | Bacteria | 1068 |
| 196 | Ga0105247_10009972 | 3300009101 | Bacteria | 5753 |
| 197 | Ga0105247_10120940 | 3300009101 | Bacteria | 1696 |
| 198 | Ga0105243_10218951 | 3300009148 | Bacteria | 1681 |
| 199 | Ga0105241_10021957 | 3300009174 | Bacteria | 4725 |
| 200 | Ga0105241_10023682 | 3300009174 | Bacteria | 4555 |
| 201 | Ga0105241_10125772 | 3300009174 | Bacteria | 2070 |
| 202 | Ga0105241_10274684 | 3300009174 | Bacteria | 1437 |
| 203 | Ga0105241_10617455 | 3300009174 | Unclassified | 981 |
| 204 | Ga0105242_10240347 | 3300009176 | Bacteria | 1628 |
| 205 | Ga0105242_10790609 | 3300009176 | Bacteria | 938 |
| 206 | Ga0105242_10897658 | 3300009176 | Bacteria | 886 |
| 207 | Ga0105248_10080374 | 3300009177 | Bacteria | 3664 |
| 208 | Ga0105248_10579232 | 3300009177 | Bacteria | 1266 |
| 209 | Ga0105248_10719704 | 3300009177 | Bacteria | 1126 |
| 210 | Ga0105248_11275876 | 3300009177 | Bacteria | 831 |
| 211 | Ga0105237_10322568 | 3300009545 | Bacteria | 1548 |
| 212 | Ga0105237_11312930 | 3300009545 | Bacteria | 730 |
| 213 | Ga0105237_11563474 | 3300009545 | Unclassified | 666 |
| 214 | Ga0105238_10060895 | 3300009551 | Bacteria | 3778 |
| 215 | Ga0105249_10029405 | 3300009553 | Bacteria | 4962 |
| 216 | Ga0105249_10448742 | 3300009553 | Bacteria | 1328 |
| 217 | Ga0105239_10352112 | 3300010375 | Unclassified | 1663 |
| 218 | Ga0105239_11307801 | 3300010375 | Bacteria | 836 |
| 219 | Ga0105246_10163241 | 3300011119 | Bacteria | 1699 |
| 220 | Ga0105246_10236062 | 3300011119 | Bacteria | 1443 |
| 221 | Ga0105246_11867147 | 3300011119 | Unclassified | 576 |
| 222 | Ga0157339_1063953 | 3300012505 | Unclassified | 517 |
| 223 | Ga0157373_10065315 | 3300013100 | Bacteria | 2575 |
| 224 | Ga0157373_11513686 | 3300013100 | Unclassified | 512 |
| 225 | Ga0157371_10632722 | 3300013102 | Bacteria | 797 |
| 226 | Ga0157370_10141679 | 3300013104 | Bacteria | 2240 |
| 227 | Ga0157369_10181180 | 3300013105 | Bacteria | 2216 |
| 228 | Ga0157374_10048678 | 3300013296 | Bacteria | 3934 |
| 229 | Ga0157374_10319115 | 3300013296 | Bacteria | 1539 |
| 230 | Ga0157374_12583250 | 3300013296 | Unclassified | 535 |
| 231 | Ga0157378_10119838 | 3300013297 | Bacteria | 2424 |
| 232 | Ga0157378_10162477 | 3300013297 | Bacteria | 2089 |
| 233 | Ga0157378_12673382 | 3300013297 | Unclassified | 552 |
| 234 | Ga0163162_10192940 | 3300013306 | Unclassified | 2165 |
| 235 | Ga0163162_10314784 | 3300013306 | Bacteria | 1698 |
| 236 | Ga0163162_10668305 | 3300013306 | Bacteria | 1162 |
| 237 | Ga0163162_12867768 | 3300013306 | Bacteria | 555 |
| 238 | Ga0157372_10023159 | 3300013307 | Bacteria | 6730 |
| 239 | Ga0157372_10084833 | 3300013307 | Bacteria | 3591 |
| 240 | Ga0157372_10389842 | 3300013307 | Bacteria | 1623 |
| 241 | Ga0157372_11413570 | 3300013307 | Unclassified | 802 |
| 242 | Ga0157375_10005603 | 3300013308 | Bacteria | 10929 |
| 243 | Ga0157375_10829528 | 3300013308 | Bacteria | 1072 |
| 244 | Ga0163163_10457767 | 3300014325 | Bacteria | 1336 |
| 245 | Ga0163163_10943311 | 3300014325 | Unclassified | 926 |
| 246 | Ga0157379_10001792 | 3300014968 | Bacteria | 17740 |
| 247 | Ga0157379_10024448 | 3300014968 | Bacteria | 5363 |
| 248 | Ga0157379_10637474 | 3300014968 | Bacteria | 997 |
| 249 | Ga0157379_10845888 | 3300014968 | Bacteria | 866 |
| 250 | Ga0157376_10145599 | 3300014969 | Bacteria | 2130 |
| 251 | Ga0157376_10214636 | 3300014969 | Bacteria | 1778 |
| 252 | Ga0157376_10420982 | 3300014969 | Bacteria | 1296 |
| 253 | Ga0224571_105232 | 3300022734 | Bacteria | 851 |
| 254 | Ga0228600_1016769 | 3300024123 | Unclassified | 598 |
| 255 | Ga0224572_1005093 | 3300024225 | Bacteria | 2328 |
| 256 | Ga0224572_1037668 | 3300024225 | Unclassified | 914 |
| 257 | Ga0228598_1001152 | 3300024227 | Bacteria | 5826 |
| 258 | Ga0228598_1042725 | 3300024227 | Unclassified | 896 |
| 259 | Ga0207656_10036965 | 3300025321 | Bacteria | 2052 |
| 260 | Ga0207682_10088650 | 3300025893 | Bacteria | 1338 |
| 261 | Ga0207692_10003857 | 3300025898 | Bacteria | 5888 |
| 262 | Ga0207692_10020990 | 3300025898 | Bacteria | 2981 |
| 263 | Ga0207692_10324776 | 3300025898 | Bacteria | 943 |
| 264 | Ga0207692_11082665 | 3300025898 | Unclassified | 530 |
| 265 | Ga0207642_10143543 | 3300025899 | Bacteria | 1262 |
| 266 | Ga0207710_10062888 | 3300025900 | Bacteria | 1688 |
| 267 | Ga0207710_10514771 | 3300025900 | Unclassified | 622 |
| 268 | Ga0207647_10219469 | 3300025904 | Bacteria | 1096 |
| 269 | Ga0207685_10001524 | 3300025905 | Bacteria | 4903 |
| 270 | Ga0207685_10057218 | 3300025905 | Unclassified | 1529 |
| 271 | Ga0207685_10145965 | 3300025905 | Bacteria | 1066 |
| 272 | Ga0207685_10630610 | 3300025905 | Unclassified | 578 |
| 273 | Ga0207699_10001136 | 3300025906 | Bacteria | 12600 |
| 274 | Ga0207699_10021811 | 3300025906 | Bacteria | 3460 |
| 275 | Ga0207699_10208864 | 3300025906 | Unclassified | 1327 |
| 276 | Ga0207699_10447781 | 3300025906 | Bacteria | 926 |
| 277 | Ga0207699_10614288 | 3300025906 | Bacteria | 792 |
| 278 | Ga0207699_11148223 | 3300025906 | Bacteria | 575 |
| 279 | Ga0207645_10450626 | 3300025907 | Bacteria | 869 |
| 280 | Ga0207684_10005821 | 3300025910 | Bacteria | 11298 |
| 281 | Ga0207684_10073793 | 3300025910 | Bacteria | 2898 |
| 282 | Ga0207654_10015081 | 3300025911 | Bacteria | 4002 |
| 283 | Ga0207654_10024478 | 3300025911 | Bacteria | 3247 |
| 284 | Ga0207654_10085264 | 3300025911 | Bacteria | 1912 |
| 285 | Ga0207654_10413504 | 3300025911 | Unclassified | 940 |
| 286 | Ga0207707_10027083 | 3300025912 | Bacteria | 5011 |
| 287 | Ga0207707_10098652 | 3300025912 | Bacteria | 2553 |
| 288 | Ga0207707_10474502 | 3300025912 | Bacteria | 1069 |
| 289 | Ga0207695_10133952 | 3300025913 | Bacteria | 2433 |
| 290 | Ga0207695_10137761 | 3300025913 | Bacteria | 2393 |
| 291 | Ga0207695_10560452 | 3300025913 | Bacteria | 1024 |
| 292 | Ga0207671_10098578 | 3300025914 | Bacteria | 2211 |
| 293 | Ga0207671_10297041 | 3300025914 | Unclassified | 1276 |
| 294 | Ga0207671_10981179 | 3300025914 | Unclassified | 666 |
| 295 | Ga0207671_11210490 | 3300025914 | Unclassified | 591 |
| 296 | Ga0207671_11454354 | 3300025914 | Unclassified | 530 |
| 297 | Ga0207693_10000016 | 3300025915 | Bacteria | 145892 |
| 298 | Ga0207693_10000065 | 3300025915 | Bacteria | 91476 |
| 299 | Ga0207693_10000467 | 3300025915 | Bacteria | 36905 |
| 300 | Ga0207693_10097262 | 3300025915 | Bacteria | 2308 |
| 301 | Ga0207693_10225574 | 3300025915 | Bacteria | 1472 |
| 302 | Ga0207693_10301766 | 3300025915 | Bacteria | 1254 |
| 303 | Ga0207693_10367135 | 3300025915 | Bacteria | 1126 |
| 304 | Ga0207693_10567082 | 3300025915 | Bacteria | 885 |
| 305 | Ga0207663_10004470 | 3300025916 | Bacteria | 6956 |
| 306 | Ga0207663_10005038 | 3300025916 | Bacteria | 6633 |
| 307 | Ga0207663_10007570 | 3300025916 | Bacteria | 5636 |
| 308 | Ga0207663_10031586 | 3300025916 | Bacteria | 3136 |
| 309 | Ga0207663_10043257 | 3300025916 | Bacteria | 2757 |
| 310 | Ga0207663_10127199 | 3300025916 | Bacteria | 1755 |
| 311 | Ga0207663_10153838 | 3300025916 | Bacteria | 1616 |
| 312 | Ga0207663_10972738 | 3300025916 | Unclassified | 680 |
| 313 | Ga0207663_11067688 | 3300025916 | Unclassified | 649 |
| 314 | Ga0207663_11120906 | 3300025916 | Unclassified | 633 |
| 315 | Ga0207663_11333107 | 3300025916 | Unclassified | 578 |
| 316 | Ga0207660_10193107 | 3300025917 | Bacteria | 1587 |
| 317 | Ga0207660_10968177 | 3300025917 | Bacteria | 694 |
| 318 | Ga0207662_11346049 | 3300025918 | Bacteria | 507 |
| 319 | Ga0207657_10011252 | 3300025919 | Bacteria | 8891 |
| 320 | Ga0207649_10049802 | 3300025920 | Bacteria | 2589 |
| 321 | Ga0207649_11203602 | 3300025920 | Bacteria | 599 |
| 322 | Ga0207652_10041858 | 3300025921 | Bacteria | 3896 |
| 323 | Ga0207646_10041544 | 3300025922 | Bacteria | 4134 |
| 324 | Ga0207646_10044708 | 3300025922 | Unclassified | 3975 |
| 325 | Ga0207646_10093939 | 3300025922 | Bacteria | 2686 |
| 326 | Ga0207646_10190236 | 3300025922 | Bacteria | 1854 |
| 327 | Ga0207646_11699762 | 3300025922 | Unclassified | 542 |
| 328 | Ga0207694_10164168 | 3300025924 | Bacteria | 1795 |
| 329 | Ga0207659_10323961 | 3300025926 | Unclassified | 1272 |
| 330 | Ga0207687_10057591 | 3300025927 | Bacteria | 2731 |
| 331 | Ga0207687_10127999 | 3300025927 | Bacteria | 1910 |
