F465646
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 577 | 242 | 1154 | 98 |
Family's Representative Sequence
| Representative Sequence | 3300046455|Ga0495603_0677573|Ga0495603_0677573_154_486 |
| Length | 110 |
| Sequence | MALLLHAYDPTMPAYVIVETDVHDPEQYERYKTASPDAVHAGGGRFIVRGGEIAVLEGDWDPSRLVVLEFPDLDAAKRFYDSPEYEGAKRLREGAANLRMVAVQGLDEPV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 41 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 42 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 62 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 65 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 73 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 116 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 117 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 119 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 121 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 122 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 123 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 124 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 125 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 126 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 127 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 128 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 129 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 130 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 131 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 132 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 133 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 134 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 135 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 136 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 137 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 143 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 144 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 145 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 146 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 147 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 148 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 149 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 150 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 151 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 152 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 153 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 154 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 155 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 156 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 157 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 158 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 159 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 160 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 161 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 162 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 163 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 164 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 216 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 217 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 218 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 219 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 220 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 223 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 224 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 225 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 226 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 240 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 241 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 242 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.61 |
| Metatranscriptomes | 1.39 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.35 |
| Nodule | 0 |
| Rhizoplane | 7.8 |
| Rhizosphere | 90.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495603_0677573 | 3300046455 | Bacteria | 590 |
| 2 | Ga0070658_10383237 | 3300005327 | Bacteria | 1206 |
| 3 | Ga0070683_100001257 | 3300005329 | Bacteria | 19285 |
| 4 | Ga0070683_100196505 | 3300005329 | Bacteria | 1915 |
| 5 | Ga0070683_100346567 | 3300005329 | Bacteria | 1415 |
| 6 | Ga0070690_100561677 | 3300005330 | Unclassified | 862 |
| 7 | Ga0070680_100047923 | 3300005336 | Bacteria | 3481 |
| 8 | Ga0070680_100116332 | 3300005336 | Bacteria | 2229 |
| 9 | Ga0070680_100314010 | 3300005336 | Bacteria | 1330 |
| 10 | Ga0070680_100741507 | 3300005336 | Bacteria | 846 |
| 11 | Ga0070682_100180929 | 3300005337 | Bacteria | 1473 |
| 12 | Ga0070682_100187849 | 3300005337 | Bacteria | 1449 |
| 13 | Ga0068868_100868433 | 3300005338 | Bacteria | 818 |
| 14 | Ga0070660_100775342 | 3300005339 | Bacteria | 806 |
| 15 | Ga0070660_101748045 | 3300005339 | Bacteria | 530 |
| 16 | Ga0070689_101314184 | 3300005340 | Bacteria | 651 |
| 17 | Ga0070691_10054620 | 3300005341 | Bacteria | 1912 |
| 18 | Ga0070661_100524206 | 3300005344 | Bacteria | 951 |
| 19 | Ga0070671_100392233 | 3300005355 | Bacteria | 1187 |
| 20 | Ga0070659_100814807 | 3300005366 | Bacteria | 812 |
| 21 | Ga0070659_101814140 | 3300005366 | Bacteria | 546 |
| 22 | Ga0070714_100037754 | 3300005435 | Bacteria | 4060 |
| 23 | Ga0070714_100172277 | 3300005435 | Bacteria | 1965 |
| 24 | Ga0070714_100199984 | 3300005435 | Bacteria | 1827 |
| 25 | Ga0070714_100679317 | 3300005435 | Bacteria | 993 |
| 26 | Ga0070714_101150411 | 3300005435 | Unclassified | 757 |
| 27 | Ga0070713_100695490 | 3300005436 | Bacteria | 970 |
| 28 | Ga0070713_101299854 | 3300005436 | Bacteria | 705 |
| 29 | Ga0070713_101745052 | 3300005436 | Bacteria | 604 |
| 30 | Ga0070710_10004667 | 3300005437 | Bacteria | 6480 |
| 31 | Ga0070711_100002087 | 3300005439 | Bacteria | 11293 |
| 32 | Ga0070711_100987126 | 3300005439 | Bacteria | 722 |
| 33 | Ga0070663_101680526 | 3300005455 | Bacteria | 567 |
| 34 | Ga0070662_100304264 | 3300005457 | Bacteria | 1296 |
| 35 | Ga0070681_10017683 | 3300005458 | Bacteria | 7126 |
| 36 | Ga0070681_10026566 | 3300005458 | Bacteria | 5819 |
| 37 | Ga0070681_10100450 | 3300005458 | Bacteria | 2839 |
| 38 | Ga0070681_10678272 | 3300005458 | Bacteria | 946 |
| 39 | Ga0068867_100905122 | 3300005459 | Bacteria | 794 |
| 40 | Ga0070706_100507712 | 3300005467 | Unclassified | 1121 |
| 41 | Ga0070707_100580103 | 3300005468 | Bacteria | 1084 |
| 42 | Ga0070679_100040375 | 3300005530 | Bacteria | 4643 |
| 43 | Ga0070679_100151473 | 3300005530 | Bacteria | 2295 |
| 44 | Ga0070679_100186050 | 3300005530 | Bacteria | 2047 |
| 45 | Ga0070684_100036453 | 3300005535 | Bacteria | 4214 |
| 46 | Ga0070684_100071746 | 3300005535 | Bacteria | 3047 |
| 47 | Ga0070684_100074215 | 3300005535 | Bacteria | 2998 |
| 48 | Ga0070684_100396854 | 3300005535 | Bacteria | 1271 |
| 49 | Ga0070684_100663997 | 3300005535 | Bacteria | 971 |
| 50 | Ga0070672_101635192 | 3300005543 | Bacteria | 578 |
| 51 | Ga0070695_100807791 | 3300005545 | Bacteria | 752 |
| 52 | Ga0070696_100380608 | 3300005546 | Bacteria | 1100 |
| 53 | Ga0070693_100184997 | 3300005547 | Bacteria | 1344 |
| 54 | Ga0070664_100081852 | 3300005564 | Bacteria | 2783 |
| 55 | Ga0070664_100093886 | 3300005564 | Bacteria | 2601 |
| 56 | Ga0068857_100173306 | 3300005577 | Bacteria | 1962 |