| 332 | Ga0207700_10001701 | 3300025928 | Bacteria | 12490 |
| 333 | Ga0207700_10001772 | 3300025928 | Bacteria | 12238 |
| 334 | Ga0207700_10016606 | 3300025928 | Bacteria | 4895 |
| 335 | Ga0207700_10103988 | 3300025928 | Unclassified | 2271 |
| 336 | Ga0207700_10163167 | 3300025928 | Bacteria | 1852 |
| 337 | Ga0207700_10650839 | 3300025928 | Bacteria | 939 |
| 338 | Ga0207700_11021606 | 3300025928 | Unclassified | 740 |
| 339 | Ga0207700_11219047 | 3300025928 | Unclassified | 671 |
| 340 | Ga0207664_10000098 | 3300025929 | Bacteria | 80444 |
| 341 | Ga0207664_10131242 | 3300025929 | Bacteria | 2109 |
| 342 | Ga0207664_10840614 | 3300025929 | Bacteria | 825 |
| 343 | Ga0207690_10574490 | 3300025932 | Bacteria | 918 |
| 344 | Ga0207706_10000590 | 3300025933 | Bacteria | 38531 |
| 345 | Ga0207686_10032810 | 3300025934 | Bacteria | 3093 |
| 346 | Ga0207686_11612060 | 3300025934 | Unclassified | 536 |
| 347 | Ga0207709_10358678 | 3300025935 | Bacteria | 1103 |
| 348 | Ga0207669_10716928 | 3300025937 | Bacteria | 823 |
| 349 | Ga0207665_10005642 | 3300025939 | Bacteria | 8344 |
| 350 | Ga0207665_10017983 | 3300025939 | Bacteria | 4647 |
| 351 | Ga0207665_10025469 | 3300025939 | Bacteria | 3903 |
| 352 | Ga0207665_10043179 | 3300025939 | Bacteria | 3014 |
| 353 | Ga0207665_10047088 | 3300025939 | Bacteria | 2890 |
| 354 | Ga0207665_10182520 | 3300025939 | Bacteria | 1520 |
| 355 | Ga0207665_10194240 | 3300025939 | Bacteria | 1476 |
| 356 | Ga0207665_10234617 | 3300025939 | Bacteria | 1349 |
| 357 | Ga0207665_10485271 | 3300025939 | Bacteria | 953 |
| 358 | Ga0207665_10513089 | 3300025939 | Bacteria | 927 |
| 359 | Ga0207711_10007737 | 3300025941 | Bacteria | 8978 |
| 360 | Ga0207711_10147620 | 3300025941 | Bacteria | 2120 |
| 361 | Ga0207689_10045944 | 3300025942 | Bacteria | 3610 |
| 362 | Ga0207661_10847012 | 3300025944 | Bacteria | 842 |
| 363 | Ga0207679_10403404 | 3300025945 | Bacteria | 1203 |
| 364 | Ga0207667_10086715 | 3300025949 | Bacteria | 3239 |
| 365 | Ga0207712_10282256 | 3300025961 | Bacteria | 1356 |
| 366 | Ga0207668_10010105 | 3300025972 | Bacteria | 5688 |
| 367 | Ga0207640_10545464 | 3300025981 | Bacteria | 973 |
| 368 | Ga0207658_10025179 | 3300025986 | Bacteria | 4166 |
| 369 | Ga0207658_10959131 | 3300025986 | Bacteria | 780 |
| 370 | Ga0207677_10181975 | 3300026023 | Bacteria | 1654 |
| 371 | Ga0207703_10097089 | 3300026035 | Bacteria | 2489 |
| 372 | Ga0207703_11295541 | 3300026035 | Bacteria | 701 |
| 373 | Ga0207703_11430120 | 3300026035 | Unclassified | 665 |
| 374 | Ga0207639_10151750 | 3300026041 | Bacteria | 1941 |
| 375 | Ga0207678_10003766 | 3300026067 | Bacteria | 13638 |
| 376 | Ga0207702_10072978 | 3300026078 | Bacteria | 2959 |
| 377 | Ga0207702_10905238 | 3300026078 | Bacteria | 874 |
| 378 | Ga0207702_11300500 | 3300026078 | Bacteria | 721 |
| 379 | Ga0207702_12121245 | 3300026078 | Unclassified | 551 |
| 380 | Ga0207641_10066111 | 3300026088 | Unclassified | 3095 |
| 381 | Ga0207648_10002534 | 3300026089 | Bacteria | 19609 |
| 382 | Ga0207676_10145695 | 3300026095 | Unclassified | 2034 |
| 383 | Ga0207683_10986382 | 3300026121 | Bacteria | 782 |
| 384 | Ga0207698_10153013 | 3300026142 | Bacteria | 2005 |
| 385 | Ga0207428_10832494 | 3300027907 | Bacteria | 654 |
| 386 | Ga0265356_1029839 | 3300028017 | Unclassified | 592 |
| 387 | Ga0265357_1030986 | 3300028023 | Unclassified | 611 |
| 388 | Ga0268265_10146740 | 3300028380 | Bacteria | 1983 |
| 389 | Ga0268264_10049672 | 3300028381 | Bacteria | 3491 |
| 390 | Ga0268264_10270946 | 3300028381 | Bacteria | 1586 |
| 391 | Ga0268264_11008139 | 3300028381 | Bacteria | 839 |
| 392 | Ga0265338_10000716 | 3300028800 | Bacteria | 56718 |
| 393 | Ga0265338_10101137 | 3300028800 | Bacteria | 2348 |
| 394 | Ga0265338_10135009 | 3300028800 | Bacteria | 1941 |
| 395 | Ga0265338_10157292 | 3300028800 | Bacteria | 1759 |
| 396 | Ga0265338_10277862 | 3300028800 | Unclassified | 1225 |
| 397 | Ga0265762_1002722 | 3300030760 | Bacteria | 3161 |
| 398 | Ga0265762_1011214 | 3300030760 | Bacteria | 1603 |
| 399 | Ga0265770_1013185 | 3300030878 | Bacteria | 1233 |
| 400 | Ga0265760_10031605 | 3300031090 | Bacteria | 1561 |
| 401 | Ga0265760_10290782 | 3300031090 | Unclassified | 577 |
| 402 | Ga0265340_10060646 | 3300031247 | Bacteria | 1811 |
| 403 | Ga0265339_10029063 | 3300031249 | Bacteria | 3139 |
| 404 | Ga0265339_10178648 | 3300031249 | Bacteria | 1058 |
| 405 | Ga0265316_10000652 | 3300031344 | Bacteria | 38558 |
| 406 | Ga0265316_10006032 | 3300031344 | Bacteria | 11643 |
| 407 | Ga0265316_10195675 | 3300031344 | Bacteria | 1500 |
| 408 | Ga0265316_10235101 | 3300031344 | Bacteria | 1348 |
| 409 | Ga0265316_10592316 | 3300031344 | Bacteria | 787 |
| 410 | Ga0265316_10885614 | 3300031344 | Unclassified | 624 |
| 411 | Ga0265316_11262558 | 3300031344 | Unclassified | 510 |
| 412 | Ga0265314_10000572 | 3300031711 | Bacteria | 46833 |
| 413 | Ga0265314_10064871 | 3300031711 | Bacteria | 2470 |
| 414 | Ga0265314_10189439 | 3300031711 | Bacteria | 1225 |
| 415 | Ga0307416_103596955 | 3300032002 | Unclassified | 519 |
| 416 | Ga0316212_1001045 | 3300033547 | Bacteria | 3666 |
| 417 | Ga0373930_0128441 | 3300034816 | Bacteria | 622 |
| 418 | Ga0373950_0073282 | 3300034818 | Bacteria | 705 |
| 419 | Ga0373959_0055771 | 3300034820 | Bacteria | 864 |
| 420 | Ga0373926_0149821 | 3300035083 | Unclassified | 888 |
| 421 | Ga0373926_0311991 | 3300035083 | Unclassified | 615 |
| 422 | Ga0373926_0312920 | 3300035083 | Unclassified | 614 |
| 423 | Ga0373926_0334143 | 3300035083 | Bacteria | 594 |
| 424 | Ga0373928_0070590 | 3300035084 | Bacteria | 863 |
| 425 | Ga0373928_0235671 | 3300035084 | Unclassified | 540 |
| 426 | Ga0373934_0018523 | 3300035086 | Unclassified | 2665 |
| 427 | Ga0373940_0037665 | 3300035088 | Bacteria | 1317 |
| 428 | Ga0373923_0064482 | 3300035111 | Bacteria | 1562 |
| 429 | Ga0373923_0092781 | 3300035111 | Bacteria | 1323 |
| 430 | Ga0373932_0109575 | 3300035112 | Bacteria | 908 |
| 431 | Ga0373936_0006947 | 3300035113 | Bacteria | 4260 |
| 432 | Ga0373936_0010612 | 3300035113 | Bacteria | 3477 |
| 433 | Ga0373945_0007745 | 3300035116 | Bacteria | 3484 |
| 434 | Ga0373945_0048130 | 3300035116 | Unclassified | 1561 |
| 435 | Ga0373953_0021632 | 3300035117 | Unclassified | 2416 |
| 436 | Ga0373954_0035138 | 3300035118 | Bacteria | 2323 |
| 437 | Ga0373956_0116467 | 3300035119 | Unclassified | 1246 |
| 438 | Ga0373957_0062102 | 3300035120 | Unclassified | 1449 |
| 439 | Ga0373960_0121108 | 3300035121 | Bacteria | 868 |
| 440 | Ga0373943_0000652 | 3300035170 | Bacteria | 15006 |
| 441 | Ga0373943_0055244 | 3300035170 | Unclassified | 1966 |
| 442 | Ga0373943_0856913 | 3300035170 | Bacteria | 542 |
| 443 | Ga0373946_0052307 | 3300035171 | Unclassified | 1713 |
| 444 | Ga0373955_0035719 | 3300035172 | Unclassified | 2633 |
| 445 | Ga0373942_0090497 | 3300035207 | Bacteria | 921 |
| 446 | Ga0373961_0331115 | 3300035241 | Bacteria | 570 |
| 447 | Ga0373924_0050754 | 3300035410 | Bacteria | 1718 |
| 448 | Ga0373924_0249398 | 3300035410 | Unclassified | 786 |
| 449 | Ga0373924_0541235 | 3300035410 | Bacteria | 524 |
| 450 | Ga0373931_0041032 | 3300035691 | Bacteria | 2430 |
| 451 | Ga0373931_0380722 | 3300035691 | Bacteria | 889 |
| 452 | Ga0373935_0003067 | 3300035692 | Bacteria | 9629 |
| 453 | Ga0373935_0003233 | 3300035692 | Bacteria | 9415 |
| 454 | Ga0373935_0062609 | 3300035692 | Bacteria | 2383 |
| 455 | Ga0373935_0360671 | 3300035692 | Bacteria | 1038 |
| 456 | Ga0373935_0426497 | 3300035692 | Bacteria | 955 |
| 457 | Ga0373927_0000282 | 3300035695 | Bacteria | 40021 |
| 458 | Ga0373927_0024041 | 3300035695 | Bacteria | 3986 |
| 459 | Ga0373927_0168656 | 3300035695 | Unclassified | 1435 |
| 460 | Ga0373927_0176179 | 3300035695 | Unclassified | 1402 |
| 461 | Ga0373933_0028605 | 3300035724 | Bacteria | 3217 |
| 462 | Ga0373933_0456104 | 3300035724 | Unclassified | 836 |
| 463 | Ga0373947_0001095 | 3300035725 | Bacteria | 16615 |
| 464 | Ga0373947_0385106 | 3300035725 | Unclassified | 944 |
| 465 | Ga0373947_1215164 | 3300035725 | Unclassified | 513 |
| 466 | Ga0373937_0265061 | 3300036401 | Bacteria | 1621 |
| 467 | Ga0373937_0642095 | 3300036401 | Bacteria | 1007 |
| 468 | Ga0373937_0769456 | 3300036401 | Bacteria | 910 |
| 469 | Ga0373937_0910441 | 3300036401 | Bacteria | 828 |
| 470 | Ga0373925_0001335 | 3300037068 | Bacteria | 21578 |
| 471 | Ga0373925_0022875 | 3300037068 | Unclassified | 4561 |
| 472 | Ga0373925_0035759 | 3300037068 | Bacteria | 3666 |
| 473 | Ga0373925_0039815 | 3300037068 | Bacteria | 3478 |
| 474 | Ga0373925_0061179 | 3300037068 | Bacteria | 2828 |
| 475 | Ga0373925_1035447 | 3300037068 | Bacteria | 676 |
| 476 | Ga0395900_1693970 | 3300037418 | Unclassified | 543 |
| 477 | Ga0242420_013682 | 3300038996 | Bacteria | 1385 |
| 478 | Ga0436360_1114409 | 3300039438 | Unclassified | 673 |
| 479 | Ga0451577_0339432 | 3300042876 | Bacteria | 1363 |
| 480 | Ga0466966_0735325 | 3300044684 | Bacteria | 595 |
| 481 | Ga0466964_0140527 | 3300044706 | Bacteria | 1109 |
| 482 | Ga0453684_2316560 | 3300044712 | Bacteria | 534 |
| 483 | Ga0451576_0041599 | 3300045051 | Unclassified | 4858 |
| 484 | Ga0451576_0651143 | 3300045051 | Bacteria | 1107 |
| 485 | Ga0451576_2062699 | 3300045051 | Bacteria | 587 |
| 486 | Ga0466967_0150332 | 3300045976 | Bacteria | 2176 |
| 487 | Ga0495592_0481341 | 3300046454 | Unclassified | 773 |
| 488 | Ga0495603_0540385 | 3300046455 | Unclassified | 667 |
| 489 | Ga0495629_0100974 | 3300046459 | Unclassified | 2013 |
| 490 | Ga0495653_0266156 | 3300046463 | Bacteria | 1131 |
| 491 | Ga0495580_0000774 | 3300046472 | Bacteria | 27522 |
| 492 | Ga0495580_0002088 | 3300046472 | Bacteria | 17538 |
| 493 | Ga0495580_0008640 | 3300046472 | Bacteria | 8078 |
| 494 | Ga0495580_0068240 | 3300046472 | Bacteria | 2487 |
| 495 | Ga0495580_0101148 | 3300046472 | Bacteria | 2005 |
| 496 | Ga0495580_0114169 | 3300046472 | Bacteria | 1876 |
| 497 | Ga0495580_0619066 | 3300046472 | Bacteria | 714 |
| 498 | Ga0495582_0006163 | 3300046473 | Bacteria | 6676 |
| 499 | Ga0495582_0068893 | 3300046473 | Bacteria | 1956 |
| 500 | Ga0495582_0536272 | 3300046473 | Unclassified | 677 |
| 501 | Ga0495584_0405051 | 3300046491 | Bacteria | 693 |
| 502 | Ga0495630_0391055 | 3300046517 | Bacteria | 1065 |
| 503 | Ga0495630_0573148 | 3300046517 | Unclassified | 865 |
| 504 | Ga0495630_0587971 | 3300046517 | Unclassified | 853 |
| 505 | Ga0495652_0415069 | 3300046529 | Unclassified | 950 |
| 506 | Ga0495665_0101208 | 3300046531 | Bacteria | 1512 |
| 507 | Ga0495640_0801331 | 3300046533 | Unclassified | 561 |
| 508 | Ga0495586_0363855 | 3300046535 | Unclassified | 831 |
| 509 | Ga0495635_0119034 | 3300046663 | Bacteria | 1802 |
| 510 | Ga0495635_0236981 | 3300046663 | Unclassified | 1232 |
| 511 | Ga0495588_0665229 | 3300046674 | Unclassified | 545 |
| 512 | Ga0495657_0887224 | 3300046675 | Unclassified | 507 |
| 513 | Ga0495599_0539864 | 3300046678 | Unclassified | 683 |
| 514 | Ga0495623_0665915 | 3300046679 | Unclassified | 536 |
| 515 | Ga0495658_0006630 | 3300046683 | Bacteria | 5690 |
| 516 | Ga0495669_0191089 | 3300046684 | Bacteria | 977 |
| 517 | Ga0495624_0690023 | 3300046690 | Bacteria | 606 |
| 518 | Ga0495581_0125259 | 3300047315 | Unclassified | 1496 |
| 519 | Ga0495581_0275983 | 3300047315 | Unclassified | 983 |
| 520 | Ga0495674_0007090 | 3300047319 | Bacteria | 10725 |
| 521 | Ga0495674_0088728 | 3300047319 | Bacteria | 2644 |
| 522 | Ga0495674_0107971 | 3300047319 | Bacteria | 2362 |
| 523 | Ga0495676_0215035 | 3300047321 | Unclassified | 1328 |
| 524 | Ga0495684_0362082 | 3300047471 | Unclassified | 1027 |
| 525 | Ga0495593_0269294 | 3300047673 | Unclassified | 852 |
| 526 | Ga0495593_0581987 | 3300047673 | Unclassified | 562 |
| 527 | Ga0495602_0448048 | 3300048088 | Unclassified | 912 |
| 528 | Ga0496100_0073349 | 3300048903 | Bacteria | 2290 |
| 529 | Ga0496100_1018880 | 3300048903 | Unclassified | 652 |
| 530 | Ga0496101_0024453 | 3300048904 | Bacteria | 4181 |
| 531 | Ga0496101_0198438 | 3300048904 | Bacteria | 1550 |
| 532 | Ga0496101_0502367 | 3300048904 | Bacteria | 958 |
| 533 | Ga0496101_0998519 | 3300048904 | Bacteria | 658 |
| 534 | Ga0496102_0000882 | 3300048905 | Bacteria | 28596 |
| 535 | Ga0496102_0278918 | 3300048905 | Bacteria | 1575 |
| 536 | Ga0496102_0310551 | 3300048905 | Bacteria | 1486 |
| 537 | Ga0496102_0668266 | 3300048905 | Bacteria | 962 |
| 538 | Ga0496103_0010332 | 3300048906 | Bacteria | 5524 |
| 539 | Ga0496103_0019618 | 3300048906 | Bacteria | 4059 |
| 540 | Ga0496104_0079680 | 3300048907 | Unclassified | 3122 |
| 541 | Ga0496104_0164806 | 3300048907 | Bacteria | 2125 |
| 542 | Ga0496105_0057191 | 3300048908 | Bacteria | 3221 |
| 543 | Ga0496105_0069913 | 3300048908 | Bacteria | 2902 |
| 544 | Ga0496105_0468280 | 3300048908 | Bacteria | 993 |
| 545 | Ga0496106_0010794 | 3300048909 | Bacteria | 6753 |
| 546 | Ga0496106_0181497 | 3300048909 | Bacteria | 1671 |
| 547 | Ga0496107_0004478 | 3300048910 | Bacteria | 9475 |
| 548 | Ga0496107_0034006 | 3300048910 | Bacteria | 3649 |
| 549 | Ga0496107_0623884 | 3300048910 | Bacteria | 796 |
| 550 | Ga0496108_0281737 | 3300048911 | Bacteria | 1447 |
| 551 | Ga0496110_1749802 | 3300048913 | Unclassified | 532 |
| 552 | Ga0496111_0300461 | 3300048914 | Bacteria | 1190 |
| 553 | Ga0496112_0367361 | 3300048915 | Bacteria | 1380 |
| 554 | Ga0496113_0628439 | 3300048916 | Bacteria | 859 |
| 555 | Ga0496114_0159719 | 3300048917 | Bacteria | 1959 |
| 556 | Ga0496114_0337848 | 3300048917 | Bacteria | 1332 |
| 557 | Ga0496115_0024296 | 3300048918 | Unclassified | 4709 |
| 558 | Ga0496115_0302514 | 3300048918 | Bacteria | 1310 |
| 559 | Ga0496115_0667439 | 3300048918 | Bacteria | 820 |
| 560 | Ga0496115_0851176 | 3300048918 | Unclassified | 706 |
| 561 | Ga0496126_0328818 | 3300048929 | Unclassified | 1255 |
| 562 | Ga0501032_0930639 | 3300049569 | Unclassified | 547 |
| 563 | Ga0501047_0144467 | 3300049581 | Bacteria | 2257 |
| 564 | Ga0501069_0004579 | 3300049585 | Bacteria | 7151 |
| 565 | Ga0501070_0326842 | 3300049586 | Bacteria | 1247 |
| 566 | Ga0501044_0000602 | 3300049823 | Bacteria | 43645 |
| 567 | Ga0501044_0001219 | 3300049823 | Bacteria | 30541 |
| 568 | nmdc:mga08y16_1128749_c1 | 3300050511 | Bacteria | 758 |
| 569 | nmdc:mga0n895_213062_c1 | 3300050512 | Bacteria | 1962 |
| 570 | nmdc:mga0rr50_1201033_c1 | 3300050513 | Unclassified | 644 |
| 571 | nmdc:mga0rr50_1272758_c1 | 3300050513 | Bacteria | 624 |
| 572 | nmdc:mga0rr50_298416_c1 | 3300050513 | Bacteria | 1347 |
| 573 | nmdc:mga08x19_105104_c1 | 3300050514 | Bacteria | 1877 |
| 574 | Ga0495601_0407885 | 3300053077 | Unclassified | 880 |
| 575 | Ga0495619_0043233 | 3300053085 | Bacteria | 2953 |
| 576 | Ga0495619_0626984 | 3300053085 | Unclassified | 735 |
| 577 | Ga0495619_0664253 | 3300053085 | Unclassified | 710 |
| 578 | Ga0501082_0016497 | 3300060353 | Bacteria | 6356 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049581 | Ga0501047_0144467 | Ga0501047_0144467_688_921 | 57 |
| 2 | 3300049586 | Ga0501070_0326842 | Ga0501070_0326842_704_937 | 57 |
| 3 | 3300049823 | Ga0501044_0000602 | Ga0501044_0000602_34383_34616 | 57 |
| 4 | 3300049823 | Ga0501044_0001219 | Ga0501044_0001219_16732_16965 | 57 |
| 5 | 3300049569 | Ga0501032_0930639 | Ga0501032_0930639_45_278 | 58 |
| 6 | 3300049585 | Ga0501069_0004579 | Ga0501069_0004579_23_202 | 58 |
| 7 | 3300060353 | Ga0501082_0016497 | Ga0501082_0016497_24_203 | 58 |
| 8 | 3300005354 | Ga0070675_100951260 | Ga0070675_1009512601 | 62 |
| 9 | 3300005618 | Ga0068864_100627181 | Ga0068864_1006271812 | 62 |
| 10 | 3300005841 | Ga0068863_101239260 | Ga0068863_1012392602 | 62 |
| 11 | 3300009177 | Ga0105248_10579232 | Ga0105248_105792322 | 62 |
| 12 | 3300013296 | Ga0157374_10319115 | Ga0157374_103191152 | 62 |
| 13 | 3300013306 | Ga0163162_12867768 | Ga0163162_128677682 | 62 |
| 14 | 3300013308 | Ga0157375_10829528 | Ga0157375_108295282 | 62 |
| 15 | 3300014325 | Ga0163163_10943311 | Ga0163163_109433112 | 62 |
| 16 | 3300025941 | Ga0207711_10147620 | Ga0207711_101476202 | 62 |
| 17 | 3300026095 | Ga0207676_10145695 | Ga0207676_101456952 | 62 |
| 18 | 3300048913 | Ga0496110_1749802 | Ga0496110_1749802_218_421 | 62 |
| 19 | 3300005539 | Ga0068853_102119339 | Ga0068853_1021193392 | 63 |
| 20 | 3300032002 | Ga0307416_103596955 | Ga0307416_1035969552 | 63 |
| 21 | 3300005436 | Ga0070713_102111555 | Ga0070713_1021115551 | 66 |
| 22 | 3300045051 | Ga0451576_2062699 | Ga0451576_2062699_58_276 | 66 |