| 57 | Ga0068857_100201399 | 3300005577 | Bacteria | 1815 |
| 58 | Ga0068852_100285193 | 3300005616 | Bacteria | 1593 |
| 59 | Ga0068859_101626247 | 3300005617 | Bacteria | 713 |
| 60 | Ga0068861_100370779 | 3300005719 | Bacteria | 1262 |
| 61 | Ga0068858_100157799 | 3300005842 | Bacteria | 2135 |
| 62 | Ga0081538_10016993 | 3300005981 | Bacteria | 5545 |
| 63 | Ga0070717_10036084 | 3300006028 | Bacteria | 4007 |
| 64 | Ga0070717_10364088 | 3300006028 | Unclassified | 1295 |
| 65 | Ga0070717_10543519 | 3300006028 | Bacteria | 1052 |
| 66 | Ga0075432_10159534 | 3300006058 | Bacteria | 871 |
| 67 | Ga0070712_101841672 | 3300006175 | Unclassified | 530 |
| 68 | Ga0075433_10266084 | 3300006852 | Bacteria | 1520 |
| 69 | Ga0075434_100001312 | 3300006871 | Bacteria | 20750 |
| 70 | Ga0075434_100018897 | 3300006871 | Bacteria | 6661 |
| 71 | Ga0075436_100295097 | 3300006914 | Bacteria | 1161 |
| 72 | Ga0097620_101626673 | 3300006931 | Bacteria | 713 |
| 73 | Ga0075435_100133816 | 3300007076 | Bacteria | 2076 |
| 74 | Ga0111539_10013416 | 3300009094 | Bacteria | 10243 |
| 75 | Ga0111539_10835639 | 3300009094 | Bacteria | 1071 |
| 76 | Ga0105245_10348043 | 3300009098 | Bacteria | 1467 |
| 77 | Ga0105245_10712134 | 3300009098 | Bacteria | 1038 |
| 78 | Ga0105245_10937455 | 3300009098 | Bacteria | 908 |
| 79 | Ga0105245_10953773 | 3300009098 | Bacteria | 901 |
| 80 | Ga0105243_10030136 | 3300009148 | Bacteria | 4175 |
| 81 | Ga0105243_10575425 | 3300009148 | Bacteria | 1080 |
| 82 | Ga0105241_10877352 | 3300009174 | Bacteria | 831 |
| 83 | Ga0105241_11044160 | 3300009174 | Bacteria | 767 |
| 84 | Ga0105248_12583784 | 3300009177 | Bacteria | 579 |
| 85 | Ga0105238_11522958 | 3300009551 | Bacteria | 698 |
| 86 | Ga0105239_10630083 | 3300010375 | Bacteria | 1224 |
| 87 | Ga0105239_11118865 | 3300010375 | Bacteria | 907 |
| 88 | Ga0105246_10089004 | 3300011119 | Bacteria | 2220 |
| 89 | Ga0157373_10425352 | 3300013100 | Bacteria | 954 |
| 90 | Ga0157371_10930067 | 3300013102 | Unclassified | 660 |
| 91 | Ga0157369_10263573 | 3300013105 | Bacteria | 1797 |
| 92 | Ga0157369_10380653 | 3300013105 | Bacteria | 1465 |
| 93 | Ga0157369_10479435 | 3300013105 | Bacteria | 1287 |
| 94 | Ga0157374_10626377 | 3300013296 | Bacteria | 1087 |
| 95 | Ga0157374_11284399 | 3300013296 | Bacteria | 754 |
| 96 | Ga0163162_10248097 | 3300013306 | Bacteria | 1912 |
| 97 | Ga0163162_10467970 | 3300013306 | Bacteria | 1392 |
| 98 | Ga0157372_10280223 | 3300013307 | Bacteria | 1938 |
| 99 | Ga0157372_10357775 | 3300013307 | Bacteria | 1701 |
| 100 | Ga0157372_11697258 | 3300013307 | Bacteria | 727 |
| 101 | Ga0157372_12562486 | 3300013307 | Bacteria | 585 |
| 102 | Ga0163163_10397878 | 3300014325 | Bacteria | 1435 |
| 103 | Ga0163163_11531279 | 3300014325 | Bacteria | 728 |
| 104 | Ga0157380_11625690 | 3300014326 | Bacteria | 702 |
| 105 | Ga0182008_10002774 | 3300014497 | Bacteria | 10856 |
| 106 | Ga0182008_10566341 | 3300014497 | Bacteria | 633 |
| 107 | Ga0157377_10046956 | 3300014745 | Bacteria | 2417 |
| 108 | Ga0157376_10508560 | 3300014969 | Bacteria | 1185 |
| 109 | Ga0157376_11075117 | 3300014969 | Bacteria | 829 |
| 110 | Ga0182006_1013543 | 3300015261 | Bacteria | 3537 |
| 111 | Ga0182006_1182150 | 3300015261 | Bacteria | 700 |
| 112 | Ga0182007_10021417 | 3300015262 | Bacteria | 2297 |
| 113 | Ga0182005_1051467 | 3300015265 | Bacteria | 1120 |
| 114 | Ga0182005_1072805 | 3300015265 | Bacteria | 944 |
| 115 | Ga0163161_10627692 | 3300017792 | Unclassified | 888 |
| 116 | Ga0197907_10896267 | 3300020069 | Bacteria | 1407 |
| 117 | Ga0206356_10729212 | 3300020070 | Bacteria | 707 |
| 118 | Ga0206356_10730043 | 3300020070 | Bacteria | 526 |
| 119 | Ga0206356_10924113 | 3300020070 | Bacteria | 1672 |
| 120 | Ga0206354_10604998 | 3300020081 | Bacteria | 897 |
| 121 | Ga0206353_10428564 | 3300020082 | Bacteria | 7083 |
| 122 | Ga0206353_10963801 | 3300020082 | Unclassified | 934 |
| 123 | Ga0206353_11396111 | 3300020082 | Bacteria | 1588 |
| 124 | Ga0213876_10010722 | 3300021384 | Bacteria | 4911 |
| 125 | Ga0207682_10402743 | 3300025893 | Unclassified | 647 |
| 126 | Ga0207645_10057286 | 3300025907 | Bacteria | 2488 |
| 127 | Ga0207705_10025354 | 3300025909 | Bacteria | 4234 |
| 128 | Ga0207705_10478916 | 3300025909 | Bacteria | 966 |
| 129 | Ga0207684_10811775 | 3300025910 | Bacteria | 790 |
| 130 | Ga0207707_10017227 | 3300025912 | Bacteria | 6297 |
| 131 | Ga0207707_10148239 | 3300025912 | Bacteria | 2051 |
| 132 | Ga0207707_10176501 | 3300025912 | Bacteria | 1866 |
| 133 | Ga0207695_10061423 | 3300025913 | Bacteria | 3884 |
| 134 | Ga0207693_10000222 | 3300025915 | Bacteria | 51803 |
| 135 | Ga0207663_11658285 | 3300025916 | Bacteria | 514 |
| 136 | Ga0207660_10092317 | 3300025917 | Bacteria | 2247 |
| 137 | Ga0207660_10566677 | 3300025917 | Bacteria | 924 |
| 138 | Ga0207660_10990608 | 3300025917 | Bacteria | 686 |
| 139 | Ga0207657_10073875 | 3300025919 | Bacteria | 2880 |
| 140 | Ga0207657_10097233 | 3300025919 | Bacteria | 2448 |
| 141 | Ga0207657_11005984 | 3300025919 | Bacteria | 639 |
| 142 | Ga0207649_10370396 | 3300025920 | Bacteria | 1065 |
| 143 | Ga0207652_10035702 | 3300025921 | Bacteria | 4198 |
| 144 | Ga0207652_10179775 | 3300025921 | Bacteria | 1901 |
| 145 | Ga0207646_10392332 | 3300025922 | Bacteria | 1254 |
| 146 | Ga0207646_10435014 | 3300025922 | Bacteria | 1184 |
| 147 | Ga0207694_10143488 | 3300025924 | Bacteria | 1921 |
| 148 | Ga0207650_10554465 | 3300025925 | Bacteria | 964 |
| 149 | Ga0207659_10108553 | 3300025926 | Bacteria | 2105 |
| 150 | Ga0207659_10970013 | 3300025926 | Unclassified | 731 |
| 151 | Ga0207659_11051735 | 3300025926 | Bacteria | 700 |
| 152 | Ga0207687_10282337 | 3300025927 | Bacteria | 1331 |
| 153 | Ga0207687_10783869 | 3300025927 | Bacteria | 812 |
| 154 | Ga0207687_11054031 | 3300025927 | Bacteria | 698 |
| 155 | Ga0207664_10024691 | 3300025929 | Bacteria | 4519 |
| 156 | Ga0207664_10046571 | 3300025929 | Bacteria | 3404 |
| 157 | Ga0207664_10140776 | 3300025929 | Bacteria | 2040 |
| 158 | Ga0207664_10372013 | 3300025929 | Bacteria | 1267 |
| 159 | Ga0207664_10513931 | 3300025929 | Unclassified | 1073 |
| 160 | Ga0207690_10113646 | 3300025932 | Bacteria | 1954 |
| 161 | Ga0207690_10574988 | 3300025932 | Bacteria | 918 |
| 162 | Ga0207690_11417693 | 3300025932 | Bacteria | 581 |
| 163 | Ga0207706_10258699 | 3300025933 | Bacteria | 1520 |
| 164 | Ga0207706_10575448 | 3300025933 | Bacteria | 968 |
| 165 | Ga0207709_10400550 | 3300025935 | Bacteria | 1049 |
| 166 | Ga0207709_10622470 | 3300025935 | Bacteria | 857 |
| 167 | Ga0207670_10353393 | 3300025936 | Bacteria | 1164 |
| 168 | Ga0207665_10931905 | 3300025939 | Bacteria | 690 |
| 169 | Ga0207691_10440058 | 3300025940 | Bacteria | 1110 |
| 170 | Ga0207711_10442597 | 3300025941 | Bacteria | 1209 |
| 171 | Ga0207689_10031506 | 3300025942 | Bacteria | 4413 |
| 172 | Ga0207661_10026391 | 3300025944 | Bacteria | 4426 |
| 173 | Ga0207661_10300745 | 3300025944 | Bacteria | 1438 |
| 174 | Ga0207661_10362968 | 3300025944 | Bacteria | 1308 |
| 175 | Ga0207661_10932196 | 3300025944 | Bacteria | 800 |
| 176 | Ga0207679_10029622 | 3300025945 | Bacteria | 3813 |
| 177 | Ga0207679_10057264 | 3300025945 | Bacteria | 2882 |
| 178 | Ga0207679_10127561 | 3300025945 | Unclassified | 2036 |
| 179 | Ga0207679_10165421 | 3300025945 | Bacteria | 1815 |