| 23 | 3300005336 | Ga0070680_100381016 | Ga0070680_1003810162 | 67 |
| 24 | 3300005434 | Ga0070709_10000540 | Ga0070709_1000054012 | 67 |
| 25 | 3300005434 | Ga0070709_10338224 | Ga0070709_103382241 | 67 |
| 26 | 3300005434 | Ga0070709_10516307 | Ga0070709_105163072 | 67 |
| 27 | 3300005434 | Ga0070709_10875202 | Ga0070709_108752021 | 67 |
| 28 | 3300005434 | Ga0070709_11261560 | Ga0070709_112615602 | 67 |
| 29 | 3300005435 | Ga0070714_100199151 | Ga0070714_1001991512 | 67 |
| 30 | 3300005435 | Ga0070714_100674061 | Ga0070714_1006740612 | 67 |
| 31 | 3300005435 | Ga0070714_100966012 | Ga0070714_1009660122 | 67 |
| 32 | 3300005435 | Ga0070714_101156822 | Ga0070714_1011568221 | 67 |
| 33 | 3300005435 | Ga0070714_101908540 | Ga0070714_1019085401 | 67 |
| 34 | 3300005435 | Ga0070714_101949997 | Ga0070714_1019499971 | 67 |
| 35 | 3300005436 | Ga0070713_100000909 | Ga0070713_1000009094 | 67 |
| 36 | 3300005436 | Ga0070713_100001436 | Ga0070713_1000014367 | 67 |
| 37 | 3300005436 | Ga0070713_100011192 | Ga0070713_1000111924 | 67 |
| 38 | 3300005436 | Ga0070713_100279625 | Ga0070713_1002796252 | 67 |
| 39 | 3300005436 | Ga0070713_100283626 | Ga0070713_1002836262 | 67 |
| 40 | 3300005436 | Ga0070713_100378854 | Ga0070713_1003788541 | 67 |
| 41 | 3300005436 | Ga0070713_100385193 | Ga0070713_1003851932 | 67 |
| 42 | 3300005436 | Ga0070713_100880676 | Ga0070713_1008806762 | 67 |
| 43 | 3300005436 | Ga0070713_100946419 | Ga0070713_1009464192 | 67 |
| 44 | 3300005437 | Ga0070710_10016640 | Ga0070710_100166403 | 67 |
| 45 | 3300005437 | Ga0070710_10033073 | Ga0070710_100330732 | 67 |
| 46 | 3300005437 | Ga0070710_10139218 | Ga0070710_101392182 | 67 |
| 47 | 3300005437 | Ga0070710_10532351 | Ga0070710_105323512 | 67 |
| 48 | 3300005437 | Ga0070710_11282272 | Ga0070710_112822722 | 67 |
| 49 | 3300005439 | Ga0070711_100000291 | Ga0070711_10000029110 | 67 |
| 50 | 3300005439 | Ga0070711_100006753 | Ga0070711_1000067536 | 67 |
| 51 | 3300005439 | Ga0070711_100037847 | Ga0070711_1000378472 | 67 |
| 52 | 3300005439 | Ga0070711_100045534 | Ga0070711_1000455342 | 67 |
| 53 | 3300005439 | Ga0070711_100267372 | Ga0070711_1002673722 | 67 |
| 54 | 3300005439 | Ga0070711_100388022 | Ga0070711_1003880222 | 67 |
| 55 | 3300005439 | Ga0070711_101159458 | Ga0070711_1011594582 | 67 |
| 56 | 3300005445 | Ga0070708_100002397 | Ga0070708_1000023973 | 67 |
| 57 | 3300005445 | Ga0070708_100152009 | Ga0070708_1001520092 | 67 |
| 58 | 3300005458 | Ga0070681_10037931 | Ga0070681_100379314 | 67 |
| 59 | 3300005467 | Ga0070706_100126839 | Ga0070706_1001268392 | 67 |
| 60 | 3300005467 | Ga0070706_100873724 | Ga0070706_1008737242 | 67 |
| 61 | 3300005468 | Ga0070707_100260566 | Ga0070707_1002605662 | 67 |
| 62 | 3300005471 | Ga0070698_100115556 | Ga0070698_1001155562 | 67 |
| 63 | 3300005530 | Ga0070679_100611341 | Ga0070679_1006113411 | 67 |
| 64 | 3300005564 | Ga0070664_101728523 | Ga0070664_1017285232 | 67 |
| 65 | 3300005614 | Ga0068856_102409055 | Ga0068856_1024090552 | 67 |
| 66 | 3300005983 | Ga0081540_1045576 | Ga0081540_10455763 | 67 |
| 67 | 3300006028 | Ga0070717_10001140 | Ga0070717_100011406 | 67 |
| 68 | 3300006028 | Ga0070717_10011272 | Ga0070717_100112722 | 67 |
| 69 | 3300006028 | Ga0070717_10030213 | Ga0070717_100302132 | 67 |
| 70 | 3300006028 | Ga0070717_10033310 | Ga0070717_100333102 | 67 |
| 71 | 3300006028 | Ga0070717_10047492 | Ga0070717_100474922 | 67 |
| 72 | 3300006028 | Ga0070717_10061732 | Ga0070717_100617322 | 67 |
| 73 | 3300006028 | Ga0070717_10062767 | Ga0070717_100627672 | 67 |
| 74 | 3300006028 | Ga0070717_10420639 | Ga0070717_104206392 | 67 |
| 75 | 3300006028 | Ga0070717_10427351 | Ga0070717_104273512 | 67 |
| 76 | 3300006163 | Ga0070715_10004799 | Ga0070715_100047992 | 67 |
| 77 | 3300006163 | Ga0070715_10008869 | Ga0070715_100088692 | 67 |
| 78 | 3300006173 | Ga0070716_100009213 | Ga0070716_1000092131 | 67 |
| 79 | 3300006173 | Ga0070716_100215544 | Ga0070716_1002155442 | 67 |
| 80 | 3300006173 | Ga0070716_100256695 | Ga0070716_1002566952 | 67 |
| 81 | 3300006173 | Ga0070716_100749186 | Ga0070716_1007491862 | 67 |
| 82 | 3300006175 | Ga0070712_100000105 | Ga0070712_10000010533 | 67 |
| 83 | 3300006175 | Ga0070712_100001546 | Ga0070712_1000015465 | 67 |
| 84 | 3300006175 | Ga0070712_100107130 | Ga0070712_1001071302 | 67 |
| 85 | 3300006175 | Ga0070712_100452727 | Ga0070712_1004527272 | 67 |
| 86 | 3300006175 | Ga0070712_100833396 | Ga0070712_1008333962 | 67 |
| 87 | 3300007076 | Ga0075435_101608624 | Ga0075435_1016086242 | 67 |
| 88 | 3300007788 | Ga0099795_10040407 | Ga0099795_100404072 | 67 |
| 89 | 3300009093 | Ga0105240_10016327 | Ga0105240_100163276 | 67 |
| 90 | 3300009174 | Ga0105241_10125772 | Ga0105241_101257722 | 67 |
| 91 | 3300009545 | Ga0105237_10322568 | Ga0105237_103225682 | 67 |
| 92 | 3300011119 | Ga0105246_11867147 | Ga0105246_118671472 | 67 |
| 93 | 3300012505 | Ga0157339_1063953 | Ga0157339_10639531 | 67 |
| 94 | 3300013100 | Ga0157373_11513686 | Ga0157373_115136862 | 67 |
| 95 | 3300013307 | Ga0157372_10023159 | Ga0157372_100231595 | 67 |
| 96 | 3300013307 | Ga0157372_10389842 | Ga0157372_103898422 | 67 |
| 97 | 3300014969 | Ga0157376_10420982 | Ga0157376_104209822 | 67 |
| 98 | 3300024225 | Ga0224572_1037668 | Ga0224572_10376682 | 67 |
| 99 | 3300025898 | Ga0207692_10003857 | Ga0207692_100038574 | 67 |
| 100 | 3300025898 | Ga0207692_10020990 | Ga0207692_100209902 | 67 |
| 101 | 3300025898 | Ga0207692_10324776 | Ga0207692_103247762 | 67 |
| 102 | 3300025905 | Ga0207685_10001524 | Ga0207685_100015242 | 67 |
| 103 | 3300025906 | Ga0207699_10001136 | Ga0207699_100011364 | 67 |
| 104 | 3300025906 | Ga0207699_10208864 | Ga0207699_102088642 | 67 |
| 105 | 3300025906 | Ga0207699_10614288 | Ga0207699_106142882 | 67 |
| 106 | 3300025910 | Ga0207684_10073793 | Ga0207684_100737933 | 67 |
| 107 | 3300025911 | Ga0207654_10413504 | Ga0207654_104135042 | 67 |
| 108 | 3300025912 | Ga0207707_10098652 | Ga0207707_100986522 | 67 |
| 109 | 3300025912 | Ga0207707_10474502 | Ga0207707_104745021 | 67 |
| 110 | 3300025913 | Ga0207695_10137761 | Ga0207695_101377612 | 67 |
| 111 | 3300025914 | Ga0207671_11210490 | Ga0207671_112104902 | 67 |
| 112 | 3300025915 | Ga0207693_10000016 | Ga0207693_10000016113 | 67 |
| 113 | 3300025915 | Ga0207693_10000065 | Ga0207693_1000006537 | 67 |
| 114 | 3300025915 | Ga0207693_10225574 | Ga0207693_102255742 | 67 |
| 115 | 3300025915 | Ga0207693_10301766 | Ga0207693_103017662 | 67 |
| 116 | 3300025915 | Ga0207693_10367135 | Ga0207693_103671352 | 67 |
| 117 | 3300025916 | Ga0207663_10004470 | Ga0207663_100044706 | 67 |
| 118 | 3300025916 | Ga0207663_10007570 | Ga0207663_100075702 | 67 |
| 119 | 3300025916 | Ga0207663_10031586 | Ga0207663_100315863 | 67 |
| 120 | 3300025916 | Ga0207663_10043257 | Ga0207663_100432572 | 67 |
| 121 | 3300025916 | Ga0207663_10153838 | Ga0207663_101538382 | 67 |
| 122 | 3300025916 | Ga0207663_11067688 | Ga0207663_110676882 | 67 |
| 123 | 3300025917 | Ga0207660_10193107 | Ga0207660_101931072 | 67 |
| 124 | 3300025922 | Ga0207646_10093939 | Ga0207646_100939393 | 67 |
| 125 | 3300025928 | Ga0207700_10001701 | Ga0207700_100017012 | 67 |
| 126 | 3300025928 | Ga0207700_10001772 | Ga0207700_100017728 | 67 |
| 127 | 3300025928 | Ga0207700_10016606 | Ga0207700_100166064 | 67 |
| 128 | 3300025928 | Ga0207700_10103988 | Ga0207700_101039882 | 67 |
| 129 | 3300025928 | Ga0207700_10163167 | Ga0207700_101631672 | 67 |
| 130 | 3300025928 | Ga0207700_10650839 | Ga0207700_106508392 | 67 |
| 131 | 3300025928 | Ga0207700_11021606 | Ga0207700_110216062 | 67 |
| 132 | 3300025929 | Ga0207664_10000098 | Ga0207664_1000009828 | 67 |
| 133 | 3300025929 | Ga0207664_10131242 | Ga0207664_101312422 | 67 |
| 134 | 3300025929 | Ga0207664_10840614 | Ga0207664_108406142 | 67 |
| 135 | 3300025939 | Ga0207665_10005642 | Ga0207665_100056426 | 67 |
| 136 | 3300025939 | Ga0207665_10025469 | Ga0207665_100254694 | 67 |
| 137 | 3300025939 | Ga0207665_10043179 | Ga0207665_100431793 | 67 |
| 138 | 3300025939 | Ga0207665_10047088 | Ga0207665_100470883 | 67 |
| 139 | 3300025939 | Ga0207665_10234617 | Ga0207665_102346172 | 67 |
| 140 | 3300025939 | Ga0207665_10485271 | Ga0207665_104852711 | 67 |
| 141 | 3300025944 | Ga0207661_10847012 | Ga0207661_108470122 | 67 |
| 142 | 3300025945 | Ga0207679_10403404 | Ga0207679_104034042 | 67 |