| 180 | Ga0207667_10353113 | 3300025949 | Bacteria | 1499 |
| 181 | Ga0207667_10770900 | 3300025949 | Bacteria | 960 |
| 182 | Ga0207640_10107311 | 3300025981 | Bacteria | 1971 |
| 183 | Ga0207677_10136684 | 3300026023 | Bacteria | 1870 |
| 184 | Ga0207677_10315430 | 3300026023 | Bacteria | 1297 |
| 185 | Ga0207678_11187185 | 3300026067 | Bacteria | 676 |
| 186 | Ga0207708_10065216 | 3300026075 | Bacteria | 2783 |
| 187 | Ga0207702_10046515 | 3300026078 | Bacteria | 3653 |
| 188 | Ga0207702_10066214 | 3300026078 | Bacteria | 3096 |
| 189 | Ga0207702_10943006 | 3300026078 | Bacteria | 856 |
| 190 | Ga0207702_11592474 | 3300026078 | Bacteria | 646 |
| 191 | Ga0207641_10256297 | 3300026088 | Bacteria | 1636 |
| 192 | Ga0207648_10248134 | 3300026089 | Bacteria | 1587 |
| 193 | Ga0207676_11630017 | 3300026095 | Unclassified | 643 |
| 194 | Ga0207674_10048281 | 3300026116 | Bacteria | 4357 |
| 195 | Ga0207674_10085312 | 3300026116 | Bacteria | 3153 |
| 196 | Ga0207674_10158505 | 3300026116 | Bacteria | 2218 |
| 197 | Ga0207675_100126210 | 3300026118 | Bacteria | 2423 |
| 198 | Ga0207675_100697661 | 3300026118 | Bacteria | 1024 |
| 199 | Ga0207675_101792118 | 3300026118 | Unclassified | 633 |
| 200 | Ga0207698_10251316 | 3300026142 | Bacteria | 1618 |
| 201 | Ga0207698_11518703 | 3300026142 | Bacteria | 685 |
| 202 | Ga0268266_10021387 | 3300028379 | Bacteria | 5511 |
| 203 | Ga0268264_10643619 | 3300028381 | Bacteria | 1049 |
| 204 | Ga0268264_12125305 | 3300028381 | Unclassified | 570 |
| 205 | Ga0265326_10052772 | 3300028558 | Bacteria | 1151 |
| 206 | Ga0265318_10172415 | 3300028577 | Bacteria | 792 |
| 207 | Ga0265338_10184144 | 3300028800 | Bacteria | 1589 |
| 208 | Ga0265338_10467511 | 3300028800 | Bacteria | 891 |
| 209 | Ga0265340_10498253 | 3300031247 | Bacteria | 536 |
| 210 | Ga0265339_10502061 | 3300031249 | Bacteria | 560 |
| 211 | Ga0265316_10232554 | 3300031344 | Bacteria | 1357 |
| 212 | Ga0307413_10079700 | 3300031824 | Bacteria | 2094 |
| 213 | Ga0307407_10012276 | 3300031903 | Bacteria | 4112 |
| 214 | Ga0307409_101688872 | 3300031995 | Bacteria | 662 |
| 215 | Ga0307414_10023649 | 3300032004 | Bacteria | 3902 |
| 216 | Ga0373926_0081606 | 3300035083 | Bacteria | 1196 |
| 217 | Ga0373944_0044646 | 3300035089 | Bacteria | 1381 |
| 218 | Ga0373936_0039380 | 3300035113 | Bacteria | 1891 |
| 219 | Ga0373945_0056727 | 3300035116 | Bacteria | 1453 |
| 220 | Ga0373943_0000925 | 3300035170 | Bacteria | 12925 |
| 221 | Ga0373943_0396526 | 3300035170 | Unclassified | 796 |
| 222 | Ga0373946_0013416 | 3300035171 | Bacteria | 3081 |
| 223 | Ga0373955_0236219 | 3300035172 | Bacteria | 1094 |
| 224 | Ga0373955_0553973 | 3300035172 | Bacteria | 703 |
| 225 | Ga0316574_0219410 | 3300035398 | Bacteria | 1219 |
| 226 | Ga0373924_0467323 | 3300035410 | Bacteria | 566 |
| 227 | Ga0373935_0014242 | 3300035692 | Bacteria | 4800 |
| 228 | Ga0373933_0502414 | 3300035724 | Bacteria | 794 |
| 229 | Ga0373947_0002909 | 3300035725 | Bacteria | 10218 |
| 230 | Ga0373947_0375735 | 3300035725 | Bacteria | 956 |
| 231 | Ga0373937_0003744 | 3300036401 | Bacteria | 12853 |
| 232 | Ga0373937_0370847 | 3300036401 | Bacteria | 1357 |
| 233 | Ga0373937_1463601 | 3300036401 | Bacteria | 631 |
| 234 | Ga0373925_0002949 | 3300037068 | Bacteria | 13431 |
| 235 | Ga0373925_0832648 | 3300037068 | Bacteria | 761 |
| 236 | Ga0373925_0984362 | 3300037068 | Bacteria | 695 |
| 237 | Ga0395900_1211748 | 3300037418 | Bacteria | 670 |
| 238 | Ga0395898_0136704 | 3300037466 | Bacteria | 2347 |
| 239 | Ga0395898_0399933 | 3300037466 | Bacteria | 1310 |
| 240 | Ga0395898_0612442 | 3300037466 | Bacteria | 1032 |
| 241 | Ga0395901_0078816 | 3300038443 | Bacteria | 3440 |
| 242 | Ga0395901_0198672 | 3300038443 | Bacteria | 2102 |
| 243 | Ga0400483_042911 | 3300039062 | Bacteria | 3398 |
| 244 | Ga0400483_044649 | 3300039062 | Bacteria | 3252 |
| 245 | Ga0400483_235963 | 3300039062 | Bacteria | 2810 |
| 246 | Ga0436365_1146591 | 3300039437 | Bacteria | 10092 |
| 247 | Ga0436360_1254102 | 3300039438 | Bacteria | 837 |
| 248 | Ga0436362_0347855 | 3300039453 | Bacteria | 1977 |
| 249 | Ga0439439_0051584 | 3300041406 | Bacteria | 1079 |
| 250 | Ga0439448_0097078 | 3300042005 | Bacteria | 999 |
| 251 | Ga0439446_0070230 | 3300042156 | Bacteria | 1070 |
| 252 | Ga0439458_0058143 | 3300042157 | Bacteria | 962 |
| 253 | Ga0466969_0014427 | 3300044656 | Bacteria | 4155 |
| 254 | Ga0466969_0242767 | 3300044656 | Bacteria | 817 |
| 255 | Ga0466965_0078602 | 3300044683 | Bacteria | 1666 |
| 256 | Ga0466965_0242133 | 3300044683 | Bacteria | 966 |
| 257 | Ga0466966_0031430 | 3300044684 | Unclassified | 3443 |
| 258 | Ga0466966_0041402 | 3300044684 | Bacteria | 2960 |
| 259 | Ga0466966_0081433 | 3300044684 | Bacteria | 2016 |
| 260 | Ga0466966_0089709 | 3300044684 | Bacteria | 1909 |
| 261 | Ga0466966_0297870 | 3300044684 | Bacteria | 969 |
| 262 | Ga0466966_0338502 | 3300044684 | Bacteria | 904 |
| 263 | Ga0466961_0008653 | 3300044693 | Bacteria | 6487 |
| 264 | Ga0466961_0187362 | 3300044693 | Bacteria | 1283 |
| 265 | Ga0466961_0271858 | 3300044693 | Unclassified | 1038 |
| 266 | Ga0466961_0365464 | 3300044693 | Bacteria | 877 |
| 267 | Ga0466963_0001734 | 3300044694 | Bacteria | 11873 |
| 268 | Ga0466963_0002859 | 3300044694 | Bacteria | 9746 |
| 269 | Ga0466963_0003784 | 3300044694 | Bacteria | 8722 |
| 270 | Ga0466963_0006884 | 3300044694 | Bacteria | 6762 |
| 271 | Ga0466963_0009337 | 3300044694 | Bacteria | 5904 |
| 272 | Ga0466963_0009681 | 3300044694 | Bacteria | 5811 |
| 273 | Ga0466963_0016797 | 3300044694 | Bacteria | 4555 |
| 274 | Ga0466963_0018403 | 3300044694 | Bacteria | 4367 |
| 275 | Ga0466963_0060754 | 3300044694 | Bacteria | 2524 |
| 276 | Ga0466963_0079583 | 3300044694 | Bacteria | 2217 |
| 277 | Ga0466963_0102560 | 3300044694 | Bacteria | 1959 |
| 278 | Ga0466963_0219240 | 3300044694 | Bacteria | 1332 |
| 279 | Ga0466963_0348652 | 3300044694 | Bacteria | 1043 |
| 280 | Ga0466963_0418928 | 3300044694 | Bacteria | 944 |
| 281 | Ga0466963_0451203 | 3300044694 | Unclassified | 907 |
| 282 | Ga0466963_1189046 | 3300044694 | Bacteria | 536 |
| 283 | Ga0466964_0013423 | 3300044706 | Bacteria | 3108 |
| 284 | Ga0466964_0013533 | 3300044706 | Unclassified | 3096 |
| 285 | Ga0466964_0022864 | 3300044706 | Bacteria | 2428 |
| 286 | Ga0466964_0023083 | 3300044706 | Bacteria | 2417 |
| 287 | Ga0466964_0024426 | 3300044706 | Bacteria | 2355 |
| 288 | Ga0466964_0256438 | 3300044706 | Bacteria | 865 |
| 289 | Ga0466964_0455954 | 3300044706 | Bacteria | 679 |
| 290 | Ga0466971_0008317 | 3300044719 | Bacteria | 4527 |
| 291 | Ga0466971_0038490 | 3300044719 | Bacteria | 2146 |
| 292 | Ga0466971_0042925 | 3300044719 | Bacteria | 2032 |
| 293 | Ga0466971_0067301 | 3300044719 | Bacteria | 1623 |
| 294 | Ga0466971_0089796 | 3300044719 | Unclassified | 1406 |
| 295 | Ga0466968_0009193 | 3300044735 | Bacteria | 3801 |
| 296 | Ga0466968_0048223 | 3300044735 | Bacteria | 1812 |
| 297 | Ga0466968_0063899 | 3300044735 | Bacteria | 1591 |
| 298 | Ga0466968_0144523 | 3300044735 | Bacteria | 1090 |
| 299 | Ga0466968_0189866 | 3300044735 | Bacteria | 958 |
| 300 | Ga0466968_0223090 | 3300044735 | Unclassified | 888 |
| 301 | Ga0466968_0417796 | 3300044735 | Unclassified | 659 |
| 302 | Ga0466968_0444909 | 3300044735 | Bacteria | 640 |
| 303 | Ga0466968_0736668 | 3300044735 | Bacteria | 505 |
| 304 | Ga0466970_0076633 | 3300044765 | Bacteria | 1802 |
| 305 | Ga0466970_0112100 | 3300044765 | Bacteria | 1490 |
| 306 | Ga0466957_0005089 | 3300044842 | Bacteria | 7355 |
| 307 | Ga0466957_0010143 | 3300044842 | Bacteria | 5391 |
| 308 | Ga0466957_0010441 | 3300044842 | Bacteria | 5332 |
| 309 | Ga0466957_0016238 | 3300044842 | Bacteria | 4354 |
| 310 | Ga0466957_0021347 | 3300044842 | Bacteria | 3815 |
| 311 | Ga0466957_0069170 | 3300044842 | Bacteria | 2181 |
| 312 | Ga0466957_0121436 | 3300044842 | Bacteria | 1666 |
| 313 | Ga0466957_0194728 | 3300044842 | Bacteria | 1329 |
| 314 | Ga0466957_0219045 | 3300044842 | Bacteria | 1256 |
| 315 | Ga0466957_0226342 | 3300044842 | Unclassified | 1236 |
| 316 | Ga0466960_0038468 | 3300044901 | Bacteria | 2250 |
| 317 | Ga0466960_0191269 | 3300044901 | Bacteria | 1114 |
| 318 | Ga0466960_0608138 | 3300044901 | Bacteria | 649 |
| 319 | Ga0466960_0874198 | 3300044901 | Bacteria | 547 |
| 320 | Ga0466959_0014931 | 3300045049 | Bacteria | 5658 |
| 321 | Ga0466959_0054012 | 3300045049 | Bacteria | 2936 |
| 322 | Ga0466959_0114839 | 3300045049 | Bacteria | 1918 |
| 323 | Ga0466959_0116144 | 3300045049 | Bacteria | 1906 |
| 324 | Ga0466959_0182116 | 3300045049 | Unclassified | 1469 |
| 325 | Ga0466959_0244161 | 3300045049 | Bacteria | 1239 |
| 326 | Ga0466959_0273454 | 3300045049 | Bacteria | 1161 |
| 327 | Ga0466959_0472642 | 3300045049 | Bacteria | 849 |
| 328 | Ga0466959_0936247 | 3300045049 | Bacteria | 578 |
| 329 | Ga0466959_1194402 | 3300045049 | Bacteria | 505 |
| 330 | Ga0466958_0002772 | 3300045836 | Bacteria | 8903 |
| 331 | Ga0466958_0015550 | 3300045836 | Bacteria | 4363 |
| 332 | Ga0466958_0019004 | 3300045836 | Bacteria | 3996 |
| 333 | Ga0466958_0036350 | 3300045836 | Bacteria | 2947 |
| 334 | Ga0466958_0099554 | 3300045836 | Bacteria | 1806 |
| 335 | Ga0466958_0190311 | 3300045836 | Bacteria | 1304 |
| 336 | Ga0466958_0236779 | 3300045836 | Bacteria | 1166 |
| 337 | Ga0466958_0248904 | 3300045836 | Bacteria | 1136 |
| 338 | Ga0466958_0340649 | 3300045836 | Bacteria | 964 |
| 339 | Ga0466958_0449172 | 3300045836 | Unclassified | 834 |
| 340 | Ga0466958_0476840 | 3300045836 | Bacteria | 809 |
| 341 | Ga0466958_0681542 | 3300045836 | Unclassified | 669 |
| 342 | Ga0466967_0000956 | 3300045976 | Bacteria | 15638 |
| 343 | Ga0466967_0002062 | 3300045976 | Bacteria | 12283 |
| 344 | Ga0466967_0005328 | 3300045976 | Bacteria | 8886 |
| 345 | Ga0466967_0007439 | 3300045976 | Bacteria | 7899 |
| 346 | Ga0466967_0008977 | 3300045976 | Bacteria | 7385 |
| 347 | Ga0466967_0018105 | 3300045976 | Bacteria | 5620 |
| 348 | Ga0466967_0018782 | 3300045976 | Bacteria | 5538 |
| 349 | Ga0466967_0047556 | 3300045976 | Bacteria | 3740 |
| 350 | Ga0466967_0047567 | 3300045976 | Bacteria | 3740 |
| 351 | Ga0466967_0053604 | 3300045976 | Bacteria | 3545 |
| 352 | Ga0466967_0081044 | 3300045976 | Bacteria | 2931 |
| 353 | Ga0466967_0088241 | 3300045976 | Bacteria | 2814 |
| 354 | Ga0466967_0102323 | 3300045976 | Bacteria | 2620 |
| 355 | Ga0466967_0152700 | 3300045976 | Unclassified | 2160 |
| 356 | Ga0466967_0189422 | 3300045976 | Bacteria | 1943 |
| 357 | Ga0466967_0190024 | 3300045976 | Bacteria | 1940 |
| 358 | Ga0466967_0196063 | 3300045976 | Bacteria | 1910 |
| 359 | Ga0466967_0317776 | 3300045976 | Bacteria | 1501 |
| 360 | Ga0466967_0399465 | 3300045976 | Unclassified | 1337 |
| 361 | Ga0466967_0771317 | 3300045976 | Bacteria | 954 |
| 362 | Ga0466967_0815950 | 3300045976 | Bacteria | 926 |
| 363 | Ga0495592_0000716 | 3300046454 | Bacteria | 23196 |
| 364 | Ga0495592_0006583 | 3300046454 | Bacteria | 8656 |
| 365 | Ga0495592_0039072 | 3300046454 | Bacteria | 3567 |
| 366 | Ga0495603_0034998 | 3300046455 | Bacteria | 3018 |
| 367 | Ga0495603_0339555 | 3300046455 | Bacteria | 862 |
| 368 | Ga0495629_0035950 | 3300046459 | Bacteria | 3499 |
| 369 | Ga0495629_0434930 | 3300046459 | Bacteria | 889 |
| 370 | Ga0495629_0556488 | 3300046459 | Bacteria | 769 |
| 371 | Ga0495629_0802691 | 3300046459 | Bacteria | 621 |
| 372 | Ga0495641_0013879 | 3300046461 | Bacteria | 4391 |
| 373 | Ga0495641_0052621 | 3300046461 | Bacteria | 1855 |
| 374 | Ga0495641_0119808 | 3300046461 | Bacteria | 1174 |
| 375 | Ga0495641_0248353 | 3300046461 | Bacteria | 800 |
| 376 | Ga0495641_0285381 | 3300046461 | Bacteria | 743 |
| 377 | Ga0495651_0000001 | 3300046462 | Bacteria | 210544 |
| 378 | Ga0495651_0134323 | 3300046462 | Unclassified | 1802 |
| 379 | Ga0495651_0279188 | 3300046462 | Bacteria | 1129 |
| 380 | Ga0495653_0002945 | 3300046463 | Bacteria | 13629 |
| 381 | Ga0495653_0031268 | 3300046463 | Bacteria | 4232 |
| 382 | Ga0495653_0059110 | 3300046463 | Bacteria | 2911 |
| 383 | Ga0495653_0222143 | 3300046463 | Unclassified | 1269 |
| 384 | Ga0495653_0447195 | 3300046463 | Bacteria | 813 |
| 385 | Ga0495653_0556548 | 3300046463 | Bacteria | 709 |
| 386 | Ga0495580_0060943 | 3300046472 | Bacteria | 2650 |
| 387 | Ga0495580_0098513 | 3300046472 | Bacteria | 2034 |
| 388 | Ga0495582_0000805 | 3300046473 | Bacteria | 17419 |
| 389 | Ga0495582_0028057 | 3300046473 | Bacteria | 3088 |
| 390 | Ga0495582_0037639 | 3300046473 | Bacteria | 2661 |
| 391 | Ga0495582_0087777 | 3300046473 | Bacteria | 1732 |
| 392 | Ga0495582_0141972 | 3300046473 | Bacteria | 1361 |
| 393 | Ga0495639_0002102 | 3300046475 | Bacteria | 8795 |
| 394 | Ga0495639_0250383 | 3300046475 | Unclassified | 876 |
| 395 | Ga0495662_0084579 | 3300046476 | Bacteria | 1544 |
| 396 | Ga0495664_0006762 | 3300046477 | Bacteria | 6342 |
| 397 | Ga0495664_0904845 | 3300046477 | Bacteria | 516 |
| 398 | Ga0495584_0682549 | 3300046491 | Bacteria | 524 |
| 399 | Ga0495594_0573822 | 3300046499 | Bacteria | 640 |
| 400 | Ga0495607_0083456 | 3300046501 | Bacteria | 1750 |
| 401 | Ga0495608_0000448 | 3300046511 | Bacteria | 28730 |
| 402 | Ga0495608_0038288 | 3300046511 | Bacteria | 3221 |
| 403 | Ga0495608_0112696 | 3300046511 | Bacteria | 1748 |
| 404 | Ga0495608_0323102 | 3300046511 | Unclassified | 953 |
| 405 | Ga0495618_0003288 | 3300046514 | Bacteria | 10120 |
| 406 | Ga0495618_0025929 | 3300046514 | Bacteria | 3641 |
| 407 | Ga0495628_0000500 | 3300046516 | Bacteria | 35932 |
| 408 | Ga0495628_0007520 | 3300046516 | Bacteria | 9426 |
| 409 | Ga0495628_0829255 | 3300046516 | Unclassified | 645 |
| 410 | Ga0495630_0022170 | 3300046517 | Bacteria | 4692 |
| 411 | Ga0495630_0235706 | 3300046517 | Bacteria | 1398 |
| 412 | Ga0495630_0683468 | 3300046517 | Bacteria | 785 |
| 413 | Ga0495644_0046667 | 3300046523 | Bacteria | 1628 |
| 414 | Ga0495666_0001439 | 3300046526 | Bacteria | 11572 |
| 415 | Ga0495652_0000015 | 3300046529 | Bacteria | 222624 |
| 416 | Ga0495652_0036455 | 3300046529 | Bacteria | 4276 |
| 417 | Ga0495652_0173093 | 3300046529 | Unclassified | 1664 |
| 418 | Ga0495652_0267419 | 3300046529 | Unclassified | 1258 |
| 419 | Ga0495665_0001480 | 3300046531 | Bacteria | 12592 |
| 420 | Ga0495665_0352992 | 3300046531 | Bacteria | 749 |
| 421 | Ga0495640_0001394 | 3300046533 | Bacteria | 19052 |
| 422 | Ga0495640_0084360 | 3300046533 | Bacteria | 2107 |
| 423 | Ga0495586_0002164 | 3300046535 | Bacteria | 10681 |
| 424 | Ga0495586_0257993 | 3300046535 | Bacteria | 995 |
| 425 | Ga0495586_0573177 | 3300046535 | Bacteria | 652 |
| 426 | Ga0495587_0000036 | 3300046536 | Bacteria | 117570 |
| 427 | Ga0495587_0096475 | 3300046536 | Bacteria | 1705 |