| 143 | 3300026078 | Ga0207702_10905238 | Ga0207702_109052382 | 67 |
| 144 | 3300028800 | Ga0265338_10000716 | Ga0265338_1000071627 | 67 |
| 145 | 3300028800 | Ga0265338_10101137 | Ga0265338_101011372 | 67 |
| 146 | 3300028800 | Ga0265338_10135009 | Ga0265338_101350091 | 67 |
| 147 | 3300028800 | Ga0265338_10157292 | Ga0265338_101572922 | 67 |
| 148 | 3300031249 | Ga0265339_10178648 | Ga0265339_101786481 | 67 |
| 149 | 3300031344 | Ga0265316_10006032 | Ga0265316_100060327 | 67 |
| 150 | 3300031344 | Ga0265316_10195675 | Ga0265316_101956752 | 67 |
| 151 | 3300031344 | Ga0265316_10235101 | Ga0265316_102351012 | 67 |
| 152 | 3300031344 | Ga0265316_10592316 | Ga0265316_105923162 | 67 |
| 153 | 3300031344 | Ga0265316_11262558 | Ga0265316_112625582 | 67 |
| 154 | 3300035083 | Ga0373926_0149821 | Ga0373926_0149821_84_323 | 67 |
| 155 | 3300035083 | Ga0373926_0311991 | Ga0373926_0311991_77_316 | 67 |
| 156 | 3300035083 | Ga0373926_0334143 | Ga0373926_0334143_23_226 | 67 |
| 157 | 3300035086 | Ga0373934_0018523 | Ga0373934_0018523_206_445 | 67 |
| 158 | 3300035111 | Ga0373923_0064482 | Ga0373923_0064482_876_1115 | 67 |
| 159 | 3300035113 | Ga0373936_0006947 | Ga0373936_0006947_2924_3163 | 67 |
| 160 | 3300035113 | Ga0373936_0010612 | Ga0373936_0010612_2912_3151 | 67 |
| 161 | 3300035116 | Ga0373945_0007745 | Ga0373945_0007745_2108_2347 | 67 |
| 162 | 3300035116 | Ga0373945_0048130 | Ga0373945_0048130_569_808 | 67 |
| 163 | 3300035117 | Ga0373953_0021632 | Ga0373953_0021632_2157_2396 | 67 |
| 164 | 3300035118 | Ga0373954_0035138 | Ga0373954_0035138_1099_1338 | 67 |
| 165 | 3300035119 | Ga0373956_0116467 | Ga0373956_0116467_338_577 | 67 |
| 166 | 3300035120 | Ga0373957_0062102 | Ga0373957_0062102_460_699 | 67 |
| 167 | 3300035170 | Ga0373943_0000652 | Ga0373943_0000652_1755_1994 | 67 |
| 168 | 3300035170 | Ga0373943_0055244 | Ga0373943_0055244_1429_1668 | 67 |
| 169 | 3300035170 | Ga0373943_0856913 | Ga0373943_0856913_204_407 | 67 |
| 170 | 3300035171 | Ga0373946_0052307 | Ga0373946_0052307_255_494 | 67 |
| 171 | 3300035172 | Ga0373955_0035719 | Ga0373955_0035719_1593_1832 | 67 |
| 172 | 3300035410 | Ga0373924_0050754 | Ga0373924_0050754_654_893 | 67 |
| 173 | 3300035410 | Ga0373924_0249398 | Ga0373924_0249398_53_292 | 67 |
| 174 | 3300035410 | Ga0373924_0541235 | Ga0373924_0541235_25_228 | 67 |
| 175 | 3300035692 | Ga0373935_0003067 | Ga0373935_0003067_2746_2985 | 67 |
| 176 | 3300035692 | Ga0373935_0003233 | Ga0373935_0003233_8813_9052 | 67 |
| 177 | 3300035692 | Ga0373935_0062609 | Ga0373935_0062609_1796_2035 | 67 |
| 178 | 3300035692 | Ga0373935_0360671 | Ga0373935_0360671_342_581 | 67 |
| 179 | 3300035695 | Ga0373927_0000282 | Ga0373927_0000282_26133_26372 | 67 |
| 180 | 3300035695 | Ga0373927_0168656 | Ga0373927_0168656_626_829 | 67 |
| 181 | 3300035695 | Ga0373927_0176179 | Ga0373927_0176179_680_919 | 67 |
| 182 | 3300035724 | Ga0373933_0028605 | Ga0373933_0028605_306_545 | 67 |
| 183 | 3300035724 | Ga0373933_0456104 | Ga0373933_0456104_144_383 | 67 |
| 184 | 3300035725 | Ga0373947_0001095 | Ga0373947_0001095_2570_2809 | 67 |
| 185 | 3300035725 | Ga0373947_0385106 | Ga0373947_0385106_110_349 | 67 |
| 186 | 3300036401 | Ga0373937_0265061 | Ga0373937_0265061_70_309 | 67 |
| 187 | 3300036401 | Ga0373937_0642095 | Ga0373937_0642095_496_735 | 67 |
| 188 | 3300036401 | Ga0373937_0769456 | Ga0373937_0769456_29_244 | 67 |
| 189 | 3300036401 | Ga0373937_0910441 | Ga0373937_0910441_434_673 | 67 |
| 190 | 3300037068 | Ga0373925_0001335 | Ga0373925_0001335_7792_8031 | 67 |
| 191 | 3300037068 | Ga0373925_0022875 | Ga0373925_0022875_817_1020 | 67 |
| 192 | 3300037068 | Ga0373925_0035759 | Ga0373925_0035759_1923_2162 | 67 |
| 193 | 3300037418 | Ga0395900_1693970 | Ga0395900_1693970_272_493 | 67 |
| 194 | 3300044706 | Ga0466964_0140527 | Ga0466964_0140527_530_769 | 67 |
| 195 | 3300045976 | Ga0466967_0150332 | Ga0466967_0150332_793_1032 | 67 |
| 196 | 3300046454 | Ga0495592_0481341 | Ga0495592_0481341_243_482 | 67 |
| 197 | 3300046455 | Ga0495603_0540385 | Ga0495603_0540385_93_332 | 67 |
| 198 | 3300046459 | Ga0495629_0100974 | Ga0495629_0100974_1359_1598 | 67 |
| 199 | 3300046463 | Ga0495653_0266156 | Ga0495653_0266156_462_701 | 67 |
| 200 | 3300046472 | Ga0495580_0000774 | Ga0495580_0000774_25097_25336 | 67 |
| 201 | 3300046472 | Ga0495580_0068240 | Ga0495580_0068240_42_281 | 67 |
| 202 | 3300046472 | Ga0495580_0101148 | Ga0495580_0101148_1751_1990 | 67 |
| 203 | 3300046472 | Ga0495580_0114169 | Ga0495580_0114169_1360_1563 | 67 |
| 204 | 3300046472 | Ga0495580_0619066 | Ga0495580_0619066_104_343 | 67 |
| 205 | 3300046473 | Ga0495582_0006163 | Ga0495582_0006163_2697_2936 | 67 |
| 206 | 3300046473 | Ga0495582_0536272 | Ga0495582_0536272_386_625 | 67 |
| 207 | 3300046491 | Ga0495584_0405051 | Ga0495584_0405051_280_519 | 67 |
| 208 | 3300046517 | Ga0495630_0573148 | Ga0495630_0573148_307_546 | 67 |
| 209 | 3300046517 | Ga0495630_0587971 | Ga0495630_0587971_170_409 | 67 |
| 210 | 3300046529 | Ga0495652_0415069 | Ga0495652_0415069_248_487 | 67 |
| 211 | 3300046535 | Ga0495586_0363855 | Ga0495586_0363855_117_356 | 67 |
| 212 | 3300046663 | Ga0495635_0119034 | Ga0495635_0119034_328_567 | 67 |
| 213 | 3300046663 | Ga0495635_0236981 | Ga0495635_0236981_401_640 | 67 |
| 214 | 3300046674 | Ga0495588_0665229 | Ga0495588_0665229_235_474 | 67 |
| 215 | 3300046675 | Ga0495657_0887224 | Ga0495657_0887224_24_263 | 67 |
| 216 | 3300046678 | Ga0495599_0539864 | Ga0495599_0539864_31_270 | 67 |
| 217 | 3300046679 | Ga0495623_0665915 | Ga0495623_0665915_156_395 | 67 |
| 218 | 3300046683 | Ga0495658_0006630 | Ga0495658_0006630_863_1102 | 67 |
| 219 | 3300046690 | Ga0495624_0690023 | Ga0495624_0690023_336_575 | 67 |
| 220 | 3300047315 | Ga0495581_0125259 | Ga0495581_0125259_702_941 | 67 |
| 221 | 3300047319 | Ga0495674_0007090 | Ga0495674_0007090_6043_6282 | 67 |
| 222 | 3300047319 | Ga0495674_0088728 | Ga0495674_0088728_1685_1924 | 67 |
| 223 | 3300047319 | Ga0495674_0107971 | Ga0495674_0107971_1479_1718 | 67 |
| 224 | 3300047321 | Ga0495676_0215035 | Ga0495676_0215035_730_969 | 67 |
| 225 | 3300047471 | Ga0495684_0362082 | Ga0495684_0362082_226_465 | 67 |
| 226 | 3300047673 | Ga0495593_0269294 | Ga0495593_0269294_573_812 | 67 |
| 227 | 3300047673 | Ga0495593_0581987 | Ga0495593_0581987_116_355 | 67 |
| 228 | 3300048088 | Ga0495602_0448048 | Ga0495602_0448048_317_556 | 67 |
| 229 | 3300048904 | Ga0496101_0502367 | Ga0496101_0502367_541_780 | 67 |
| 230 | 3300048907 | Ga0496104_0079680 | Ga0496104_0079680_938_1177 | 67 |
| 231 | 3300048908 | Ga0496105_0069913 | Ga0496105_0069913_812_1051 | 67 |
| 232 | 3300048917 | Ga0496114_0337848 | Ga0496114_0337848_948_1187 | 67 |
| 233 | 3300048918 | Ga0496115_0024296 | Ga0496115_0024296_3739_3978 | 67 |
| 234 | 3300048918 | Ga0496115_0667439 | Ga0496115_0667439_564_803 | 67 |
| 235 | 3300050513 | nmdc:mga0rr50_1201033_c1 | nmdc:mga0rr50_1201033_c1_66_272 | 67 |
| 236 | 3300053077 | Ga0495601_0407885 | Ga0495601_0407885_189_428 | 67 |
| 237 | 3300053085 | Ga0495619_0626984 | Ga0495619_0626984_104_343 | 67 |
| 238 | 3300053085 | Ga0495619_0664253 | Ga0495619_0664253_359_598 | 67 |
| 239 | 3300005293 | Ga0065715_10012049 | Ga0065715_100120493 | 68 |
| 240 | 3300005293 | Ga0065715_10291325 | Ga0065715_102913252 | 68 |
| 241 | 3300005328 | Ga0070676_10758800 | Ga0070676_107588001 | 68 |
| 242 | 3300005330 | Ga0070690_100431156 | Ga0070690_1004311562 | 68 |
| 243 | 3300005330 | Ga0070690_100795060 | Ga0070690_1007950601 | 68 |
| 244 | 3300005334 | Ga0068869_100143063 | Ga0068869_1001430632 | 68 |
| 245 | 3300005335 | Ga0070666_10231411 | Ga0070666_102314112 | 68 |
| 246 | 3300005335 | Ga0070666_10559130 | Ga0070666_105591302 | 68 |
| 247 | 3300005336 | Ga0070680_100437425 | Ga0070680_1004374252 | 68 |
| 248 | 3300005337 | Ga0070682_100110346 | Ga0070682_1001103462 | 68 |
| 249 | 3300005338 | Ga0068868_100830957 | Ga0068868_1008309572 | 68 |
| 250 | 3300005339 | Ga0070660_100596400 | Ga0070660_1005964002 | 68 |
| 251 | 3300005341 | Ga0070691_10105384 | Ga0070691_101053842 | 68 |
| 252 | 3300005343 | Ga0070687_100300139 | Ga0070687_1003001392 | 68 |
| 253 | 3300005344 | Ga0070661_100004744 | Ga0070661_1000047446 | 68 |
| 254 | 3300005345 | Ga0070692_11105907 | Ga0070692_111059072 | 68 |
| 255 | 3300005347 | Ga0070668_100015991 | Ga0070668_1000159915 | 68 |
| 256 | 3300005353 | Ga0070669_100072940 | Ga0070669_1000729402 | 68 |
| 257 | 3300005354 | Ga0070675_100838139 | Ga0070675_1008381392 | 68 |
| 258 | 3300005356 | Ga0070674_100289838 | Ga0070674_1002898381 | 68 |
| 259 | 3300005366 | Ga0070659_100090683 | Ga0070659_1000906832 | 68 |
| 260 | 3300005367 | Ga0070667_100056467 | Ga0070667_1000564673 | 68 |
| 261 | 3300005434 | Ga0070709_10077720 | Ga0070709_100777201 | 68 |
| 262 | 3300005434 | Ga0070709_10550133 | Ga0070709_105501332 | 68 |
| 263 | 3300005434 | Ga0070709_10731817 | Ga0070709_107318172 | 68 |
| 264 | 3300005434 | Ga0070709_11590438 | Ga0070709_115904382 | 68 |
| 265 | 3300005435 | Ga0070714_100273911 | Ga0070714_1002739112 | 68 |
| 266 | 3300005435 | Ga0070714_101750216 | Ga0070714_1017502162 | 68 |
| 267 | 3300005436 | Ga0070713_100102674 | Ga0070713_1001026742 | 68 |
| 268 | 3300005436 | Ga0070713_100634320 | Ga0070713_1006343202 | 68 |
| 269 | 3300005436 | Ga0070713_101055172 | Ga0070713_1010551722 | 68 |
| 270 | 3300005437 | Ga0070710_10050045 | Ga0070710_100500453 | 68 |
| 271 | 3300005437 | Ga0070710_11043134 | Ga0070710_110431341 | 68 |
| 272 | 3300005437 | Ga0070710_11117807 | Ga0070710_111178071 | 68 |
| 273 | 3300005438 | Ga0070701_10882907 | Ga0070701_108829072 | 68 |
| 274 | 3300005439 | Ga0070711_100008437 | Ga0070711_1000084373 | 68 |
| 275 | 3300005439 | Ga0070711_100067261 | Ga0070711_1000672612 | 68 |
| 276 | 3300005439 | Ga0070711_100170426 | Ga0070711_1001704262 | 68 |
| 277 | 3300005439 | Ga0070711_100924632 | Ga0070711_1009246321 | 68 |
| 278 | 3300005440 | Ga0070705_100321534 | Ga0070705_1003215342 | 68 |
| 279 | 3300005440 | Ga0070705_100446607 | Ga0070705_1004466072 | 68 |
| 280 | 3300005441 | Ga0070700_100135830 | Ga0070700_1001358302 | 68 |
| 281 | 3300005444 | Ga0070694_100115102 | Ga0070694_1001151022 | 68 |
| 282 | 3300005445 | Ga0070708_100025156 | Ga0070708_1000251563 | 68 |
| 283 | 3300005445 | Ga0070708_100497723 | Ga0070708_1004977231 | 68 |
| 284 | 3300005455 | Ga0070663_100082046 | Ga0070663_1000820462 | 68 |
| 285 | 3300005456 | Ga0070678_100775577 | Ga0070678_1007755772 | 68 |
| 286 | 3300005457 | Ga0070662_100020862 | Ga0070662_1000208623 | 68 |
| 287 | 3300005458 | Ga0070681_11191591 | Ga0070681_111915911 | 68 |
| 288 | 3300005459 | Ga0068867_100486317 | Ga0068867_1004863172 | 68 |
| 289 | 3300005467 | Ga0070706_100001716 | Ga0070706_10000171614 | 68 |
| 290 | 3300005468 | Ga0070707_100017665 | Ga0070707_1000176652 | 68 |
| 291 | 3300005468 | Ga0070707_100215609 | Ga0070707_1002156092 | 68 |
| 292 | 3300005468 | Ga0070707_100247851 | Ga0070707_1002478512 | 68 |
| 293 | 3300005468 | Ga0070707_100631579 | Ga0070707_1006315792 | 68 |
| 294 | 3300005471 | Ga0070698_101053688 | Ga0070698_1010536882 | 68 |
| 295 | 3300005518 | Ga0070699_100028157 | Ga0070699_1000281572 | 68 |
| 296 | 3300005530 | Ga0070679_100313843 | Ga0070679_1003138432 | 68 |
| 297 | 3300005535 | Ga0070684_100282935 | Ga0070684_1002829352 | 68 |
| 298 | 3300005536 | Ga0070697_100000739 | Ga0070697_1000007399 | 68 |
| 299 | 3300005536 | Ga0070697_100890866 | Ga0070697_1008908662 | 68 |
| 300 | 3300005539 | Ga0068853_100053189 | Ga0068853_1000531894 | 68 |
| 301 | 3300005544 | Ga0070686_100289648 | Ga0070686_1002896482 | 68 |
| 302 | 3300005545 | Ga0070695_100066372 | Ga0070695_1000663722 | 68 |
| 303 | 3300005546 | Ga0070696_100078866 | Ga0070696_1000788662 | 68 |
| 304 | 3300005546 | Ga0070696_100081262 | Ga0070696_1000812622 | 68 |
| 305 | 3300005546 | Ga0070696_100449443 | Ga0070696_1004494432 | 68 |
| 306 | 3300005547 | Ga0070693_100526954 | Ga0070693_1005269542 | 68 |
| 307 | 3300005548 | Ga0070665_100104443 | Ga0070665_1001044433 | 68 |
| 308 | 3300005548 | Ga0070665_100242687 | Ga0070665_1002426872 | 68 |
| 309 | 3300005549 | Ga0070704_100297322 | Ga0070704_1002973222 | 68 |
| 310 | 3300005563 | Ga0068855_101087309 | Ga0068855_1010873092 | 68 |
| 311 | 3300005563 | Ga0068855_101862489 | Ga0068855_1018624892 | 68 |
| 312 | 3300005564 | Ga0070664_100275870 | Ga0070664_1002758702 | 68 |
| 313 | 3300005577 | Ga0068857_100045939 | Ga0068857_1000459392 | 68 |
| 314 | 3300005578 | Ga0068854_100003948 | Ga0068854_1000039482 | 68 |
| 315 | 3300005614 | Ga0068856_100021745 | Ga0068856_1000217452 | 68 |
| 316 | 3300005614 | Ga0068856_100167306 | Ga0068856_1001673062 | 68 |
| 317 | 3300005614 | Ga0068856_102090018 | Ga0068856_1020900182 | 68 |
| 318 | 3300005616 | Ga0068852_100025097 | Ga0068852_1000250974 | 68 |
| 319 | 3300005617 | Ga0068859_100344192 | Ga0068859_1003441922 | 68 |
| 320 | 3300005618 | Ga0068864_100091873 | Ga0068864_1000918732 | 68 |
| 321 | 3300005718 | Ga0068866_10020115 | Ga0068866_100201152 | 68 |
| 322 | 3300005834 | Ga0068851_10009851 | Ga0068851_100098513 | 68 |
| 323 | 3300005841 | Ga0068863_100083059 | Ga0068863_1000830592 | 68 |
| 324 | 3300005842 | Ga0068858_100049514 | Ga0068858_1000495142 | 68 |
| 325 | 3300005842 | Ga0068858_100906379 | Ga0068858_1009063792 | 68 |
| 326 | 3300005843 | Ga0068860_100066450 | Ga0068860_1000664503 | 68 |
| 327 | 3300005843 | Ga0068860_100550319 | Ga0068860_1005503192 | 68 |
| 328 | 3300005844 | Ga0068862_100017939 | Ga0068862_1000179393 | 68 |
| 329 | 3300005983 | Ga0081540_1175483 | Ga0081540_11754832 | 68 |
| 330 | 3300006028 | Ga0070717_10230810 | Ga0070717_102308102 | 68 |
| 331 | 3300006028 | Ga0070717_10361054 | Ga0070717_103610541 | 68 |
| 332 | 3300006028 | Ga0070717_11155157 | Ga0070717_111551572 | 68 |
| 333 | 3300006028 | Ga0070717_11386732 | Ga0070717_113867322 | 68 |
| 334 | 3300006163 | Ga0070715_10016622 | Ga0070715_100166222 | 68 |
| 335 | 3300006163 | Ga0070715_10037375 | Ga0070715_100373752 | 68 |
| 336 | 3300006163 | Ga0070715_10273394 | Ga0070715_102733942 | 68 |
| 337 | 3300006173 | Ga0070716_100013831 | Ga0070716_1000138314 | 68 |
| 338 | 3300006173 | Ga0070716_100506011 | Ga0070716_1005060112 | 68 |
| 339 | 3300006173 | Ga0070716_101274812 | Ga0070716_1012748122 | 68 |
| 340 | 3300006173 | Ga0070716_101692417 | Ga0070716_1016924172 | 68 |
| 341 | 3300006175 | Ga0070712_100000167 | Ga0070712_1000001677 | 68 |
| 342 | 3300006175 | Ga0070712_100085882 | Ga0070712_1000858822 | 68 |
| 343 | 3300006175 | Ga0070712_101769337 | Ga0070712_1017693371 | 68 |
| 344 | 3300006237 | Ga0097621_100089383 | Ga0097621_1000893833 | 68 |
| 345 | 3300006237 | Ga0097621_100119234 | Ga0097621_1001192342 | 68 |
| 346 | 3300006358 | Ga0068871_100040917 | Ga0068871_1000409173 | 68 |
| 347 | 3300006358 | Ga0068871_100093460 | Ga0068871_1000934603 | 68 |
| 348 | 3300006871 | Ga0075434_100305908 | Ga0075434_1003059082 | 68 |
| 349 | 3300006871 | Ga0075434_100606101 | Ga0075434_1006061012 | 68 |
| 350 | 3300006881 | Ga0068865_100055100 | Ga0068865_1000551001 | 68 |
| 351 | 3300006914 | Ga0075436_100848187 | Ga0075436_1008481872 | 68 |
| 352 | 3300006931 | Ga0097620_100344187 | Ga0097620_1003441872 | 68 |
| 353 | 3300007265 | Ga0099794_10119078 | Ga0099794_101190782 | 68 |
| 354 | 3300007265 | Ga0099794_10279955 | Ga0099794_102799552 | 68 |
| 355 | 3300007788 | Ga0099795_10270504 | Ga0099795_102705042 | 68 |
| 356 | 3300009093 | Ga0105240_10069435 | Ga0105240_100694353 | 68 |
| 357 | 3300009093 | Ga0105240_10500077 | Ga0105240_105000772 | 68 |
| 358 | 3300009094 | Ga0111539_11571765 | Ga0111539_115717652 | 68 |
| 359 | 3300009098 | Ga0105245_10083509 | Ga0105245_100835092 | 68 |
| 360 | 3300009098 | Ga0105245_10295071 | Ga0105245_102950712 | 68 |
| 361 | 3300009098 | Ga0105245_10670765 | Ga0105245_106707652 | 68 |
| 362 | 3300009101 | Ga0105247_10009972 | Ga0105247_100099725 | 68 |
| 363 | 3300009101 | Ga0105247_10120940 | Ga0105247_101209401 | 68 |
| 364 | 3300009148 | Ga0105243_10218951 | Ga0105243_102189512 | 68 |
| 365 | 3300009174 | Ga0105241_10021957 | Ga0105241_100219573 | 68 |
| 366 | 3300009174 | Ga0105241_10023682 | Ga0105241_100236825 | 68 |
| 367 | 3300009174 | Ga0105241_10274684 | Ga0105241_102746842 | 68 |
| 368 | 3300009174 | Ga0105241_10617455 | Ga0105241_106174552 | 68 |
| 369 | 3300009176 | Ga0105242_10240347 | Ga0105242_102403472 | 68 |
| 370 | 3300009176 | Ga0105242_10790609 | Ga0105242_107906092 | 68 |
| 371 | 3300009176 | Ga0105242_10897658 | Ga0105242_108976582 | 68 |
| 372 | 3300009177 | Ga0105248_10080374 | Ga0105248_100803742 | 68 |