| 428 | Ga0495587_0122916 | 3300046536 | Bacteria | 1486 |
| 429 | Ga0495645_0000039 | 3300046543 | Bacteria | 94569 |
| 430 | Ga0495645_0143744 | 3300046543 | Bacteria | 1662 |
| 431 | Ga0495667_0009291 | 3300046559 | Bacteria | 6667 |
| 432 | Ga0495667_0057887 | 3300046559 | Bacteria | 2547 |
| 433 | Ga0495667_0169908 | 3300046559 | Bacteria | 1401 |
| 434 | Ga0495667_0207922 | 3300046559 | Unclassified | 1251 |
| 435 | Ga0495667_0338619 | 3300046559 | Bacteria | 951 |
| 436 | Ga0495667_0341816 | 3300046559 | Bacteria | 946 |
| 437 | Ga0495634_0005773 | 3300046642 | Bacteria | 9452 |
| 438 | Ga0495634_0027282 | 3300046642 | Bacteria | 3974 |
| 439 | Ga0495634_0108303 | 3300046642 | Bacteria | 1789 |
| 440 | Ga0495611_0362937 | 3300046648 | Unclassified | 664 |
| 441 | Ga0495635_0013748 | 3300046663 | Bacteria | 5664 |
| 442 | Ga0495635_0134171 | 3300046663 | Bacteria | 1687 |
| 443 | Ga0495635_0188680 | 3300046663 | Bacteria | 1400 |
| 444 | Ga0495635_0365080 | 3300046663 | Bacteria | 962 |
| 445 | Ga0495657_0009335 | 3300046675 | Bacteria | 7443 |
| 446 | Ga0495657_0028255 | 3300046675 | Bacteria | 3948 |
| 447 | Ga0495657_0035989 | 3300046675 | Bacteria | 3426 |
| 448 | Ga0495599_0000055 | 3300046678 | Bacteria | 79065 |
| 449 | Ga0495599_0000409 | 3300046678 | Bacteria | 24585 |
| 450 | Ga0495623_0000445 | 3300046679 | Bacteria | 27187 |
| 451 | Ga0495623_0155318 | 3300046679 | Bacteria | 1349 |
| 452 | Ga0495623_0461542 | 3300046679 | Unclassified | 675 |
| 453 | Ga0495646_0029960 | 3300046680 | Bacteria | 3399 |
| 454 | Ga0495646_0031152 | 3300046680 | Bacteria | 3326 |
| 455 | Ga0495646_0150454 | 3300046680 | Bacteria | 1295 |
| 456 | Ga0495647_0001179 | 3300046681 | Bacteria | 8036 |
| 457 | Ga0495647_0010402 | 3300046681 | Unclassified | 3166 |
| 458 | Ga0495647_0297253 | 3300046681 | Bacteria | 727 |
| 459 | Ga0495658_0004116 | 3300046683 | Bacteria | 7163 |
| 460 | Ga0495658_0183366 | 3300046683 | Bacteria | 1299 |
| 461 | Ga0495658_0419937 | 3300046683 | Bacteria | 853 |
| 462 | Ga0495613_0008288 | 3300046689 | Bacteria | 7716 |
| 463 | Ga0495613_0108321 | 3300046689 | Bacteria | 2004 |
| 464 | Ga0495613_0343565 | 3300046689 | Bacteria | 1026 |
| 465 | Ga0495613_0375506 | 3300046689 | Bacteria | 973 |
| 466 | Ga0495624_0104260 | 3300046690 | Bacteria | 1745 |
| 467 | Ga0495600_0032611 | 3300046809 | Bacteria | 3381 |
| 468 | Ga0495600_0106366 | 3300046809 | Bacteria | 1828 |
| 469 | Ga0495600_0160793 | 3300046809 | Bacteria | 1452 |
| 470 | Ga0495581_0013174 | 3300047315 | Bacteria | 4794 |
| 471 | Ga0495581_0093803 | 3300047315 | Bacteria | 1742 |
| 472 | Ga0495604_0000004 | 3300047317 | Bacteria | 456385 |
| 473 | Ga0495604_0042743 | 3300047317 | Bacteria | 3550 |
| 474 | Ga0495604_0650110 | 3300047317 | Bacteria | 673 |
| 475 | Ga0495674_0023292 | 3300047319 | Bacteria | 5709 |
| 476 | Ga0495674_0042802 | 3300047319 | Bacteria | 4036 |
| 477 | Ga0495674_1086564 | 3300047319 | Bacteria | 609 |
| 478 | Ga0495674_1214117 | 3300047319 | Unclassified | 569 |
| 479 | Ga0495676_0004734 | 3300047321 | Bacteria | 12459 |
| 480 | Ga0495676_0134114 | 3300047321 | Bacteria | 1783 |
| 481 | Ga0495676_0312006 | 3300047321 | Bacteria | 1058 |
| 482 | Ga0495676_1091751 | 3300047321 | Unclassified | 507 |
| 483 | Ga0495680_0026960 | 3300047322 | Bacteria | 4728 |
| 484 | Ga0495680_0048360 | 3300047322 | Bacteria | 3340 |
| 485 | Ga0495680_0197101 | 3300047322 | Bacteria | 1446 |
| 486 | Ga0495680_0317885 | 3300047322 | Bacteria | 1090 |
| 487 | Ga0495675_0000250 | 3300047444 | Bacteria | 38818 |
| 488 | Ga0495677_0167722 | 3300047445 | Unclassified | 849 |
| 489 | Ga0495684_0017002 | 3300047471 | Bacteria | 5604 |
| 490 | Ga0495684_0020962 | 3300047471 | Bacteria | 5034 |
| 491 | Ga0495684_0730261 | 3300047471 | Bacteria | 654 |
| 492 | Ga0495593_0002267 | 3300047673 | Bacteria | 11530 |
| 493 | Ga0495593_0552927 | 3300047673 | Bacteria | 577 |
| 494 | Ga0495602_0000235 | 3300048088 | Bacteria | 51786 |
| 495 | Ga0495602_0007762 | 3300048088 | Bacteria | 11216 |
| 496 | Ga0495602_0326499 | 3300048088 | Bacteria | 1114 |
| 497 | Ga0495614_0000112 | 3300048089 | Bacteria | 27892 |
| 498 | Ga0495614_0225466 | 3300048089 | Bacteria | 853 |
| 499 | Ga0495614_0316374 | 3300048089 | Bacteria | 723 |
| 500 | Ga0496100_0229156 | 3300048903 | Bacteria | 1366 |
| 501 | Ga0496100_0480119 | 3300048903 | Unclassified | 956 |
| 502 | Ga0496101_0174367 | 3300048904 | Bacteria | 1653 |
| 503 | Ga0496101_0288944 | 3300048904 | Bacteria | 1283 |
| 504 | Ga0496101_0362346 | 3300048904 | Bacteria | 1140 |
| 505 | Ga0496101_0481789 | 3300048904 | Bacteria | 980 |
| 506 | Ga0496101_0488608 | 3300048904 | Unclassified | 972 |
| 507 | Ga0496102_0224542 | 3300048905 | Bacteria | 1771 |
| 508 | Ga0496102_0788943 | 3300048905 | Bacteria | 872 |
| 509 | Ga0496102_1361283 | 3300048905 | Bacteria | 629 |
| 510 | Ga0496104_0022392 | 3300048907 | Bacteria | 5804 |
| 511 | Ga0496104_0029020 | 3300048907 | Bacteria | 5129 |
| 512 | Ga0496104_0040981 | 3300048907 | Bacteria | 4342 |
| 513 | Ga0496104_0465849 | 3300048907 | Bacteria | 1175 |
| 514 | Ga0496105_0017975 | 3300048908 | Bacteria | 5674 |
| 515 | Ga0496105_0144392 | 3300048908 | Bacteria | 1957 |
| 516 | Ga0496105_0266535 | 3300048908 | Bacteria | 1384 |
| 517 | Ga0496106_0014802 | 3300048909 | Bacteria | 5768 |
| 518 | Ga0496106_0535336 | 3300048909 | Bacteria | 940 |
| 519 | Ga0496107_0022049 | 3300048910 | Bacteria | 4499 |
| 520 | Ga0496107_0328666 | 3300048910 | Bacteria | 1138 |
| 521 | Ga0496108_0008091 | 3300048911 | Bacteria | 8529 |
| 522 | Ga0496108_0023961 | 3300048911 | Bacteria | 5024 |
| 523 | Ga0496108_0084150 | 3300048911 | Bacteria | 2699 |
| 524 | Ga0496108_0560852 | 3300048911 | Bacteria | 996 |
| 525 | Ga0496109_0006728 | 3300048912 | Bacteria | 9680 |
| 526 | Ga0496109_0170353 | 3300048912 | Bacteria | 2042 |
| 527 | Ga0496109_0358375 | 3300048912 | Bacteria | 1378 |
| 528 | Ga0496109_0397239 | 3300048912 | Bacteria | 1302 |
| 529 | Ga0496109_1605071 | 3300048912 | Unclassified | 585 |
| 530 | Ga0496109_1712495 | 3300048912 | Bacteria | 562 |
| 531 | Ga0496110_0458988 | 3300048913 | Bacteria | 1161 |
| 532 | Ga0496110_0464602 | 3300048913 | Bacteria | 1153 |
| 533 | Ga0496111_0072549 | 3300048914 | Bacteria | 2506 |
| 534 | Ga0496112_0062672 | 3300048915 | Bacteria | 3668 |
| 535 | Ga0496112_0190526 | 3300048915 | Bacteria | 2013 |
| 536 | Ga0496112_0251899 | 3300048915 | Bacteria | 1717 |
| 537 | Ga0496112_1330265 | 3300048915 | Unclassified | 634 |
| 538 | Ga0496113_0742663 | 3300048916 | Bacteria | 782 |
| 539 | Ga0496114_0091189 | 3300048917 | Bacteria | 2588 |
| 540 | Ga0496114_0134035 | 3300048917 | Bacteria | 2141 |
| 541 | Ga0496114_0330508 | 3300048917 | Unclassified | 1347 |
| 542 | Ga0496115_0043665 | 3300048918 | Bacteria | 3575 |
| 543 | Ga0496115_0633966 | 3300048918 | Unclassified | 846 |
| 544 | Ga0496115_1077929 | 3300048918 | Bacteria | 610 |
| 545 | Ga0501067_0103492 | 3300049583 | Bacteria | 1582 |
| 546 | Ga0501069_0078504 | 3300049585 | Bacteria | 1857 |
| 547 | Ga0501069_0080780 | 3300049585 | Bacteria | 1831 |
| 548 | nmdc:mga08y16_291931_c1 | 3300050511 | Bacteria | 1681 |
| 549 | nmdc:mga08y16_58590_c1 | 3300050511 | Bacteria | 4024 |
| 550 | nmdc:mga0n895_304986_c1 | 3300050512 | Bacteria | 1614 |
| 551 | nmdc:mga0n895_5602_c1 | 3300050512 | Bacteria | 10514 |
| 552 | nmdc:mga0rr50_124002_c1 | 3300050513 | Bacteria | 2060 |
| 553 | nmdc:mga08x19_87079_c1 | 3300050514 | Bacteria | 2057 |
| 554 | Ga0495601_0000553 | 3300053077 | Bacteria | 19807 |
| 555 | Ga0495601_0014800 | 3300053077 | Bacteria | 4707 |
| 556 | Ga0495601_0139038 | 3300053077 | Bacteria | 1583 |
| 557 | Ga0495601_0386864 | 3300053077 | Unclassified | 907 |
| 558 | Ga0495612_0002155 | 3300053078 | Bacteria | 8097 |
| 559 | Ga0495612_0031034 | 3300053078 | Bacteria | 2154 |
| 560 | Ga0495612_0043254 | 3300053078 | Bacteria | 1840 |
| 561 | Ga0495655_0265306 | 3300053083 | Bacteria | 581 |
| 562 | Ga0495595_0005478 | 3300053084 | Bacteria | 5141 |
| 563 | Ga0495595_0035368 | 3300053084 | Bacteria | 2263 |
| 564 | Ga0495595_0269060 | 3300053084 | Unclassified | 854 |
| 565 | Ga0495619_0007907 | 3300053085 | Bacteria | 6727 |
| 566 | Ga0495619_0011553 | 3300053085 | Bacteria | 5564 |
| 567 | Ga0495619_0022976 | 3300053085 | Bacteria | 3993 |
| 568 | Ga0495619_0203837 | 3300053085 | Bacteria | 1369 |
| 569 | Ga0495619_0415310 | 3300053085 | Bacteria | 928 |
| 570 | Ga0500566_0082911 | 3300053094 | Bacteria | 1781 |
| 571 | Ga0500657_088586 | 3300053728 | Bacteria | 1310 |
| 572 | Ga0466962_0002540 | 3300061719 | Bacteria | 8660 |
| 573 | Ga0466962_0005481 | 3300061719 | Bacteria | 6100 |
| 574 | Ga0466962_0005901 | 3300061719 | Bacteria | 5883 |
| 575 | Ga0466962_0008807 | 3300061719 | Bacteria | 4836 |
| 576 | Ga0466962_0374425 | 3300061719 | Bacteria | 711 |
| 577 | Ga0530510_0334297 | 3300061734 | Bacteria | 1137 |
| 578 | Ga0495603_0677573 | |||
| 579 | Ga0070658_10383237 | |||
| 580 | Ga0070683_100001257 | |||
| 581 | Ga0070683_100196505 | |||
| 582 | Ga0070683_100346567 | |||
| 583 | Ga0070690_100561677 | |||
| 584 | Ga0070680_100047923 | |||
| 585 | Ga0070680_100116332 | |||
| 586 | Ga0070680_100314010 | |||
| 587 | Ga0070680_100741507 | |||
| 588 | Ga0070682_100180929 | |||
| 589 | Ga0070682_100187849 | |||
| 590 | Ga0068868_100868433 | |||
| 591 | Ga0070660_100775342 | |||
| 592 | Ga0070660_101748045 | |||
| 593 | Ga0070689_101314184 | |||
| 594 | Ga0070691_10054620 | |||
| 595 | Ga0070661_100524206 | |||
| 596 | Ga0070671_100392233 | |||
| 597 | Ga0070659_100814807 | |||
| 598 | Ga0070659_101814140 | |||
| 599 | Ga0070714_100037754 | |||
| 600 | Ga0070714_100172277 | |||
| 601 | Ga0070714_100199984 | |||
| 602 | Ga0070714_100679317 | |||
| 603 | Ga0070714_101150411 | |||
| 604 | Ga0070713_100695490 | |||
| 605 | Ga0070713_101299854 | |||
| 606 | Ga0070713_101745052 | |||
| 607 | Ga0070710_10004667 | |||
| 608 | Ga0070711_100002087 | |||
| 609 | Ga0070711_100987126 | |||
| 610 | Ga0070663_101680526 | |||
| 611 | Ga0070662_100304264 | |||
| 612 | Ga0070681_10017683 | |||
| 613 | Ga0070681_10026566 | |||
| 614 | Ga0070681_10100450 | |||
| 615 | Ga0070681_10678272 | |||
| 616 | Ga0068867_100905122 | |||
| 617 | Ga0070706_100507712 | |||
| 618 | Ga0070707_100580103 | |||
| 619 | Ga0070679_100040375 | |||
| 620 | Ga0070679_100151473 | |||
| 621 | Ga0070679_100186050 | |||
| 622 | Ga0070684_100036453 | |||
| 623 | Ga0070684_100071746 | |||
| 624 | Ga0070684_100074215 | |||
| 625 | Ga0070684_100396854 | |||
| 626 | Ga0070684_100663997 | |||
| 627 | Ga0070672_101635192 | |||
| 628 | Ga0070695_100807791 | |||
| 629 | Ga0070696_100380608 | |||
| 630 | Ga0070693_100184997 | |||
| 631 | Ga0070664_100081852 | |||
| 632 | Ga0070664_100093886 | |||
| 633 | Ga0068857_100173306 | |||
| 634 | Ga0068857_100201399 | |||
| 635 | Ga0068852_100285193 | |||
| 636 | Ga0068859_101626247 | |||
| 637 | Ga0068861_100370779 | |||
| 638 | Ga0068858_100157799 | |||
| 639 | Ga0081538_10016993 | |||
| 640 | Ga0070717_10036084 | |||
| 641 | Ga0070717_10364088 | |||
| 642 | Ga0070717_10543519 | |||
| 643 | Ga0075432_10159534 | |||
| 644 | Ga0070712_101841672 | |||
| 645 | Ga0075433_10266084 | |||
| 646 | Ga0075434_100001312 | |||
| 647 | Ga0075434_100018897 | |||
| 648 | Ga0075436_100295097 | |||
| 649 | Ga0097620_101626673 | |||
| 650 | Ga0075435_100133816 | |||
| 651 | Ga0111539_10013416 | |||
| 652 | Ga0111539_10835639 | |||
| 653 | Ga0105245_10348043 | |||
| 654 | Ga0105245_10712134 | |||
| 655 | Ga0105245_10937455 | |||
| 656 | Ga0105245_10953773 | |||
| 657 | Ga0105243_10030136 | |||
| 658 | Ga0105243_10575425 | |||
| 659 | Ga0105241_10877352 | |||
| 660 | Ga0105241_11044160 | |||
| 661 | Ga0105248_12583784 | |||
| 662 | Ga0105238_11522958 | |||
| 663 | Ga0105239_10630083 | |||
| 664 | Ga0105239_11118865 | |||
| 665 | Ga0105246_10089004 | |||
| 666 | Ga0157373_10425352 | |||
| 667 | Ga0157371_10930067 | |||
| 668 | Ga0157369_10263573 | |||
| 669 | Ga0157369_10380653 | |||
| 670 | Ga0157369_10479435 | |||
| 671 | Ga0157374_10626377 | |||
| 672 | Ga0157374_11284399 | |||
| 673 | Ga0163162_10248097 | |||
| 674 | Ga0163162_10467970 | |||
| 675 | Ga0157372_10280223 | |||
| 676 | Ga0157372_10357775 | |||
| 677 | Ga0157372_11697258 | |||
| 678 | Ga0157372_12562486 | |||
| 679 | Ga0163163_10397878 | |||
| 680 | Ga0163163_11531279 | |||
| 681 | Ga0157380_11625690 | |||
| 682 | Ga0182008_10002774 | |||
| 683 | Ga0182008_10566341 | |||
| 684 | Ga0157377_10046956 | |||
| 685 | Ga0157376_10508560 | |||
| 686 | Ga0157376_11075117 | |||
| 687 | Ga0182006_1013543 | |||
| 688 | Ga0182006_1182150 | |||
| 689 | Ga0182007_10021417 | |||
| 690 | Ga0182005_1051467 | |||
| 691 | Ga0182005_1072805 | |||
| 692 | Ga0163161_10627692 | |||
| 693 | Ga0197907_10896267 | |||
| 694 | Ga0206356_10729212 | |||
| 695 | Ga0206356_10730043 | |||
| 696 | Ga0206356_10924113 | |||
| 697 | Ga0206354_10604998 | |||
| 698 | Ga0206353_10428564 | |||
| 699 | Ga0206353_10963801 | |||
| 700 | Ga0206353_11396111 | |||
| 701 | Ga0213876_10010722 | |||
| 702 | Ga0207682_10402743 | |||
| 703 | Ga0207645_10057286 | |||
| 704 | Ga0207705_10025354 | |||
| 705 | Ga0207705_10478916 | |||
| 706 | Ga0207684_10811775 | |||
| 707 | Ga0207707_10017227 | |||
| 708 | Ga0207707_10148239 | |||
| 709 | Ga0207707_10176501 | |||
| 710 | Ga0207695_10061423 | |||
| 711 | Ga0207693_10000222 | |||
| 712 | Ga0207663_11658285 | |||
| 713 | Ga0207660_10092317 | |||
| 714 | Ga0207660_10566677 | |||
| 715 | Ga0207660_10990608 | |||
| 716 | Ga0207657_10073875 | |||
| 717 | Ga0207657_10097233 | |||
| 718 | Ga0207657_11005984 | |||
| 719 | Ga0207649_10370396 | |||
| 720 | Ga0207652_10035702 | |||
| 721 | Ga0207652_10179775 | |||
| 722 | Ga0207646_10392332 | |||
| 723 | Ga0207646_10435014 | |||
| 724 | Ga0207694_10143488 | |||
| 725 | Ga0207650_10554465 | |||
| 726 | Ga0207659_10108553 | |||
| 727 | Ga0207659_10970013 | |||
| 728 | Ga0207659_11051735 | |||
| 729 | Ga0207687_10282337 | |||
| 730 | Ga0207687_10783869 | |||
| 731 | Ga0207687_11054031 | |||
| 732 | Ga0207664_10024691 | |||
| 733 | Ga0207664_10046571 | |||
| 734 | Ga0207664_10140776 | |||
| 735 | Ga0207664_10372013 | |||
| 736 | Ga0207664_10513931 | |||
| 737 | Ga0207690_10113646 | |||
| 738 | Ga0207690_10574988 | |||
| 739 | Ga0207690_11417693 | |||
| 740 | Ga0207706_10258699 | |||
| 741 | Ga0207706_10575448 | |||
| 742 | Ga0207709_10400550 | |||
| 743 | Ga0207709_10622470 | |||
| 744 | Ga0207670_10353393 | |||
| 745 | Ga0207665_10931905 | |||
| 746 | Ga0207691_10440058 | |||
| 747 | Ga0207711_10442597 | |||
| 748 | Ga0207689_10031506 | |||
| 749 | Ga0207661_10026391 | |||
| 750 | Ga0207661_10300745 | |||
| 751 | Ga0207661_10362968 | |||
| 752 | Ga0207661_10932196 | |||
| 753 | Ga0207679_10029622 | |||
| 754 | Ga0207679_10057264 | |||
| 755 | Ga0207679_10127561 | |||
| 756 | Ga0207679_10165421 | |||
| 757 | Ga0207667_10353113 | |||
| 758 | Ga0207667_10770900 | |||
| 759 | Ga0207640_10107311 | |||
| 760 | Ga0207677_10136684 | |||
| 761 | Ga0207677_10315430 | |||
| 762 | Ga0207678_11187185 | |||
| 763 | Ga0207708_10065216 | |||
| 764 | Ga0207702_10046515 | |||
| 765 | Ga0207702_10066214 | |||
| 766 | Ga0207702_10943006 | |||
| 767 | Ga0207702_11592474 | |||
| 768 | Ga0207641_10256297 | |||
| 769 | Ga0207648_10248134 | |||
| 770 | Ga0207676_11630017 | |||
| 771 | Ga0207674_10048281 | |||
| 772 | Ga0207674_10085312 | |||
| 773 | Ga0207674_10158505 | |||
| 774 | Ga0207675_100126210 | |||
| 775 | Ga0207675_100697661 | |||
| 776 | Ga0207675_101792118 | |||
| 777 | Ga0207698_10251316 | |||
| 778 | Ga0207698_11518703 | |||
| 779 | Ga0268266_10021387 | |||
| 780 | Ga0268264_10643619 | |||
| 781 | Ga0268264_12125305 | |||
| 782 | Ga0265326_10052772 | |||
| 783 | Ga0265318_10172415 | |||
| 784 | Ga0265338_10184144 | |||
| 785 | Ga0265338_10467511 | |||
| 786 | Ga0265340_10498253 | |||
| 787 | Ga0265339_10502061 | |||
| 788 | Ga0265316_10232554 | |||
| 789 | Ga0307413_10079700 | |||
| 790 | Ga0307407_10012276 | |||
| 791 | Ga0307409_101688872 | |||
| 792 | Ga0307414_10023649 | |||
| 793 | Ga0373926_0081606 | |||
| 794 | Ga0373944_0044646 | |||
| 795 | Ga0373936_0039380 | |||
| 796 | Ga0373945_0056727 | |||
| 797 | Ga0373943_0000925 | |||
| 798 | Ga0373943_0396526 | |||
| 799 | Ga0373946_0013416 | |||
| 800 | Ga0373955_0236219 | |||
| 801 | Ga0373955_0553973 | |||
| 802 | Ga0316574_0219410 | |||
| 803 | Ga0373924_0467323 | |||
| 804 | Ga0373935_0014242 | |||
| 805 | Ga0373933_0502414 | |||
| 806 | Ga0373947_0002909 | |||
| 807 | Ga0373947_0375735 | |||
| 808 | Ga0373937_0003744 | |||
| 809 | Ga0373937_0370847 | |||
| 810 | Ga0373937_1463601 | |||
| 811 | Ga0373925_0002949 | |||
| 812 | Ga0373925_0832648 | |||
| 813 | Ga0373925_0984362 | |||
| 814 | Ga0395900_1211748 | |||
| 815 | Ga0395898_0136704 | |||
| 816 | Ga0395898_0399933 | |||
| 817 | Ga0395898_0612442 | |||
| 818 | Ga0395901_0078816 | |||
| 819 | Ga0395901_0198672 | |||
| 820 | Ga0400483_042911 | |||
| 821 | Ga0400483_044649 | |||
| 822 | Ga0400483_235963 | |||
| 823 | Ga0436365_1146591 | |||
| 824 | Ga0436360_1254102 | |||
| 825 | Ga0436362_0347855 | |||
| 826 | Ga0439439_0051584 | |||
| 827 | Ga0439448_0097078 | |||
| 828 | Ga0439446_0070230 | |||
| 829 | Ga0439458_0058143 | |||
| 830 | Ga0466969_0014427 | |||
| 831 | Ga0466969_0242767 | |||
| 832 | Ga0466965_0078602 | |||
| 833 | Ga0466965_0242133 | |||
| 834 | Ga0466966_0031430 | |||
| 835 | Ga0466966_0041402 | |||
| 836 | Ga0466966_0081433 | |||
| 837 | Ga0466966_0089709 | |||
| 838 | Ga0466966_0297870 | |||
| 839 | Ga0466966_0338502 | |||
| 840 | Ga0466961_0008653 | |||
| 841 | Ga0466961_0187362 | |||
| 842 | Ga0466961_0271858 | |||
| 843 | Ga0466961_0365464 | |||
| 844 | Ga0466963_0001734 | |||
| 845 | Ga0466963_0002859 | |||
| 846 | Ga0466963_0003784 | |||
| 847 | Ga0466963_0006884 | |||
| 848 | Ga0466963_0009337 | |||
| 849 | Ga0466963_0009681 | |||
| 850 | Ga0466963_0016797 | |||
| 851 | Ga0466963_0018403 | |||
| 852 | Ga0466963_0060754 | |||
| 853 | Ga0466963_0079583 | |||
| 854 | Ga0466963_0102560 | |||
| 855 | Ga0466963_0219240 | |||
| 856 | Ga0466963_0348652 | |||
| 857 | Ga0466963_0418928 | |||
| 858 | Ga0466963_0451203 | |||
| 859 | Ga0466963_1189046 | |||
| 860 | Ga0466964_0013423 | |||
| 861 | Ga0466964_0013533 | |||
| 862 | Ga0466964_0022864 | |||
| 863 | Ga0466964_0023083 | |||
| 864 | Ga0466964_0024426 | |||
| 865 | Ga0466964_0256438 | |||
| 866 | Ga0466964_0455954 | |||
| 867 | Ga0466971_0008317 | |||
| 868 | Ga0466971_0038490 | |||
| 869 | Ga0466971_0042925 | |||
| 870 | Ga0466971_0067301 | |||
| 871 | Ga0466971_0089796 | |||
| 872 | Ga0466968_0009193 | |||
| 873 | Ga0466968_0048223 | |||
| 874 | Ga0466968_0063899 | |||
| 875 | Ga0466968_0144523 | |||
| 876 | Ga0466968_0189866 | |||
| 877 | Ga0466968_0223090 | |||
| 878 | Ga0466968_0417796 | |||
| 879 | Ga0466968_0444909 | |||
| 880 | Ga0466968_0736668 | |||
| 881 | Ga0466970_0076633 | |||
| 882 | Ga0466970_0112100 | |||
| 883 | Ga0466957_0005089 | |||
| 884 | Ga0466957_0010143 | |||
| 885 | Ga0466957_0010441 | |||
| 886 | Ga0466957_0016238 | |||
| 887 | Ga0466957_0021347 | |||
| 888 | Ga0466957_0069170 | |||
| 889 | Ga0466957_0121436 | |||
| 890 | Ga0466957_0194728 | |||
| 891 | Ga0466957_0219045 | |||
| 892 | Ga0466957_0226342 | |||
| 893 | Ga0466960_0038468 | |||
| 894 | Ga0466960_0191269 | |||
| 895 | Ga0466960_0608138 | |||
| 896 | Ga0466960_0874198 | |||
| 897 | Ga0466959_0014931 | |||
| 898 | Ga0466959_0054012 | |||
| 899 | Ga0466959_0114839 | |||
| 900 | Ga0466959_0116144 | |||
| 901 | Ga0466959_0182116 | |||
| 902 | Ga0466959_0244161 | |||
| 903 | Ga0466959_0273454 | |||
| 904 | Ga0466959_0472642 | |||
| 905 | Ga0466959_0936247 | |||
| 906 | Ga0466959_1194402 | |||
| 907 | Ga0466958_0002772 | |||
| 908 | Ga0466958_0015550 | |||
| 909 | Ga0466958_0019004 | |||
| 910 | Ga0466958_0036350 | |||
| 911 | Ga0466958_0099554 | |||
| 912 | Ga0466958_0190311 | |||
| 913 | Ga0466958_0236779 | |||
| 914 | Ga0466958_0248904 | |||
| 915 | Ga0466958_0340649 | |||
| 916 | Ga0466958_0449172 | |||
| 917 | Ga0466958_0476840 | |||
| 918 | Ga0466958_0681542 | |||
| 919 | Ga0466967_0000956 | |||
| 920 | Ga0466967_0002062 | |||
| 921 | Ga0466967_0005328 | |||
| 922 | Ga0466967_0007439 | |||
| 923 | Ga0466967_0008977 | |||
| 924 | Ga0466967_0018105 | |||
| 925 | Ga0466967_0018782 | |||
| 926 | Ga0466967_0047556 | |||
| 927 | Ga0466967_0047567 | |||
| 928 | Ga0466967_0053604 | |||
| 929 | Ga0466967_0081044 | |||
| 930 | Ga0466967_0088241 | |||
| 931 | Ga0466967_0102323 | |||
| 932 | Ga0466967_0152700 | |||
| 933 | Ga0466967_0189422 | |||
| 934 | Ga0466967_0190024 | |||
| 935 | Ga0466967_0196063 | |||
| 936 | Ga0466967_0317776 | |||
| 937 | Ga0466967_0399465 | |||
| 938 | Ga0466967_0771317 | |||
| 939 | Ga0466967_0815950 | |||
| 940 | Ga0495592_0000716 | |||
| 941 | Ga0495592_0006583 | |||
| 942 | Ga0495592_0039072 | |||
| 943 | Ga0495603_0034998 | |||
| 944 | Ga0495603_0339555 | |||
| 945 | Ga0495629_0035950 | |||
| 946 | Ga0495629_0434930 | |||
| 947 | Ga0495629_0556488 | |||
| 948 | Ga0495629_0802691 | |||
| 949 | Ga0495641_0013879 | |||
| 950 | Ga0495641_0052621 | |||
| 951 | Ga0495641_0119808 | |||
| 952 | Ga0495641_0248353 | |||
| 953 | Ga0495641_0285381 | |||
| 954 | Ga0495651_0000001 | |||
| 955 | Ga0495651_0134323 | |||
| 956 | Ga0495651_0279188 | |||
| 957 | Ga0495653_0002945 | |||
| 958 | Ga0495653_0031268 | |||
| 959 | Ga0495653_0059110 | |||
| 960 | Ga0495653_0222143 | |||
| 961 | Ga0495653_0447195 | |||
| 962 | Ga0495653_0556548 | |||
| 963 | Ga0495580_0060943 | |||
| 964 | Ga0495580_0098513 | |||
| 965 | Ga0495582_0000805 | |||
| 966 | Ga0495582_0028057 | |||
| 967 | Ga0495582_0037639 | |||
| 968 | Ga0495582_0087777 | |||
| 969 | Ga0495582_0141972 | |||
| 970 | Ga0495639_0002102 | |||
| 971 | Ga0495639_0250383 | |||
| 972 | Ga0495662_0084579 | |||
| 973 | Ga0495664_0006762 | |||
| 974 | Ga0495664_0904845 | |||
| 975 | Ga0495584_0682549 | |||
| 976 | Ga0495594_0573822 | |||
| 977 | Ga0495607_0083456 | |||
| 978 | Ga0495608_0000448 | |||
| 979 | Ga0495608_0038288 | |||
| 980 | Ga0495608_0112696 | |||
| 981 | Ga0495608_0323102 | |||
| 982 | Ga0495618_0003288 | |||
| 983 | Ga0495618_0025929 | |||
| 984 | Ga0495628_0000500 | |||
| 985 | Ga0495628_0007520 | |||
| 986 | Ga0495628_0829255 | |||
| 987 | Ga0495630_0022170 | |||
| 988 | Ga0495630_0235706 | |||
| 989 | Ga0495630_0683468 | |||
| 990 | Ga0495644_0046667 | |||
| 991 | Ga0495666_0001439 | |||
| 992 | Ga0495652_0000015 | |||
| 993 | Ga0495652_0036455 | |||
| 994 | Ga0495652_0173093 | |||
| 995 | Ga0495652_0267419 | |||
| 996 | Ga0495665_0001480 | |||
| 997 | Ga0495665_0352992 | |||
| 998 | Ga0495640_0001394 | |||
| 999 | Ga0495640_0084360 | |||
| 1000 | Ga0495586_0002164 | |||
| 1001 | Ga0495586_0257993 | |||
| 1002 | Ga0495586_0573177 | |||
| 1003 | Ga0495587_0000036 | |||
| 1004 | Ga0495587_0096475 | |||
| 1005 | Ga0495587_0122916 | |||
| 1006 | Ga0495645_0000039 | |||
| 1007 | Ga0495645_0143744 | |||
| 1008 | Ga0495667_0009291 | |||
| 1009 | Ga0495667_0057887 | |||
| 1010 | Ga0495667_0169908 | |||
| 1011 | Ga0495667_0207922 | |||
| 1012 | Ga0495667_0338619 | |||
| 1013 | Ga0495667_0341816 | |||
| 1014 | Ga0495634_0005773 | |||
| 1015 | Ga0495634_0027282 | |||
| 1016 | Ga0495634_0108303 | |||
| 1017 | Ga0495611_0362937 | |||
| 1018 | Ga0495635_0013748 | |||
| 1019 | Ga0495635_0134171 | |||
| 1020 | Ga0495635_0188680 | |||
| 1021 | Ga0495635_0365080 | |||
| 1022 | Ga0495657_0009335 | |||
| 1023 | Ga0495657_0028255 | |||
| 1024 | Ga0495657_0035989 | |||
| 1025 | Ga0495599_0000055 | |||
| 1026 | Ga0495599_0000409 | |||
| 1027 | Ga0495623_0000445 | |||
| 1028 | Ga0495623_0155318 | |||
| 1029 | Ga0495623_0461542 | |||
| 1030 | Ga0495646_0029960 | |||
| 1031 | Ga0495646_0031152 | |||
| 1032 | Ga0495646_0150454 | |||
| 1033 | Ga0495647_0001179 | |||
| 1034 | Ga0495647_0010402 | |||
| 1035 | Ga0495647_0297253 | |||
| 1036 | Ga0495658_0004116 | |||
| 1037 | Ga0495658_0183366 | |||
| 1038 | Ga0495658_0419937 | |||
| 1039 | Ga0495613_0008288 | |||
| 1040 | Ga0495613_0108321 | |||
| 1041 | Ga0495613_0343565 | |||
| 1042 | Ga0495613_0375506 | |||
| 1043 | Ga0495624_0104260 | |||
| 1044 | Ga0495600_0032611 | |||
| 1045 | Ga0495600_0106366 | |||
| 1046 | Ga0495600_0160793 | |||
| 1047 | Ga0495581_0013174 | |||
| 1048 | Ga0495581_0093803 | |||
| 1049 | Ga0495604_0000004 | |||
| 1050 | Ga0495604_0042743 | |||
| 1051 | Ga0495604_0650110 | |||
| 1052 | Ga0495674_0023292 | |||
| 1053 | Ga0495674_0042802 | |||
| 1054 | Ga0495674_1086564 | |||
| 1055 | Ga0495674_1214117 | |||
| 1056 | Ga0495676_0004734 | |||
| 1057 | Ga0495676_0134114 | |||
| 1058 | Ga0495676_0312006 | |||
| 1059 | Ga0495676_1091751 | |||
| 1060 | Ga0495680_0026960 | |||
| 1061 | Ga0495680_0048360 | |||
| 1062 | Ga0495680_0197101 | |||
| 1063 | Ga0495680_0317885 | |||
| 1064 | Ga0495675_0000250 | |||
| 1065 | Ga0495677_0167722 | |||
| 1066 | Ga0495684_0017002 | |||
| 1067 | Ga0495684_0020962 | |||
| 1068 | Ga0495684_0730261 | |||
| 1069 | Ga0495593_0002267 | |||
| 1070 | Ga0495593_0552927 | |||
| 1071 | Ga0495602_0000235 | |||
| 1072 | Ga0495602_0007762 | |||
| 1073 | Ga0495602_0326499 | |||
| 1074 | Ga0495614_0000112 | |||
| 1075 | Ga0495614_0225466 | |||
| 1076 | Ga0495614_0316374 | |||
| 1077 | Ga0496100_0229156 | |||
| 1078 | Ga0496100_0480119 | |||
| 1079 | Ga0496101_0174367 | |||
| 1080 | Ga0496101_0288944 | |||
| 1081 | Ga0496101_0362346 | |||
| 1082 | Ga0496101_0481789 | |||
| 1083 | Ga0496101_0488608 | |||
| 1084 | Ga0496102_0224542 | |||
| 1085 | Ga0496102_0788943 | |||
| 1086 | Ga0496102_1361283 | |||
| 1087 | Ga0496104_0022392 | |||
| 1088 | Ga0496104_0029020 | |||
| 1089 | Ga0496104_0040981 | |||
| 1090 | Ga0496104_0465849 | |||
| 1091 | Ga0496105_0017975 | |||
| 1092 | Ga0496105_0144392 | |||
| 1093 | Ga0496105_0266535 | |||
| 1094 | Ga0496106_0014802 | |||
| 1095 | Ga0496106_0535336 | |||
| 1096 | Ga0496107_0022049 | |||
| 1097 | Ga0496107_0328666 | |||
| 1098 | Ga0496108_0008091 | |||
| 1099 | Ga0496108_0023961 | |||
| 1100 | Ga0496108_0084150 | |||
| 1101 | Ga0496108_0560852 | |||
| 1102 | Ga0496109_0006728 | |||
| 1103 | Ga0496109_0170353 | |||
| 1104 | Ga0496109_0358375 | |||
| 1105 | Ga0496109_0397239 | |||
| 1106 | Ga0496109_1605071 | |||
| 1107 | Ga0496109_1712495 | |||
| 1108 | Ga0496110_0458988 | |||
| 1109 | Ga0496110_0464602 | |||
| 1110 | Ga0496111_0072549 | |||
| 1111 | Ga0496112_0062672 | |||
| 1112 | Ga0496112_0190526 | |||
| 1113 | Ga0496112_0251899 | |||
| 1114 | Ga0496112_1330265 | |||
| 1115 | Ga0496113_0742663 | |||
| 1116 | Ga0496114_0091189 | |||
| 1117 | Ga0496114_0134035 | |||
| 1118 | Ga0496114_0330508 | |||
| 1119 | Ga0496115_0043665 | |||
| 1120 | Ga0496115_0633966 | |||
| 1121 | Ga0496115_1077929 | |||
| 1122 | Ga0501067_0103492 | |||
| 1123 | Ga0501069_0078504 | |||
| 1124 | Ga0501069_0080780 | |||
| 1125 | nmdc:mga08y16_291931_c1 | |||
| 1126 | nmdc:mga08y16_58590_c1 | |||
| 1127 | nmdc:mga0n895_304986_c1 | |||
| 1128 | nmdc:mga0n895_5602_c1 | |||
| 1129 | nmdc:mga0rr50_124002_c1 | |||
| 1130 | nmdc:mga08x19_87079_c1 | |||
| 1131 | Ga0495601_0000553 | |||
| 1132 | Ga0495601_0014800 | |||
| 1133 | Ga0495601_0139038 | |||
| 1134 | Ga0495601_0386864 | |||
| 1135 | Ga0495612_0002155 | |||
| 1136 | Ga0495612_0031034 | |||
| 1137 | Ga0495612_0043254 | |||
| 1138 | Ga0495655_0265306 | |||
| 1139 | Ga0495595_0005478 | |||
| 1140 | Ga0495595_0035368 | |||
| 1141 | Ga0495595_0269060 | |||
| 1142 | Ga0495619_0007907 | |||
| 1143 | Ga0495619_0011553 | |||
| 1144 | Ga0495619_0022976 | |||
| 1145 | Ga0495619_0203837 | |||
| 1146 | Ga0495619_0415310 | |||
| 1147 | Ga0500566_0082911 | |||
| 1148 | Ga0500657_088586 | |||
| 1149 | Ga0466962_0002540 | |||
| 1150 | Ga0466962_0005481 | |||
| 1151 | Ga0466962_0005901 | |||
| 1152 | Ga0466962_0008807 | |||
| 1153 | Ga0466962_0374425 | |||
| 1154 | Ga0530510_0334297 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fiu-assembly1.cif.gz_B | crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens | 0.9199 | 2 | 95 |
| 3lo3-assembly2.cif.gz_C | the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. | 0.9195 | 2 | 92 |
| 2fiu-assembly1.cif.gz_B | crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens | 0.8845 | 2 | 95 |
| 3lo3-assembly2.cif.gz_C | the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. | 0.8742 | 2 | 92 |
| 1si9-assembly1.cif.gz_A | boiling stable protein isolated from populus tremula | 0.738 | 2 | 93 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fiuB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9085 | 1 | 95 | 3.30.70.100 |
| 2fiuB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8906 | 1 | 95 | 3.30.70.100 |
| 3lo3U00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8493 | 1 | 90 | 3.30.70.100 |
| 3lo3U00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8163 | 1 | 90 | 3.30.70.100 |
| af_Q4DL38_2_104_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.707 | 1 | 95 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U9SCK0-F1-model_v4 | DUF1330 domain-containing protein | 0.9918 | 1 | 95 |
|
| AF-A0A258TXZ2-F1-model_v4 | deleted | 0.9868 | 2 | 95 |
|
| AF-A0A2S2CR32-F1-model_v4 | DUF1330 domain-containing protein | 0.9847 | 1 | 95 |
|
| AF-A0A2U9SCK0-F1-model_v4 | DUF1330 domain-containing protein | 0.9816 | 1 | 95 |
|
| AF-A0A0S8DG95-F1-model_v4 | DUF1330 domain-containing protein | 0.9805 | 1 | 95 |
|