| 373 | 3300009177 | Ga0105248_10719704 | Ga0105248_107197042 | 68 |
| 374 | 3300009177 | Ga0105248_11275876 | Ga0105248_112758762 | 68 |
| 375 | 3300009545 | Ga0105237_11312930 | Ga0105237_113129302 | 68 |
| 376 | 3300009545 | Ga0105237_11563474 | Ga0105237_115634741 | 68 |
| 377 | 3300009551 | Ga0105238_10060895 | Ga0105238_100608952 | 68 |
| 378 | 3300009553 | Ga0105249_10029405 | Ga0105249_100294052 | 68 |
| 379 | 3300009553 | Ga0105249_10448742 | Ga0105249_104487422 | 68 |
| 380 | 3300010375 | Ga0105239_10352112 | Ga0105239_103521122 | 68 |
| 381 | 3300010375 | Ga0105239_11307801 | Ga0105239_113078012 | 68 |
| 382 | 3300011119 | Ga0105246_10163241 | Ga0105246_101632412 | 68 |
| 383 | 3300011119 | Ga0105246_10236062 | Ga0105246_102360622 | 68 |
| 384 | 3300013100 | Ga0157373_10065315 | Ga0157373_100653152 | 68 |
| 385 | 3300013102 | Ga0157371_10632722 | Ga0157371_106327221 | 68 |
| 386 | 3300013104 | Ga0157370_10141679 | Ga0157370_101416793 | 68 |
| 387 | 3300013105 | Ga0157369_10181180 | Ga0157369_101811802 | 68 |
| 388 | 3300013296 | Ga0157374_10048678 | Ga0157374_100486783 | 68 |
| 389 | 3300013296 | Ga0157374_12583250 | Ga0157374_125832502 | 68 |
| 390 | 3300013297 | Ga0157378_10119838 | Ga0157378_101198383 | 68 |
| 391 | 3300013297 | Ga0157378_10162477 | Ga0157378_101624772 | 68 |
| 392 | 3300013297 | Ga0157378_12673382 | Ga0157378_126733822 | 68 |
| 393 | 3300013306 | Ga0163162_10192940 | Ga0163162_101929402 | 68 |
| 394 | 3300013306 | Ga0163162_10314784 | Ga0163162_103147842 | 68 |
| 395 | 3300013306 | Ga0163162_10668305 | Ga0163162_106683052 | 68 |
| 396 | 3300013307 | Ga0157372_10084833 | Ga0157372_100848332 | 68 |
| 397 | 3300013307 | Ga0157372_11413570 | Ga0157372_114135701 | 68 |
| 398 | 3300013308 | Ga0157375_10005603 | Ga0157375_100056034 | 68 |
| 399 | 3300014325 | Ga0163163_10457767 | Ga0163163_104577672 | 68 |
| 400 | 3300014968 | Ga0157379_10001792 | Ga0157379_100017926 | 68 |
| 401 | 3300014968 | Ga0157379_10024448 | Ga0157379_100244482 | 68 |
| 402 | 3300014968 | Ga0157379_10637474 | Ga0157379_106374742 | 68 |
| 403 | 3300014968 | Ga0157379_10845888 | Ga0157379_108458882 | 68 |
| 404 | 3300014969 | Ga0157376_10145599 | Ga0157376_101455992 | 68 |
| 405 | 3300014969 | Ga0157376_10214636 | Ga0157376_102146362 | 68 |
| 406 | 3300022734 | Ga0224571_105232 | Ga0224571_1052322 | 68 |
| 407 | 3300024123 | Ga0228600_1016769 | Ga0228600_10167692 | 68 |
| 408 | 3300024225 | Ga0224572_1005093 | Ga0224572_10050932 | 68 |
| 409 | 3300024227 | Ga0228598_1001152 | Ga0228598_10011523 | 68 |
| 410 | 3300024227 | Ga0228598_1042725 | Ga0228598_10427252 | 68 |
| 411 | 3300025321 | Ga0207656_10036965 | Ga0207656_100369652 | 68 |
| 412 | 3300025893 | Ga0207682_10088650 | Ga0207682_100886502 | 68 |
| 413 | 3300025898 | Ga0207692_11082665 | Ga0207692_110826651 | 68 |
| 414 | 3300025899 | Ga0207642_10143543 | Ga0207642_101435432 | 68 |
| 415 | 3300025900 | Ga0207710_10062888 | Ga0207710_100628882 | 68 |
| 416 | 3300025900 | Ga0207710_10514771 | Ga0207710_105147712 | 68 |
| 417 | 3300025904 | Ga0207647_10219469 | Ga0207647_102194691 | 68 |
| 418 | 3300025905 | Ga0207685_10057218 | Ga0207685_100572182 | 68 |
| 419 | 3300025905 | Ga0207685_10145965 | Ga0207685_101459652 | 68 |
| 420 | 3300025905 | Ga0207685_10630610 | Ga0207685_106306101 | 68 |
| 421 | 3300025906 | Ga0207699_10021811 | Ga0207699_100218113 | 68 |
| 422 | 3300025906 | Ga0207699_10447781 | Ga0207699_104477812 | 68 |
| 423 | 3300025906 | Ga0207699_11148223 | Ga0207699_111482232 | 68 |
| 424 | 3300025907 | Ga0207645_10450626 | Ga0207645_104506262 | 68 |
| 425 | 3300025910 | Ga0207684_10005821 | Ga0207684_100058217 | 68 |
| 426 | 3300025911 | Ga0207654_10015081 | Ga0207654_100150812 | 68 |
| 427 | 3300025911 | Ga0207654_10024478 | Ga0207654_100244782 | 68 |
| 428 | 3300025911 | Ga0207654_10085264 | Ga0207654_100852642 | 68 |
| 429 | 3300025912 | Ga0207707_10027083 | Ga0207707_100270832 | 68 |
| 430 | 3300025913 | Ga0207695_10133952 | Ga0207695_101339522 | 68 |
| 431 | 3300025913 | Ga0207695_10560452 | Ga0207695_105604521 | 68 |
| 432 | 3300025914 | Ga0207671_10098578 | Ga0207671_100985781 | 68 |
| 433 | 3300025914 | Ga0207671_10297041 | Ga0207671_102970412 | 68 |
| 434 | 3300025914 | Ga0207671_10981179 | Ga0207671_109811791 | 68 |
| 435 | 3300025914 | Ga0207671_11454354 | Ga0207671_114543542 | 68 |
| 436 | 3300025915 | Ga0207693_10000467 | Ga0207693_1000046718 | 68 |
| 437 | 3300025915 | Ga0207693_10097262 | Ga0207693_100972622 | 68 |
| 438 | 3300025915 | Ga0207693_10567082 | Ga0207693_105670821 | 68 |
| 439 | 3300025916 | Ga0207663_10005038 | Ga0207663_100050384 | 68 |
| 440 | 3300025916 | Ga0207663_10127199 | Ga0207663_101271992 | 68 |
| 441 | 3300025916 | Ga0207663_10972738 | Ga0207663_109727381 | 68 |
| 442 | 3300025916 | Ga0207663_11120906 | Ga0207663_111209061 | 68 |
| 443 | 3300025916 | Ga0207663_11333107 | Ga0207663_113331071 | 68 |
| 444 | 3300025917 | Ga0207660_10968177 | Ga0207660_109681772 | 68 |
| 445 | 3300025918 | Ga0207662_11346049 | Ga0207662_113460492 | 68 |
| 446 | 3300025919 | Ga0207657_10011252 | Ga0207657_100112525 | 68 |
| 447 | 3300025920 | Ga0207649_10049802 | Ga0207649_100498022 | 68 |
| 448 | 3300025920 | Ga0207649_11203602 | Ga0207649_112036022 | 68 |
| 449 | 3300025921 | Ga0207652_10041858 | Ga0207652_100418583 | 68 |
| 450 | 3300025922 | Ga0207646_10041544 | Ga0207646_100415442 | 68 |
| 451 | 3300025922 | Ga0207646_10044708 | Ga0207646_100447082 | 68 |
| 452 | 3300025922 | Ga0207646_10190236 | Ga0207646_101902362 | 68 |
| 453 | 3300025922 | Ga0207646_11699762 | Ga0207646_116997621 | 68 |
| 454 | 3300025924 | Ga0207694_10164168 | Ga0207694_101641682 | 68 |
| 455 | 3300025926 | Ga0207659_10323961 | Ga0207659_103239613 | 68 |
| 456 | 3300025927 | Ga0207687_10057591 | Ga0207687_100575913 | 68 |
| 457 | 3300025927 | Ga0207687_10127999 | Ga0207687_101279993 | 68 |
| 458 | 3300025928 | Ga0207700_11219047 | Ga0207700_112190472 | 68 |
| 459 | 3300025932 | Ga0207690_10574490 | Ga0207690_105744902 | 68 |
| 460 | 3300025933 | Ga0207706_10000590 | Ga0207706_100005904 | 68 |
| 461 | 3300025934 | Ga0207686_10032810 | Ga0207686_100328102 | 68 |
| 462 | 3300025934 | Ga0207686_11612060 | Ga0207686_116120602 | 68 |
| 463 | 3300025935 | Ga0207709_10358678 | Ga0207709_103586782 | 68 |
| 464 | 3300025937 | Ga0207669_10716928 | Ga0207669_107169281 | 68 |
| 465 | 3300025939 | Ga0207665_10017983 | Ga0207665_100179831 | 68 |
| 466 | 3300025939 | Ga0207665_10182520 | Ga0207665_101825202 | 68 |
| 467 | 3300025939 | Ga0207665_10194240 | Ga0207665_101942402 | 68 |
| 468 | 3300025939 | Ga0207665_10513089 | Ga0207665_105130891 | 68 |
| 469 | 3300025941 | Ga0207711_10007737 | Ga0207711_100077374 | 68 |
| 470 | 3300025942 | Ga0207689_10045944 | Ga0207689_100459443 | 68 |
| 471 | 3300025949 | Ga0207667_10086715 | Ga0207667_100867152 | 68 |
| 472 | 3300025961 | Ga0207712_10282256 | Ga0207712_102822562 | 68 |
| 473 | 3300025972 | Ga0207668_10010105 | Ga0207668_100101052 | 68 |
| 474 | 3300025981 | Ga0207640_10545464 | Ga0207640_105454642 | 68 |
| 475 | 3300025986 | Ga0207658_10025179 | Ga0207658_100251792 | 68 |
| 476 | 3300025986 | Ga0207658_10959131 | Ga0207658_109591312 | 68 |
| 477 | 3300026023 | Ga0207677_10181975 | Ga0207677_101819752 | 68 |
| 478 | 3300026035 | Ga0207703_10097089 | Ga0207703_100970893 | 68 |
| 479 | 3300026035 | Ga0207703_11295541 | Ga0207703_112955412 | 68 |
| 480 | 3300026035 | Ga0207703_11430120 | Ga0207703_114301202 | 68 |
| 481 | 3300026041 | Ga0207639_10151750 | Ga0207639_101517502 | 68 |
| 482 | 3300026067 | Ga0207678_10003766 | Ga0207678_100037662 | 68 |
| 483 | 3300026078 | Ga0207702_10072978 | Ga0207702_100729783 | 68 |
| 484 | 3300026078 | Ga0207702_11300500 | Ga0207702_113005002 | 68 |
| 485 | 3300026078 | Ga0207702_12121245 | Ga0207702_121212452 | 68 |
| 486 | 3300026088 | Ga0207641_10066111 | Ga0207641_100661113 | 68 |
| 487 | 3300026089 | Ga0207648_10002534 | Ga0207648_100025348 | 68 |
| 488 | 3300026121 | Ga0207683_10986382 | Ga0207683_109863822 | 68 |
| 489 | 3300026142 | Ga0207698_10153013 | Ga0207698_101530132 | 68 |
| 490 | 3300027907 | Ga0207428_10832494 | Ga0207428_108324941 | 68 |
| 491 | 3300028017 | Ga0265356_1029839 | Ga0265356_10298392 | 68 |
| 492 | 3300028023 | Ga0265357_1030986 | Ga0265357_10309862 | 68 |
| 493 | 3300028380 | Ga0268265_10146740 | Ga0268265_101467402 | 68 |
| 494 | 3300028381 | Ga0268264_10049672 | Ga0268264_100496723 | 68 |
| 495 | 3300028381 | Ga0268264_10270946 | Ga0268264_102709462 | 68 |
| 496 | 3300028381 | Ga0268264_11008139 | Ga0268264_110081392 | 68 |
| 497 | 3300028800 | Ga0265338_10277862 | Ga0265338_102778622 | 68 |
| 498 | 3300030760 | Ga0265762_1002722 | Ga0265762_10027223 | 68 |
| 499 | 3300030760 | Ga0265762_1011214 | Ga0265762_10112142 | 68 |
| 500 | 3300030878 | Ga0265770_1013185 | Ga0265770_10131852 | 68 |
| 501 | 3300031090 | Ga0265760_10031605 | Ga0265760_100316052 | 68 |
| 502 | 3300031090 | Ga0265760_10290782 | Ga0265760_102907821 | 68 |
| 503 | 3300031247 | Ga0265340_10060646 | Ga0265340_100606462 | 68 |
| 504 | 3300031249 | Ga0265339_10029063 | Ga0265339_100290633 | 68 |
| 505 | 3300031344 | Ga0265316_10000652 | Ga0265316_1000065215 | 68 |
| 506 | 3300031344 | Ga0265316_10885614 | Ga0265316_108856141 | 68 |
| 507 | 3300031711 | Ga0265314_10000572 | Ga0265314_1000057217 | 68 |
| 508 | 3300031711 | Ga0265314_10064871 | Ga0265314_100648712 | 68 |
| 509 | 3300031711 | Ga0265314_10189439 | Ga0265314_101894392 | 68 |
| 510 | 3300033547 | Ga0316212_1001045 | Ga0316212_10010452 | 68 |
| 511 | 3300034816 | Ga0373930_0128441 | Ga0373930_0128441_246_452 | 68 |
| 512 | 3300034818 | Ga0373950_0073282 | Ga0373950_0073282_71_277 | 68 |
| 513 | 3300034820 | Ga0373959_0055771 | Ga0373959_0055771_584_790 | 68 |
| 514 | 3300035083 | Ga0373926_0312920 | Ga0373926_0312920_89_295 | 68 |
| 515 | 3300035084 | Ga0373928_0070590 | Ga0373928_0070590_100_306 | 68 |
| 516 | 3300035084 | Ga0373928_0235671 | Ga0373928_0235671_131_337 | 68 |
| 517 | 3300035088 | Ga0373940_0037665 | Ga0373940_0037665_117_323 | 68 |
| 518 | 3300035111 | Ga0373923_0092781 | Ga0373923_0092781_746_958 | 68 |
| 519 | 3300035112 | Ga0373932_0109575 | Ga0373932_0109575_389_595 | 68 |
| 520 | 3300035121 | Ga0373960_0121108 | Ga0373960_0121108_142_348 | 68 |
| 521 | 3300035207 | Ga0373942_0090497 | Ga0373942_0090497_201_407 | 68 |
| 522 | 3300035241 | Ga0373961_0331115 | Ga0373961_0331115_25_231 | 68 |
| 523 | 3300035691 | Ga0373931_0041032 | Ga0373931_0041032_115_321 | 68 |
| 524 | 3300035691 | Ga0373931_0380722 | Ga0373931_0380722_271_477 | 68 |
| 525 | 3300035692 | Ga0373935_0426497 | Ga0373935_0426497_183_395 | 68 |
| 526 | 3300035695 | Ga0373927_0024041 | Ga0373927_0024041_3647_3859 | 68 |
| 527 | 3300035725 | Ga0373947_1215164 | Ga0373947_1215164_187_393 | 68 |
| 528 | 3300037068 | Ga0373925_0039815 | Ga0373925_0039815_1962_2174 | 68 |
| 529 | 3300037068 | Ga0373925_0061179 | Ga0373925_0061179_1151_1357 | 68 |
| 530 | 3300037068 | Ga0373925_1035447 | Ga0373925_1035447_440_652 | 68 |
| 531 | 3300038996 | Ga0242420_013682 | Ga0242420_013682_72_278 | 68 |
| 532 | 3300039438 | Ga0436360_1114409 | Ga0436360_1114409_94_333 | 68 |
| 533 | 3300042876 | Ga0451577_0339432 | Ga0451577_0339432_20_226 | 68 |
| 534 | 3300044684 | Ga0466966_0735325 | Ga0466966_0735325_142_348 | 68 |
| 535 | 3300044712 | Ga0453684_2316560 | Ga0453684_2316560_159_365 | 68 |
| 536 | 3300045051 | Ga0451576_0041599 | Ga0451576_0041599_2343_2552 | 68 |
| 537 | 3300045051 | Ga0451576_0651143 | Ga0451576_0651143_64_270 | 68 |
| 538 | 3300046472 | Ga0495580_0002088 | Ga0495580_0002088_1947_2159 | 68 |
| 539 | 3300046472 | Ga0495580_0008640 | Ga0495580_0008640_3489_3716 | 68 |
| 540 | 3300046473 | Ga0495582_0068893 | Ga0495582_0068893_286_498 | 68 |
| 541 | 3300046517 | Ga0495630_0391055 | Ga0495630_0391055_779_991 | 68 |
| 542 | 3300046531 | Ga0495665_0101208 | Ga0495665_0101208_46_258 | 68 |
| 543 | 3300046533 | Ga0495640_0801331 | Ga0495640_0801331_107_313 | 68 |
| 544 | 3300046684 | Ga0495669_0191089 | Ga0495669_0191089_729_938 | 68 |
| 545 | 3300047315 | Ga0495581_0275983 | Ga0495581_0275983_708_920 | 68 |
| 546 | 3300048903 | Ga0496100_0073349 | Ga0496100_0073349_358_564 | 68 |
| 547 | 3300048903 | Ga0496100_1018880 | Ga0496100_1018880_384_590 | 68 |
| 548 | 3300048904 | Ga0496101_0024453 | Ga0496101_0024453_3883_4089 | 68 |
| 549 | 3300048904 | Ga0496101_0198438 | Ga0496101_0198438_46_252 | 68 |
| 550 | 3300048904 | Ga0496101_0998519 | Ga0496101_0998519_375_581 | 68 |
| 551 | 3300048905 | Ga0496102_0000882 | Ga0496102_0000882_15573_15779 | 68 |
| 552 | 3300048905 | Ga0496102_0278918 | Ga0496102_0278918_1239_1445 | 68 |
| 553 | 3300048905 | Ga0496102_0310551 | Ga0496102_0310551_1190_1396 | 68 |
| 554 | 3300048905 | Ga0496102_0668266 | Ga0496102_0668266_122_328 | 68 |
| 555 | 3300048906 | Ga0496103_0010332 | Ga0496103_0010332_65_271 | 68 |
| 556 | 3300048906 | Ga0496103_0019618 | Ga0496103_0019618_1215_1421 | 68 |
| 557 | 3300048907 | Ga0496104_0164806 | Ga0496104_0164806_788_994 | 68 |
| 558 | 3300048908 | Ga0496105_0057191 | Ga0496105_0057191_1250_1456 | 68 |
| 559 | 3300048908 | Ga0496105_0468280 | Ga0496105_0468280_674_880 | 68 |
| 560 | 3300048909 | Ga0496106_0010794 | Ga0496106_0010794_462_668 | 68 |
| 561 | 3300048909 | Ga0496106_0181497 | Ga0496106_0181497_252_458 | 68 |
| 562 | 3300048910 | Ga0496107_0004478 | Ga0496107_0004478_6558_6764 | 68 |
| 563 | 3300048910 | Ga0496107_0034006 | Ga0496107_0034006_1956_2162 | 68 |
| 564 | 3300048910 | Ga0496107_0623884 | Ga0496107_0623884_335_541 | 68 |
| 565 | 3300048911 | Ga0496108_0281737 | Ga0496108_0281737_55_261 | 68 |
| 566 | 3300048914 | Ga0496111_0300461 | Ga0496111_0300461_84_290 | 68 |
| 567 | 3300048915 | Ga0496112_0367361 | Ga0496112_0367361_563_769 | 68 |
| 568 | 3300048916 | Ga0496113_0628439 | Ga0496113_0628439_65_271 | 68 |
| 569 | 3300048917 | Ga0496114_0159719 | Ga0496114_0159719_22_228 | 68 |
| 570 | 3300048918 | Ga0496115_0302514 | Ga0496115_0302514_475_681 | 68 |
| 571 | 3300048918 | Ga0496115_0851176 | Ga0496115_0851176_289_519 | 68 |
| 572 | 3300048929 | Ga0496126_0328818 | Ga0496126_0328818_661_891 | 68 |
| 573 | 3300050511 | nmdc:mga08y16_1128749_c1 | nmdc:mga08y16_1128749_c1_337_546 | 68 |
| 574 | 3300050512 | nmdc:mga0n895_213062_c1 | nmdc:mga0n895_213062_c1_1446_1652 | 68 |
| 575 | 3300050513 | nmdc:mga0rr50_1272758_c1 | nmdc:mga0rr50_1272758_c1_292_498 | 68 |
| 576 | 3300050513 | nmdc:mga0rr50_298416_c1 | nmdc:mga0rr50_298416_c1_237_443 | 68 |
| 577 | 3300050514 | nmdc:mga08x19_105104_c1 | nmdc:mga08x19_105104_c1_844_1050 | 68 |
| 578 | 3300053085 | Ga0495619_0043233 | Ga0495619_0043233_2664_2870 | 68 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p3r-assembly1.cif.gz_D | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8819 | 5 | 62 |
| 6grj-assembly1.cif.gz_I | structure of the ahlb pore of the tripartite alpha-pore forming toxin, ahl, from aeromonas hydrophila. | 0.8216 | 2 | 67 |
| 6h2f-assembly1.cif.gz_D | structure of the pre-pore ahlb of the tripartite alpha-pore forming toxin, ahl, from aeromonas hydrophila. | 0.8126 | 6 | 67 |
| 7a0g-assembly1.cif.gz_III | structure of the smhb pore of the tripartite alpha-pore forming toxin, smh, from serratia marcescens. | 0.8042 | 2 | 67 |
| 8esv-assembly1.cif.gz_B | structure of human adam10-tspan15 complex bound to 11g2 vfab | 0.7986 | 5 | 67 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P27701_1_107_1.20.5.780 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin | 0.8939 | 5 | 67 | 1.20.5.780 |
| af_O70352_1_107_1.20.5.780 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin | 0.8858 | 5 | 67 | 1.20.5.780 |
| af_P40237_1_107_1.20.5.110 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.8808 | 5 | 67 | 1.20.5.110 |
| af_P11049_12_272_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.8725 | 5 | 61 | 1.20.1070.10 |
| af_O60635_1_114_1.20.5.780 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin | 0.8636 | 3 | 67 | 1.20.5.780 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2J6WF35-F1-model_v4 | DUF5671 domain-containing protein | 0.9432 | 6 | 62 |
GO:0016020
|
| AF-A0A2M8Q0J6-F1-model_v4 | NERD domain-containing protein | 0.9286 | 5 | 61 |
GO:0016020
|
| AF-A0A2T1A392-F1-model_v4 | Uncharacterized protein | 0.9071 | 5 | 61 |
GO:0016020
|
| AF-A0A3N5W4J4-F1-model_v4 | DUF2207 domain-containing protein | 0.9054 | 5 | 63 |
GO:0016020
|
| AF-A0A1I7RLE2-F1-model_v4 | (pine wood nematode) hypothetical protein | 0.9015 | 5 | 61 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar