F465522

General Info

Members Datasets Scaffolds Average Seq Length
576 341 1152 150

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0000056|Ga0373934_0000056_11924_12418
Length 164
Sequence MAGILPGLTPEGSPGMPAKNSKTESDGFTADERAAMKARAAELRAEGKKGAQKADGLQAVLDSIAKMAPADRALAERVHMTVTASSPELSPKTWYGMPAYANSDSKVVVFFQNAGKFNYRYSTLGFQDAANLDEGDMWPVTYALHKWSAAVEKKVAELVKAAVS

Samples

Sample ID Description Type Environment
1 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
180 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
190 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
191 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
192 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
196 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
197 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
209 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
216 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
217 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
218 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
240 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
241 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
248 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
257 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
258 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
290 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
304 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
305 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
306 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
307 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
308 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
309 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
310 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
311 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
312 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
313 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
317 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
318 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
323 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
327 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
328 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
329 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
332 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
333 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
334 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
337 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
338 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
339 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
340 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
341 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.26
Metatranscriptomes 0.87
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 9.2
Rhizosphere 88.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373934_0000056 3300035086 Bacteria 38785
2 JGI25406J46586_10016826 3300003203 Bacteria 3037
3 Ga0070683_100137570 3300005329 Bacteria 2314
4 Ga0070683_100306261 3300005329 Bacteria 1511
5 Ga0070690_100094800 3300005330 Bacteria 1970
6 Ga0068869_100003196 3300005334 Bacteria 10012
7 Ga0068869_100164548 3300005334 Bacteria 1729
8 Ga0070666_10703883 3300005335 Bacteria 741
9 Ga0070680_100308689 3300005336 Bacteria 1342
10 Ga0070680_100512670 3300005336 Bacteria 1027
11 Ga0070680_101180964 3300005336 Bacteria 662
12 Ga0068868_100016055 3300005338 Bacteria 5553
13 Ga0068868_100805618 3300005338 Bacteria 848
14 Ga0070660_100367439 3300005339 Bacteria 1186
15 Ga0070660_100519465 3300005339 Bacteria 992
16 Ga0070689_100037154 3300005340 Bacteria 3725
17 Ga0070687_100036430 3300005343 Bacteria 2452
18 Ga0070687_100067892 3300005343 Bacteria 1905
19 Ga0070661_100025328 3300005344 Bacteria 4262
20 Ga0070661_100466406 3300005344 Bacteria 1006
21 Ga0070692_10002312 3300005345 Bacteria 7343
22 Ga0070692_10049186 3300005345 Bacteria 2186
23 Ga0070668_100111807 3300005347 Bacteria 2175
24 Ga0070668_100342107 3300005347 Bacteria 1264
25 Ga0070669_100465433 3300005353 Bacteria 1044
26 Ga0070669_100565045 3300005353 Bacteria 950
27 Ga0070675_100002538 3300005354 Bacteria 13654
28 Ga0070675_100021982 3300005354 Bacteria 5097
29 Ga0070671_100841789 3300005355 Bacteria 800
30 Ga0070674_100004282 3300005356 Bacteria 8120
31 Ga0070674_100226162 3300005356 Bacteria 1458
32 Ga0070673_100166649 3300005364 Bacteria 1878
33 Ga0070673_100434610 3300005364 Bacteria 1179
34 Ga0070688_100061479 3300005365 Bacteria 2374
35 Ga0070659_100185179 3300005366 Bacteria 1710
36 Ga0070659_100946042 3300005366 Bacteria 754
37 Ga0070667_100630564 3300005367 Bacteria 989
38 Ga0070709_10001939 3300005434 Bacteria 11250
39 Ga0070714_100004513 3300005435 Bacteria 10492
40 Ga0070714_101386749 3300005435 Bacteria 686
41 Ga0070713_100001278 3300005436 Bacteria 16101
42 Ga0070713_101271722 3300005436 Bacteria 713
43 Ga0070710_10000194 3300005437 Bacteria 28422
44 Ga0070710_10877963 3300005437 Bacteria 646
45 Ga0070701_10023717 3300005438 Bacteria 2959
46 Ga0070701_10262041 3300005438 Bacteria 1048
47 Ga0070711_100127771 3300005439 Bacteria 1889
48 Ga0070711_100191105 3300005439 Bacteria 1573
49 Ga0070700_100037709 3300005441 Bacteria 2941
50 Ga0070708_100069528 3300005445 Bacteria 3166
51 Ga0070663_100001202 3300005455 Bacteria 14256
52 Ga0070678_100005952 3300005456 Bacteria 7099
53 Ga0070678_100219220 3300005456 Bacteria 1580
54 Ga0070678_100689186 3300005456 Bacteria 920
55 Ga0070662_100004420 3300005457 Bacteria 8886
56 Ga0070662_100014496 3300005457 Bacteria 5270
57 Ga0070681_10038622 3300005458 Bacteria 4786
58 Ga0070681_10061859 3300005458 Bacteria 3718
59 Ga0070681_10161223 3300005458 Bacteria 2167
60 Ga0070681_11196733 3300005458 Bacteria 682
61 Ga0068867_100170667 3300005459 Bacteria 1722
62 Ga0070685_10004141 3300005466 Bacteria 7317
63 Ga0070706_100004234 3300005467 Bacteria 13925
64 Ga0070706_100039852 3300005467 Bacteria 4336
65 Ga0070706_100046152 3300005467 Bacteria 4022
66 Ga0070707_100016732 3300005468 Bacteria 6883
67 Ga0070707_100061303 3300005468 Bacteria 3607
68 Ga0070707_100173289 3300005468 Bacteria 2103
69 Ga0070707_101090285 3300005468 Bacteria 764
70 Ga0070698_100001915 3300005471 Bacteria 23191
71 Ga0070698_100275065 3300005471 Bacteria 1615
72 Ga0070698_100588649 3300005471 Bacteria 1053
73 Ga0070699_100039845 3300005518 Bacteria 4068
74 Ga0070679_100158358 3300005530 Bacteria 2238
75 Ga0070679_100230484 3300005530 Bacteria 1812
76 Ga0070679_100297157 3300005530 Bacteria 1566
77 Ga0070684_100025845 3300005535 Bacteria 4939
78 Ga0070684_100060110 3300005535 Bacteria 3323
79 Ga0070697_100092336 3300005536 Bacteria 2504
80 Ga0068853_100232603 3300005539 Bacteria 1686
81 Ga0068853_100290766 3300005539 Bacteria 1508
82 Ga0070672_100055455 3300005543 Bacteria 3105
83 Ga0070686_100069428 3300005544 Bacteria 2301
84 Ga0070695_100733077 3300005545 Bacteria 787
85 Ga0070696_100004838 3300005546 Bacteria 9004
86 Ga0070696_100160254 3300005546 Bacteria 1657
87 Ga0070696_100457148 3300005546 Bacteria 1009
88 Ga0070693_100232410 3300005547 Bacteria 1214
89 Ga0070665_100627020 3300005548 Bacteria 1088
90 Ga0068855_100586243 3300005563 Bacteria 1204
91 Ga0070664_100311954 3300005564 Bacteria 1423
92 Ga0068857_100305772 3300005577 Bacteria 1466
93 Ga0068854_100110735 3300005578 Bacteria 2071
94 Ga0068854_100191047 3300005578 Bacteria 1604
95 Ga0070702_100054308 3300005615 Bacteria 2304
96 Ga0070702_100080579 3300005615 Bacteria 1948
97 Ga0070702_100134687 3300005615 Bacteria 1565
98 Ga0068852_100026679 3300005616 Bacteria 4701
99 Ga0068859_100020510 3300005617 Bacteria 6633
100 Ga0068864_100064645 3300005618 Bacteria 3173
101 Ga0068866_10117046 3300005718 Bacteria 1496
102 Ga0068861_100220934 3300005719 Bacteria 1601
103 Ga0068861_100299181 3300005719 Bacteria 1393
104 Ga0068870_10005231 3300005840 Bacteria 5646
105 Ga0068870_10196069 3300005840 Bacteria 1221
106 Ga0068858_100036576 3300005842 Bacteria 4552
107 Ga0068858_101016547 3300005842 Bacteria 813
108 Ga0068860_100672521 3300005843 Bacteria 1044
109 Ga0068862_100124067 3300005844 Bacteria 2279
110 Ga0068862_100767917 3300005844 Bacteria 939
111 Ga0081455_10175820 3300005937 Bacteria 1626
112 Ga0081540_1057468 3300005983 Bacteria 1881
113 Ga0081539_10000662 3300005985 Bacteria 69140
114 Ga0070717_10003455 3300006028 Bacteria 11310
115 Ga0070717_10081054 3300006028 Bacteria 2724
116 Ga0070717_10127242 3300006028 Bacteria 2188
117 Ga0070717_10200531 3300006028 Bacteria 1747
118 Ga0070717_10361286 3300006028 Bacteria 1300
119 Ga0070717_10713640 3300006028 Bacteria 911
120 Ga0070715_10737466 3300006163 Bacteria 592
121 Ga0070716_100015269 3300006173 Bacteria 3943
122 Ga0070716_100572963 3300006173 Bacteria 845
123 Ga0070712_100037415 3300006175 Bacteria 3308
124 Ga0070712_100096479 3300006175 Bacteria 2177
125 Ga0070712_100236939 3300006175 Bacteria 1452
126 Ga0070712_100350589 3300006175 Bacteria 1208
127 Ga0068871_100120409 3300006358 Bacteria 2216
128 Ga0075429_100113914 3300006880 Bacteria 2364
129 Ga0068865_100068070 3300006881 Bacteria 2516
130 Ga0068865_100080563 3300006881 Bacteria 2335
131 Ga0075436_100174167 3300006914 Bacteria 1519
132 Ga0097620_100020510 3300006931 Bacteria 6633
133 Ga0099794_10033939 3300007265 Bacteria 2401
134 Ga0105251_10354826 3300009011 Bacteria 670
135 Ga0105244_10158750 3300009036 Bacteria 1081
136 Ga0111539_10011814 3300009094 Bacteria 10947
137 Ga0111539_10011882 3300009094 Bacteria 10914
138 Ga0111539_12836996 3300009094 Bacteria 561
139 Ga0105245_10252719 3300009098 Bacteria 1713
140 Ga0105245_10502194 3300009098 Bacteria 1229
141 Ga0105247_10109694 3300009101 Bacteria 1774
142 Ga0114129_10049458 3300009147 Bacteria 5906
143 Ga0105243_10008017 3300009148 Bacteria 8109
144 Ga0105243_10393478 3300009148 Bacteria 1285
145 Ga0105241_10112029 3300009174 Bacteria 2186
146 Ga0105241_10160319 3300009174 Bacteria 1848
147 Ga0105242_10303016 3300009176 Bacteria 1459
148 Ga0105248_10022008 3300009177 Bacteria 7063
149 Ga0105237_10178235 3300009545 Bacteria 2126
150 Ga0105238_10110352 3300009551 Bacteria 2731
151 Ga0105238_10581651 3300009551 Bacteria 1126
152 Ga0105249_10048768 3300009553 Bacteria 3861
153 Ga0105239_10157678 3300010375 Bacteria 2536
154 Ga0105239_10339441 3300010375 Bacteria 1695
155 Ga0105239_12265470 3300010375 Bacteria 632
156 Ga0105239_12882854 3300010375 Bacteria 561
157 Ga0105246_10105570 3300011119 Bacteria 2059
158 Ga0157341_1009450 3300012494 Bacteria 813
159 Ga0157374_10255780 3300013296 Bacteria 1724
160 Ga0157374_10934526 3300013296 Bacteria 885
161 Ga0157378_10010824 3300013297 Bacteria 7975
162 Ga0157378_10559165 3300013297 Bacteria 1150
163 Ga0163162_10164195 3300013306 Bacteria 2344
164 Ga0157372_10143372 3300013307 Bacteria 2754
165 Ga0157372_12155377 3300013307 Bacteria 640
166 Ga0157375_10040183 3300013308 Bacteria 4507
167 Ga0157375_10187756 3300013308 Bacteria 2221
168 Ga0157375_10437709 3300013308 Bacteria 1473
169 Ga0157375_11026278 3300013308 Bacteria 963
170 Ga0163163_10038124 3300014325 Bacteria 4680
171 Ga0163163_10568505 3300014325 Bacteria 1197
172 Ga0157380_10012817 3300014326 Bacteria 6092
173 Ga0157380_10348342 3300014326 Bacteria 1385
174 Ga0157380_12424445 3300014326 Bacteria 590
175 Ga0182008_10034942 3300014497 Bacteria 2519
176 Ga0182008_10350331 3300014497 Bacteria 783
177 Ga0157377_10010379 3300014745 Bacteria 4605
178 Ga0206352_10179489 3300020078 Bacteria 808
179 Ga0206353_10733631 3300020082 Bacteria 750
180 Ga0206353_12040391 3300020082 Bacteria 535
181 Ga0213873_10258953 3300021358 Bacteria 553
182 Ga0213876_10121903 3300021384 Bacteria 1385
183 Ga0224712_10428779 3300022467 Bacteria 633
184 Ga0207653_10206357 3300025885 Bacteria 742
185 Ga0207692_10002251 3300025898 Bacteria 7388
186 Ga0207642_10533660 3300025899 Bacteria 722
187 Ga0207688_10009755 3300025901 Bacteria 5226
188 Ga0207688_10305867 3300025901 Bacteria 973
189 Ga0207647_10176784 3300025904 Bacteria 1242
190 Ga0207699_10023655 3300025906 Bacteria 3346
191 Ga0207645_10469427 3300025907 Bacteria 850
192 Ga0207643_10006270 3300025908 Bacteria 6364
193 Ga0207643_10187844 3300025908 Bacteria 1253
194 Ga0207643_10281865 3300025908 Bacteria 1031
195 Ga0207705_10414878 3300025909 Bacteria 1042
196 Ga0207684_10019564 3300025910 Bacteria 5791
197 Ga0207684_10618472 3300025910 Bacteria 924
198 Ga0207684_11308414 3300025910 Bacteria 597
199 Ga0207654_10051831 3300025911 Bacteria 2363
200 Ga0207707_10024427 3300025912 Bacteria 5288
201 Ga0207707_10123922 3300025912 Bacteria 2260
202 Ga0207707_10350580 3300025912 Bacteria 1272
203 Ga0207671_10763174 3300025914 Bacteria 768
204 Ga0207693_10001613 3300025915 Bacteria 19936
205 Ga0207693_10129487 3300025915 Bacteria 1984
206 Ga0207693_10199957 3300025915 Bacteria 1572
207 Ga0207663_10003121 3300025916 Bacteria 8043
208 Ga0207660_10201136 3300025917 Bacteria 1556
209 Ga0207660_10624835 3300025917 Bacteria 878
210 Ga0207660_10640437 3300025917 Bacteria 866
211 Ga0207662_10013172 3300025918 Bacteria 4621
212 Ga0207662_10358968 3300025918 Bacteria 980
213 Ga0207657_10069074 3300025919 Bacteria 3000
214 Ga0207657_10080918 3300025919 Bacteria 2729
215 Ga0207649_10105756 3300025920 Bacteria 1871
216 Ga0207652_10069277 3300025921 Bacteria 3063
217 Ga0207652_10288782 3300025921 Bacteria 1480
218 Ga0207652_10595111 3300025921 Bacteria 992
219 Ga0207646_10015229 3300025922 Bacteria 7276
220 Ga0207646_10218968 3300025922 Bacteria 1720
221 Ga0207681_10496329 3300025923 Bacteria 999
222 Ga0207694_10072492 3300025924 Bacteria 2693
223 Ga0207659_10180671 3300025926 Bacteria 1671
224 Ga0207659_10967895 3300025926 Bacteria 732
225 Ga0207687_10230687 3300025927 Bacteria 1462
226 Ga0207687_11241072 3300025927 Bacteria 641
227 Ga0207700_10000302 3300025928 Bacteria 29289
228 Ga0207700_10002752 3300025928 Bacteria 10132
229 Ga0207700_10308803 3300025928 Bacteria 1368
230 Ga0207700_10684240 3300025928 Bacteria 915
231 Ga0207664_10000458 3300025929 Bacteria 28967
232 Ga0207664_10605560 3300025929 Bacteria 984
233 Ga0207644_11234598 3300025931 Bacteria 628
234 Ga0207690_10228774 3300025932 Bacteria 1426
235 Ga0207690_10272714 3300025932 Bacteria 1315
236 Ga0207706_10008825 3300025933 Bacteria 9279
237 Ga0207706_10011696 3300025933 Bacteria 8003
238 Ga0207709_10074655 3300025935 Bacteria 2165
239 Ga0207709_10210576 3300025935 Bacteria 1395
240 Ga0207670_10072536 3300025936 Bacteria 2384
241 Ga0207669_10040289 3300025937 Bacteria 2708
242 Ga0207669_10254402 3300025937 Bacteria 1310
243 Ga0207704_10084423 3300025938 Bacteria 2064
244 Ga0207665_10000535 3300025939 Bacteria 25580
245 Ga0207665_10031056 3300025939 Bacteria 3534
246 Ga0207665_10601248 3300025939 Bacteria 859
247 Ga0207691_10042019 3300025940 Bacteria 4217
248 Ga0207689_10018674 3300025942 Bacteria 5850
249 Ga0207689_10023276 3300025942 Bacteria 5201
250 Ga0207661_10585543 3300025944 Bacteria 1023
251 Ga0207679_10416576 3300025945 Bacteria 1185
252 Ga0207679_11026308 3300025945 Bacteria 756
253 Ga0207651_10112951 3300025960 Bacteria 2043
254 Ga0207651_11738230 3300025960 Bacteria 562
255 Ga0207712_10019934 3300025961 Bacteria 4386
256 Ga0207668_10983778 3300025972 Bacteria 753
257 Ga0207668_11229750 3300025972 Bacteria 673
258 Ga0207640_10597863 3300025981 Bacteria 933
259 Ga0207640_11073600 3300025981 Bacteria 711
260 Ga0207658_10739676 3300025986 Bacteria 890
261 Ga0207677_10276574 3300026023 Bacteria 1376
262 Ga0207703_10091385 3300026035 Bacteria 2560
263 Ga0207678_10012706 3300026067 Bacteria 7395
264 Ga0207708_10014960 3300026075 Bacteria 5812
265 Ga0207702_11485240 3300026078 Bacteria 671
266 Ga0207641_12380376 3300026088 Bacteria 529
267 Ga0207648_10022547 3300026089 Bacteria 5652
268 Ga0207648_10393574 3300026089 Bacteria 1254
269 Ga0207676_10114640 3300026095 Bacteria 2261
270 Ga0207676_11055893 3300026095 Bacteria 802
271 Ga0207674_10012109 3300026116 Bacteria 9657
272 Ga0207675_100036870 3300026118 Bacteria 4561
273 Ga0207675_100402538 3300026118 Bacteria 1349
274 Ga0207675_100963900 3300026118 Bacteria 871
275 Ga0207683_10059161 3300026121 Bacteria 3366
276 Ga0207683_10901738 3300026121 Bacteria 821
277 Ga0207698_10046046 3300026142 Bacteria 3290
278 Ga0207698_10129957 3300026142 Bacteria 2150
279 Ga0209969_1040755 3300027360 Bacteria 721
280 Ga0209588_1174715 3300027671 Bacteria 675
281 Ga0209974_10048176 3300027876 Bacteria 1428
282 Ga0207428_10280520 3300027907 Bacteria 1237
283 Ga0268266_11245943 3300028379 Bacteria 719
284 Ga0268265_10762694 3300028380 Bacteria 940
285 Ga0307515_10366953 3300028794 Bacteria 1078
286 Ga0265338_10127695 3300028800 Bacteria 2014
287 Ga0265340_10007101 3300031247 Bacteria 6105
288 Ga0307513_10463464 3300031456 Bacteria 990
289 Ga0307408_100034888 3300031548 Bacteria 3527
290 Ga0307408_100948295 3300031548 Bacteria 790
291 Ga0265313_10104747 3300031595 Bacteria 1251
292 Ga0307508_10000538 3300031616 Bacteria 45016
293 Ga0265314_10389311 3300031711 Bacteria 757
294 Ga0265342_10307373 3300031712 Bacteria 834
295 Ga0316576_10024214 3300031727 Bacteria 4237
296 Ga0316576_10228712 3300031727 Bacteria 1398
297 Ga0316578_10115577 3300031728 Bacteria 1612
298 Ga0316578_10219845 3300031728 Bacteria 1142
299 Ga0307410_10177193 3300031852 Bacteria 1611
300 Ga0307406_10041185 3300031901 Bacteria 2877
301 Ga0307407_10007262 3300031903 Bacteria 5007
302 Ga0307407_10127477 3300031903 Bacteria 1623
303 Ga0307409_100000751 3300031995 Bacteria 14618
304 Ga0307409_100424793 3300031995 Bacteria 1276
305 Ga0307409_100452141 3300031995 Bacteria 1240
306 Ga0307416_100026604 3300032002 Bacteria 4266
307 Ga0307416_100711264 3300032002 Bacteria 1094
308 Ga0307416_100815702 3300032002 Bacteria 1029
309 Ga0307416_102161218 3300032002 Bacteria 658
310 Ga0307414_10163278 3300032004 Bacteria 1772
311 Ga0307414_10198754 3300032004 Bacteria 1629
312 Ga0307411_10042677 3300032005 Bacteria 2896
313 Ga0307411_10244198 3300032005 Bacteria 1408
314 Ga0307415_100033260 3300032126 Bacteria 3346
315 Ga0307415_100080963 3300032126 Bacteria 2318
316 Ga0307415_100246279 3300032126 Bacteria 1449
317 Ga0307415_100322396 3300032126 Bacteria 1289
318 Ga0316580_10286327 3300032139 Bacteria 511
319 Ga0373926_0051606 3300035083 Bacteria 1485
320 Ga0373944_0038776 3300035089 Bacteria 1464
321 Ga0373944_0216144 3300035089 Bacteria 698
322 Ga0373952_0032401 3300035092 Bacteria 1167
323 Ga0373923_0021461 3300035111 Bacteria 2520
324 Ga0373953_0000631 3300035117 Bacteria 9760
325 Ga0373953_0012562 3300035117 Bacteria 3003
326 Ga0373954_0000792 3300035118 Bacteria 12211
327 Ga0373954_0083949 3300035118 Bacteria 1524
328 Ga0373956_0000191 3300035119 Bacteria 23567
329 Ga0373956_0238931 3300035119 Bacteria 863
330 Ga0373957_0000071 3300035120 Bacteria 25001
331 Ga0373943_0138169 3300035170 Bacteria 1310
332 Ga0373946_0229324 3300035171 Bacteria 899
333 Ga0373955_0000050 3300035172 Bacteria 45664
334 Ga0373955_0266724 3300035172 Bacteria 1028
335 Ga0316574_0003688 3300035398 Bacteria 7934
336 Ga0316574_0406386 3300035398 Bacteria 857
337 Ga0373924_0000037 3300035410 Bacteria 33504
338 Ga0373924_0023143 3300035410 Bacteria 2434
339 Ga0373931_0339721 3300035691 Bacteria 937
340 Ga0373935_0086826 3300035692 Bacteria 2042
341 Ga0373935_0195719 3300035692 Bacteria 1394
342 Ga0373933_0000149 3300035724 Bacteria 45676
343 Ga0373933_0006041 3300035724 Bacteria 6587
344 Ga0373933_0432130 3300035724 Bacteria 860
345 Ga0373947_0286700 3300035725 Bacteria 1095
346 Ga0373937_0000319 3300036401 Bacteria 45685
347 Ga0373937_0447763 3300036401 Bacteria 1226
348 Ga0316582_0813973 3300036647 Bacteria 640
349 Ga0316584_0030672 3300036712 Bacteria 3972
350 Ga0373925_0234664 3300037068 Bacteria 1467
351 Ga0373925_1079182 3300037068 Bacteria 661
352 Ga0436364_0108586 3300037853 Bacteria 2822
353 Ga0436365_1537362 3300039437 Bacteria 1273
354 Ga0436360_0852536 3300039438 Bacteria 865
355 Ga0436362_1126798 3300039453 Bacteria 633
356 Ga0451843_0742647 3300041509 Bacteria 1002
357 Ga0439446_0172403 3300042156 Bacteria 720
358 Ga0466969_0133991 3300044656 Bacteria 1148
359 Ga0466965_0275047 3300044683 Bacteria 908
360 Ga0466966_0004854 3300044684 Bacteria 8846
361 Ga0466961_0011689 3300044693 Bacteria 5611
362 Ga0466961_0269616 3300044693 Bacteria 1043
363 Ga0466963_0029073 3300044694 Bacteria 3554
364 Ga0466963_0183968 3300044694 Bacteria 1459
365 Ga0466963_0331804 3300044694 Bacteria 1071
366 Ga0466964_0027649 3300044706 Bacteria 2228
367 Ga0466971_0095977 3300044719 Bacteria 1360
368 Ga0466971_0148130 3300044719 Bacteria 1095
369 Ga0466957_0016109 3300044842 Bacteria 4369
370 Ga0466960_0026671 3300044901 Bacteria 2627
371 Ga0466959_0011023 3300045049 Bacteria 6488
372 Ga0466958_0013468 3300045836 Bacteria 4656
373 Ga0466958_0075757 3300045836 Bacteria 2064
374 Ga0466958_0154816 3300045836 Bacteria 1446
375 Ga0466958_0412350 3300045836 Bacteria 873
376 Ga0466967_0017328 3300045976 Bacteria 5715
377 Ga0466967_2527836 3300045976 Bacteria 508
378 Ga0495592_0000255 3300046454 Bacteria 45685
379 Ga0495592_0024424 3300046454 Bacteria 4595
380 Ga0495592_0663560 3300046454 Bacteria 630
381 Ga0495629_0124438 3300046459 Bacteria 1796
382 Ga0495641_0096921 3300046461 Bacteria 1316
383 Ga0495651_0000199 3300046462 Bacteria 45685
384 Ga0495651_0141858 3300046462 Bacteria 1741
385 Ga0495651_0284649 3300046462 Bacteria 1115
386 Ga0495653_0027537 3300046463 Bacteria 4547
387 Ga0495653_0129712 3300046463 Bacteria 1786
388 Ga0495653_0224063 3300046463 Bacteria 1262
389 Ga0495580_0167285 3300046472 Bacteria 1520
390 Ga0495582_0157825 3300046473 Bacteria 1289
391 Ga0495582_0484678 3300046473 Bacteria 715
392 Ga0495639_0068978 3300046475 Bacteria 1630
393 Ga0495585_0330554 3300046492 Bacteria 744
394 Ga0495594_0491019 3300046499 Bacteria 698
395 Ga0495608_0000499 3300046511 Bacteria 27122
396 Ga0495608_0440062 3300046511 Bacteria 794
397 Ga0495618_0247363 3300046514 Bacteria 1119
398 Ga0495628_0000282 3300046516 Bacteria 45645
399 Ga0495628_0026126 3300046516 Bacteria 4767
400 Ga0495630_0041543 3300046517 Bacteria 3434
401 Ga0495630_0175558 3300046517 Bacteria 1633
402 Ga0495666_0113809 3300046526 Bacteria 1270
403 Ga0495652_0001352 3300046529 Bacteria 27313
404 Ga0495652_0080203 3300046529 Bacteria 2696
405 Ga0495652_0289486 3300046529 Bacteria 1196
406 Ga0495665_0218513 3300046531 Bacteria 985
407 Ga0495640_0149526 3300046533 Bacteria 1501
408 Ga0495586_0173825 3300046535 Bacteria 1217
409 Ga0495587_0000189 3300046536 Bacteria 45681
410 Ga0495587_0004431 3300046536 Bacteria 9254
411 Ga0495587_0069870 3300046536 Bacteria 2044
412 Ga0495587_0231210 3300046536 Bacteria 1042
413 Ga0495645_0033567 3300046543 Bacteria 3744
414 Ga0495645_0115775 3300046543 Bacteria 1893
415 Ga0495645_0347785 3300046543 Bacteria 956
416 Ga0495622_0260156 3300046557 Bacteria 762
417 Ga0495667_0000136 3300046559 Bacteria 50731
418 Ga0495667_0146799 3300046559 Bacteria 1519
419 Ga0495634_0020872 3300046642 Bacteria 4640
420 Ga0495635_0044709 3300046663 Bacteria 3054
421 Ga0495635_0180353 3300046663 Bacteria 1435
422 Ga0495657_0000290 3300046675 Bacteria 45685
423 Ga0495657_0044978 3300046675 Bacteria 2998
424 Ga0495657_0189798 3300046675 Bacteria 1257
425 Ga0495599_0000282 3300046678 Bacteria 31243
426 Ga0495599_0172253 3300046678 Bacteria 1335
427 Ga0495599_0674499 3300046678 Bacteria 597
428 Ga0495623_0000368 3300046679 Bacteria 29559
429 Ga0495646_0042882 3300046680 Bacteria 2774
430 Ga0495658_0017752 3300046683 Bacteria 3683
431 Ga0495613_0013663 3300046689 Bacteria 6024
432 Ga0495613_0097139 3300046689 Bacteria 2130
433 Ga0495624_0223491 3300046690 Bacteria 1141
434 Ga0495589_0407611 3300046794 Bacteria 624
435 Ga0495600_0005802 3300046809 Bacteria 7462
436 Ga0495600_0273255 3300046809 Bacteria 1071
437 Ga0495581_0007986 3300047315 Bacteria 6129
438 Ga0495604_0000280 3300047317 Bacteria 45685
439 Ga0495604_0026570 3300047317 Bacteria 4608
440 Ga0495604_0065333 3300047317 Bacteria 2770
441 Ga0495674_0076148 3300047319 Bacteria 2886
442 Ga0495674_0532798 3300047319 Bacteria 936
443 Ga0495676_0337139 3300047321 Bacteria 1010
444 Ga0495680_0000430 3300047322 Bacteria 47076
445 Ga0495680_0054593 3300047322 Bacteria 3101
446 Ga0495680_0408198 3300047322 Bacteria 936
447 Ga0495675_0000347 3300047444 Bacteria 32584
448 Ga0495684_0090596 3300047471 Bacteria 2316
449 Ga0495684_0254420 3300047471 Bacteria 1276
450 Ga0495593_0226178 3300047673 Bacteria 938
451 Ga0495602_0000297 3300048088 Bacteria 45689
452 Ga0495602_0075164 3300048088 Bacteria 2868
453 Ga0495602_0261280 3300048088 Bacteria 1284
454 Ga0495602_1029073 3300048088 Bacteria 542
455 Ga0495614_0019814 3300048089 Bacteria 2910
456 Ga0496100_0020294 3300048903 Bacteria 3981
457 Ga0496100_0034586 3300048903 Bacteria 3173
458 Ga0496101_0133265 3300048904 Bacteria 1888
459 Ga0496101_0171108 3300048904 Bacteria 1670
460 Ga0496101_0325756 3300048904 Bacteria 1206
461 Ga0496101_0345245 3300048904 Bacteria 1169
462 Ga0496102_0012944 3300048905 Bacteria 7224
463 Ga0496102_0013353 3300048905 Bacteria 7114
464 Ga0496102_0191784 3300048905 Bacteria 1926
465 Ga0496102_0503492 3300048905 Bacteria 1133
466 Ga0496103_0015326 3300048906 Bacteria 4560
467 Ga0496103_0070220 3300048906 Bacteria 2191
468 Ga0496103_0297044 3300048906 Bacteria 1039
469 Ga0496103_0472019 3300048906 Bacteria 804
470 Ga0496104_0520441 3300048907 Bacteria 1101
471 Ga0496104_0609673 3300048907 Bacteria 1002
472 Ga0496104_0973179 3300048907 Bacteria 753
473 Ga0496105_0042778 3300048908 Bacteria 3735
474 Ga0496105_0463442 3300048908 Bacteria 999
475 Ga0496106_0489008 3300048909 Bacteria 989
476 Ga0496107_0033409 3300048910 Bacteria 3680
477 Ga0496107_0074697 3300048910 Bacteria 2466
478 Ga0496107_0577006 3300048910 Bacteria 832
479 Ga0496108_0134783 3300048911 Bacteria 2124
480 Ga0496108_0216029 3300048911 Bacteria 1665
481 Ga0496108_0244686 3300048911 Bacteria 1560
482 Ga0496109_0137203 3300048912 Bacteria 2286
483 Ga0496109_0188691 3300048912 Bacteria 1936
484 Ga0496109_0487038 3300048912 Bacteria 1164
485 Ga0496109_0605827 3300048912 Bacteria 1032
486 Ga0496109_0882554 3300048912 Bacteria 832
487 Ga0496109_0929570 3300048912 Bacteria 808
488 Ga0496109_1087157 3300048912 Bacteria 737
489 Ga0496110_0031893 3300048913 Bacteria 4548
490 Ga0496110_0119700 3300048913 Bacteria 2372
491 Ga0496110_1186902 3300048913 Bacteria 672
492 Ga0496111_0051697 3300048914 Bacteria 2966
493 Ga0496111_0184490 3300048914 Bacteria 1551
494 Ga0496111_0238612 3300048914 Bacteria 1350
495 Ga0496111_0342596 3300048914 Bacteria 1106
496 Ga0496112_0041806 3300048915 Bacteria 4485
497 Ga0496112_0573019 3300048915 Bacteria 1062
498 Ga0496113_0119960 3300048916 Bacteria 2055
499 Ga0496114_0059346 3300048917 Bacteria 3196
500 Ga0496114_0069987 3300048917 Bacteria 2946
501 Ga0496114_0070496 3300048917 Bacteria 2936
502 Ga0496114_0085210 3300048917 Bacteria 2676
503 Ga0496114_0980137 3300048917 Bacteria 728
504 Ga0496115_0141939 3300048918 Bacteria 1982
505 Ga0496115_0221486 3300048918 Bacteria 1561
506 Ga0496115_0481727 3300048918 Bacteria 999
507 Ga0496115_0566795 3300048918 Bacteria 906
508 Ga0496115_0844611 3300048918 Bacteria 710
509 Ga0496126_0199027 3300048929 Bacteria 1693
510 Ga0501291_004451 3300049514 Bacteria 1791
511 Ga0501032_0051153 3300049569 Bacteria 2786
512 Ga0501033_0098346 3300049570 Bacteria 2137
513 Ga0501034_0296032 3300049571 Bacteria 1556
514 Ga0501036_0103004 3300049572 Bacteria 2414
515 Ga0501037_0161139 3300049573 Bacteria 1599
516 Ga0501039_0077414 3300049575 Bacteria 2586
517 Ga0501040_0041391 3300049576 Bacteria 3138
518 Ga0501041_0022134 3300049577 Bacteria 3806
519 Ga0501042_0069845 3300049578 Bacteria 2512
520 Ga0501042_0213540 3300049578 Bacteria 1392
521 Ga0501043_0020906 3300049579 Bacteria 5133
522 Ga0501046_0093200 3300049580 Bacteria 2315
523 Ga0501048_0054398 3300049582 Bacteria 2843
524 Ga0501048_0585487 3300049582 Bacteria 801
525 Ga0501067_0007514 3300049583 Bacteria 6056
526 Ga0501067_0227669 3300049583 Bacteria 1038
527 Ga0501068_0244283 3300049584 Bacteria 1143
528 Ga0501069_0009187 3300049585 Bacteria 5217
529 Ga0501069_0098699 3300049585 Bacteria 1657
530 Ga0501069_0219709 3300049585 Bacteria 1104
531 Ga0501069_0872836 3300049585 Bacteria 547
532 Ga0501070_0060693 3300049586 Bacteria 3134
533 Ga0501071_0018111 3300049587 Bacteria 4871
534 Ga0501072_0126240 3300049588 Bacteria 2038
535 Ga0501073_0132593 3300049589 Bacteria 1727
536 Ga0501074_0027646 3300049590 Bacteria 4113
537 Ga0501074_0744639 3300049590 Bacteria 691
538 Ga0501075_0080011 3300049591 Bacteria 2473
539 Ga0501076_0036732 3300049592 Bacteria 3839
540 Ga0501076_0541471 3300049592 Bacteria 960
541 Ga0501077_0023283 3300049593 Bacteria 3927
542 Ga0501079_0002481 3300049741 Bacteria 13400
543 Ga0501080_0127778 3300049742 Bacteria 2353
544 Ga0501081_0015757 3300049743 Bacteria 4990
545 Ga0501083_0086000 3300049744 Bacteria 2080
546 Ga0501271_053922 3300049768 Bacteria 551
547 Ga0501035_0048520 3300049822 Bacteria 3808
548 Ga0501044_0468702 3300049823 Bacteria 1164
549 Ga0501045_0013319 3300049824 Bacteria 5806
550 nmdc:mga03683_130194_c1 3300050489 Bacteria 1125
551 nmdc:mga0yw44_92259_c1 3300050492 Bacteria 1916
552 nmdc:mga05p37_54403_c1 3300050507 Bacteria 4924
553 nmdc:mga08y16_1246192_c1 3300050511 Bacteria 713
554 nmdc:mga0n895_1317134_c1 3300050512 Bacteria 693
555 nmdc:mga0n895_527581_c1 3300050512 Bacteria 1188
556 nmdc:mga0rr50_1002517_c1 3300050513 Bacteria 711
557 nmdc:mga0rr50_915780_c1 3300050513 Bacteria 747
558 nmdc:mga08x19_115050_c1 3300050514 Bacteria 1798
559 nmdc:mga0a205_408363_c1 3300050515 Bacteria 1221
560 Ga0495601_0047709 3300053077 Bacteria 2697
561 Ga0495601_0173319 3300053077 Bacteria 1410
562 Ga0495595_0004575 3300053084 Bacteria 5563
563 Ga0495595_0136974 3300053084 Bacteria 1199
564 Ga0495595_0387564 3300053084 Bacteria 707
565 Ga0495619_0052301 3300053085 Bacteria 2700
566 Ga0501084_0019305 3300054114 Bacteria 5679
567 Ga0501084_0351571 3300054114 Bacteria 1245
568 Ga0587083_0181363 3300059505 Bacteria 589
569 Ga0501082_0163601 3300060353 Bacteria 1933
570 Ga0530510_0012402 3300061734 Bacteria 5988
571 Ga0530510_0024942 3300061734 Bacteria 4273
572 2623585900 2622736626 Bacteria 7181580
573 2643850070 2643221567 Bacteria 4163945
574 2644136072 2643221624 Bacteria 4384879
575 2772647039 2772190715 Bacteria 6959372
576 2819425682 2818991318 Bacteria 5266538
577 Ga0373934_0000056
578 JGI25406J46586_10016826
579 Ga0070683_100137570
580 Ga0070683_100306261
581 Ga0070690_100094800
582 Ga0068869_100003196
583 Ga0068869_100164548
584 Ga0070666_10703883
585 Ga0070680_100308689
586 Ga0070680_100512670
587 Ga0070680_101180964
588 Ga0068868_100016055
589 Ga0068868_100805618
590 Ga0070660_100367439
591 Ga0070660_100519465
592 Ga0070689_100037154
593 Ga0070687_100036430
594 Ga0070687_100067892
595 Ga0070661_100025328
596 Ga0070661_100466406
597 Ga0070692_10002312
598 Ga0070692_10049186
599 Ga0070668_100111807
600 Ga0070668_100342107
601 Ga0070669_100465433
602 Ga0070669_100565045
603 Ga0070675_100002538
604 Ga0070675_100021982
605 Ga0070671_100841789
606 Ga0070674_100004282
607 Ga0070674_100226162
608 Ga0070673_100166649
609 Ga0070673_100434610
610 Ga0070688_100061479
611 Ga0070659_100185179
612 Ga0070659_100946042
613 Ga0070667_100630564
614 Ga0070709_10001939
615 Ga0070714_100004513
616 Ga0070714_101386749
617 Ga0070713_100001278
618 Ga0070713_101271722
619 Ga0070710_10000194
620 Ga0070710_10877963
621 Ga0070701_10023717
622 Ga0070701_10262041
623 Ga0070711_100127771
624 Ga0070711_100191105
625 Ga0070700_100037709
626 Ga0070708_100069528
627 Ga0070663_100001202
628 Ga0070678_100005952
629 Ga0070678_100219220
630 Ga0070678_100689186
631 Ga0070662_100004420
632 Ga0070662_100014496
633 Ga0070681_10038622
634 Ga0070681_10061859
635 Ga0070681_10161223
636 Ga0070681_11196733
637 Ga0068867_100170667
638 Ga0070685_10004141
639 Ga0070706_100004234
640 Ga0070706_100039852
641 Ga0070706_100046152
642 Ga0070707_100016732
643 Ga0070707_100061303
644 Ga0070707_100173289
645 Ga0070707_101090285
646 Ga0070698_100001915
647 Ga0070698_100275065
648 Ga0070698_100588649
649 Ga0070699_100039845
650 Ga0070679_100158358
651 Ga0070679_100230484
652 Ga0070679_100297157
653 Ga0070684_100025845
654 Ga0070684_100060110
655 Ga0070697_100092336
656 Ga0068853_100232603
657 Ga0068853_100290766
658 Ga0070672_100055455
659 Ga0070686_100069428
660 Ga0070695_100733077
661 Ga0070696_100004838
662 Ga0070696_100160254
663 Ga0070696_100457148
664 Ga0070693_100232410
665 Ga0070665_100627020
666 Ga0068855_100586243
667 Ga0070664_100311954
668 Ga0068857_100305772
669 Ga0068854_100110735
670 Ga0068854_100191047
671 Ga0070702_100054308
672 Ga0070702_100080579
673 Ga0070702_100134687
674 Ga0068852_100026679
675 Ga0068859_100020510
676 Ga0068864_100064645
677 Ga0068866_10117046
678 Ga0068861_100220934
679 Ga0068861_100299181
680 Ga0068870_10005231
681 Ga0068870_10196069
682 Ga0068858_100036576
683 Ga0068858_101016547
684 Ga0068860_100672521
685 Ga0068862_100124067
686 Ga0068862_100767917
687 Ga0081455_10175820
688 Ga0081540_1057468
689 Ga0081539_10000662
690 Ga0070717_10003455
691 Ga0070717_10081054
692 Ga0070717_10127242
693 Ga0070717_10200531
694 Ga0070717_10361286
695 Ga0070717_10713640
696 Ga0070715_10737466
697 Ga0070716_100015269
698 Ga0070716_100572963
699 Ga0070712_100037415
700 Ga0070712_100096479
701 Ga0070712_100236939
702 Ga0070712_100350589
703 Ga0068871_100120409
704 Ga0075429_100113914
705 Ga0068865_100068070
706 Ga0068865_100080563
707 Ga0075436_100174167
708 Ga0097620_100020510
709 Ga0099794_10033939
710 Ga0105251_10354826
711 Ga0105244_10158750
712 Ga0111539_10011814
713 Ga0111539_10011882
714 Ga0111539_12836996
715 Ga0105245_10252719
716 Ga0105245_10502194
717 Ga0105247_10109694
718 Ga0114129_10049458
719 Ga0105243_10008017
720 Ga0105243_10393478
721 Ga0105241_10112029
722 Ga0105241_10160319
723 Ga0105242_10303016
724 Ga0105248_10022008
725 Ga0105237_10178235
726 Ga0105238_10110352
727 Ga0105238_10581651
728 Ga0105249_10048768
729 Ga0105239_10157678
730 Ga0105239_10339441
731 Ga0105239_12265470
732 Ga0105239_12882854
733 Ga0105246_10105570
734 Ga0157341_1009450
735 Ga0157374_10255780
736 Ga0157374_10934526
737 Ga0157378_10010824
738 Ga0157378_10559165
739 Ga0163162_10164195
740 Ga0157372_10143372
741 Ga0157372_12155377
742 Ga0157375_10040183
743 Ga0157375_10187756
744 Ga0157375_10437709
745 Ga0157375_11026278
746 Ga0163163_10038124
747 Ga0163163_10568505
748 Ga0157380_10012817
749 Ga0157380_10348342
750 Ga0157380_12424445
751 Ga0182008_10034942
752 Ga0182008_10350331
753 Ga0157377_10010379
754 Ga0206352_10179489
755 Ga0206353_10733631
756 Ga0206353_12040391
757 Ga0213873_10258953
758 Ga0213876_10121903
759 Ga0224712_10428779
760 Ga0207653_10206357
761 Ga0207692_10002251
762 Ga0207642_10533660
763 Ga0207688_10009755
764 Ga0207688_10305867
765 Ga0207647_10176784
766 Ga0207699_10023655
767 Ga0207645_10469427
768 Ga0207643_10006270
769 Ga0207643_10187844
770 Ga0207643_10281865
771 Ga0207705_10414878
772 Ga0207684_10019564
773 Ga0207684_10618472
774 Ga0207684_11308414
775 Ga0207654_10051831
776 Ga0207707_10024427
777 Ga0207707_10123922
778 Ga0207707_10350580
779 Ga0207671_10763174
780 Ga0207693_10001613
781 Ga0207693_10129487
782 Ga0207693_10199957
783 Ga0207663_10003121
784 Ga0207660_10201136
785 Ga0207660_10624835
786 Ga0207660_10640437
787 Ga0207662_10013172
788 Ga0207662_10358968
789 Ga0207657_10069074
790 Ga0207657_10080918
791 Ga0207649_10105756
792 Ga0207652_10069277
793 Ga0207652_10288782
794 Ga0207652_10595111
795 Ga0207646_10015229
796 Ga0207646_10218968
797 Ga0207681_10496329
798 Ga0207694_10072492
799 Ga0207659_10180671
800 Ga0207659_10967895
801 Ga0207687_10230687
802 Ga0207687_11241072
803 Ga0207700_10000302
804 Ga0207700_10002752
805 Ga0207700_10308803
806 Ga0207700_10684240
807 Ga0207664_10000458
808 Ga0207664_10605560
809 Ga0207644_11234598
810 Ga0207690_10228774
811 Ga0207690_10272714
812 Ga0207706_10008825
813 Ga0207706_10011696
814 Ga0207709_10074655
815 Ga0207709_10210576
816 Ga0207670_10072536
817 Ga0207669_10040289
818 Ga0207669_10254402
819 Ga0207704_10084423
820 Ga0207665_10000535
821 Ga0207665_10031056
822 Ga0207665_10601248
823 Ga0207691_10042019
824 Ga0207689_10018674
825 Ga0207689_10023276
826 Ga0207661_10585543
827 Ga0207679_10416576
828 Ga0207679_11026308
829 Ga0207651_10112951
830 Ga0207651_11738230
831 Ga0207712_10019934
832 Ga0207668_10983778
833 Ga0207668_11229750
834 Ga0207640_10597863
835 Ga0207640_11073600
836 Ga0207658_10739676
837 Ga0207677_10276574
838 Ga0207703_10091385
839 Ga0207678_10012706
840 Ga0207708_10014960
841 Ga0207702_11485240
842 Ga0207641_12380376
843 Ga0207648_10022547
844 Ga0207648_10393574
845 Ga0207676_10114640
846 Ga0207676_11055893
847 Ga0207674_10012109
848 Ga0207675_100036870
849 Ga0207675_100402538
850 Ga0207675_100963900
851 Ga0207683_10059161
852 Ga0207683_10901738
853 Ga0207698_10046046
854 Ga0207698_10129957
855 Ga0209969_1040755
856 Ga0209588_1174715
857 Ga0209974_10048176
858 Ga0207428_10280520
859 Ga0268266_11245943
860 Ga0268265_10762694
861 Ga0307515_10366953
862 Ga0265338_10127695
863 Ga0265340_10007101
864 Ga0307513_10463464
865 Ga0307408_100034888
866 Ga0307408_100948295
867 Ga0265313_10104747
868 Ga0307508_10000538
869 Ga0265314_10389311
870 Ga0265342_10307373
871 Ga0316576_10024214
872 Ga0316576_10228712
873 Ga0316578_10115577
874 Ga0316578_10219845
875 Ga0307410_10177193
876 Ga0307406_10041185
877 Ga0307407_10007262
878 Ga0307407_10127477
879 Ga0307409_100000751
880 Ga0307409_100424793
881 Ga0307409_100452141
882 Ga0307416_100026604
883 Ga0307416_100711264
884 Ga0307416_100815702
885 Ga0307416_102161218
886 Ga0307414_10163278
887 Ga0307414_10198754
888 Ga0307411_10042677
889 Ga0307411_10244198
890 Ga0307415_100033260
891 Ga0307415_100080963
892 Ga0307415_100246279
893 Ga0307415_100322396
894 Ga0316580_10286327
895 Ga0373926_0051606
896 Ga0373944_0038776
897 Ga0373944_0216144
898 Ga0373952_0032401
899 Ga0373923_0021461
900 Ga0373953_0000631
901 Ga0373953_0012562
902 Ga0373954_0000792
903 Ga0373954_0083949
904 Ga0373956_0000191
905 Ga0373956_0238931
906 Ga0373957_0000071
907 Ga0373943_0138169
908 Ga0373946_0229324
909 Ga0373955_0000050
910 Ga0373955_0266724
911 Ga0316574_0003688
912 Ga0316574_0406386
913 Ga0373924_0000037
914 Ga0373924_0023143
915 Ga0373931_0339721
916 Ga0373935_0086826
917 Ga0373935_0195719
918 Ga0373933_0000149
919 Ga0373933_0006041
920 Ga0373933_0432130
921 Ga0373947_0286700
922 Ga0373937_0000319
923 Ga0373937_0447763
924 Ga0316582_0813973
925 Ga0316584_0030672
926 Ga0373925_0234664
927 Ga0373925_1079182
928 Ga0436364_0108586
929 Ga0436365_1537362
930 Ga0436360_0852536
931 Ga0436362_1126798
932 Ga0451843_0742647
933 Ga0439446_0172403
934 Ga0466969_0133991
935 Ga0466965_0275047
936 Ga0466966_0004854
937 Ga0466961_0011689
938 Ga0466961_0269616
939 Ga0466963_0029073
940 Ga0466963_0183968
941 Ga0466963_0331804
942 Ga0466964_0027649
943 Ga0466971_0095977
944 Ga0466971_0148130
945 Ga0466957_0016109
946 Ga0466960_0026671
947 Ga0466959_0011023
948 Ga0466958_0013468
949 Ga0466958_0075757
950 Ga0466958_0154816
951 Ga0466958_0412350
952 Ga0466967_0017328
953 Ga0466967_2527836
954 Ga0495592_0000255
955 Ga0495592_0024424
956 Ga0495592_0663560
957 Ga0495629_0124438
958 Ga0495641_0096921
959 Ga0495651_0000199
960 Ga0495651_0141858
961 Ga0495651_0284649
962 Ga0495653_0027537
963 Ga0495653_0129712
964 Ga0495653_0224063
965 Ga0495580_0167285
966 Ga0495582_0157825
967 Ga0495582_0484678
968 Ga0495639_0068978
969 Ga0495585_0330554
970 Ga0495594_0491019
971 Ga0495608_0000499
972 Ga0495608_0440062
973 Ga0495618_0247363
974 Ga0495628_0000282
975 Ga0495628_0026126
976 Ga0495630_0041543
977 Ga0495630_0175558
978 Ga0495666_0113809
979 Ga0495652_0001352
980 Ga0495652_0080203
981 Ga0495652_0289486
982 Ga0495665_0218513
983 Ga0495640_0149526
984 Ga0495586_0173825
985 Ga0495587_0000189
986 Ga0495587_0004431
987 Ga0495587_0069870
988 Ga0495587_0231210
989 Ga0495645_0033567
990 Ga0495645_0115775
991 Ga0495645_0347785
992 Ga0495622_0260156
993 Ga0495667_0000136
994 Ga0495667_0146799
995 Ga0495634_0020872
996 Ga0495635_0044709
997 Ga0495635_0180353
998 Ga0495657_0000290
999 Ga0495657_0044978
1000 Ga0495657_0189798
1001 Ga0495599_0000282
1002 Ga0495599_0172253
1003 Ga0495599_0674499
1004 Ga0495623_0000368
1005 Ga0495646_0042882
1006 Ga0495658_0017752
1007 Ga0495613_0013663
1008 Ga0495613_0097139
1009 Ga0495624_0223491
1010 Ga0495589_0407611
1011 Ga0495600_0005802
1012 Ga0495600_0273255
1013 Ga0495581_0007986
1014 Ga0495604_0000280
1015 Ga0495604_0026570
1016 Ga0495604_0065333
1017 Ga0495674_0076148
1018 Ga0495674_0532798
1019 Ga0495676_0337139
1020 Ga0495680_0000430
1021 Ga0495680_0054593
1022 Ga0495680_0408198
1023 Ga0495675_0000347
1024 Ga0495684_0090596
1025 Ga0495684_0254420
1026 Ga0495593_0226178
1027 Ga0495602_0000297
1028 Ga0495602_0075164
1029 Ga0495602_0261280
1030 Ga0495602_1029073
1031 Ga0495614_0019814
1032 Ga0496100_0020294
1033 Ga0496100_0034586
1034 Ga0496101_0133265
1035 Ga0496101_0171108
1036 Ga0496101_0325756
1037 Ga0496101_0345245
1038 Ga0496102_0012944
1039 Ga0496102_0013353
1040 Ga0496102_0191784
1041 Ga0496102_0503492
1042 Ga0496103_0015326
1043 Ga0496103_0070220
1044 Ga0496103_0297044
1045 Ga0496103_0472019
1046 Ga0496104_0520441
1047 Ga0496104_0609673
1048 Ga0496104_0973179
1049 Ga0496105_0042778
1050 Ga0496105_0463442
1051 Ga0496106_0489008
1052 Ga0496107_0033409
1053 Ga0496107_0074697
1054 Ga0496107_0577006
1055 Ga0496108_0134783
1056 Ga0496108_0216029
1057 Ga0496108_0244686
1058 Ga0496109_0137203
1059 Ga0496109_0188691
1060 Ga0496109_0487038
1061 Ga0496109_0605827
1062 Ga0496109_0882554
1063 Ga0496109_0929570
1064 Ga0496109_1087157
1065 Ga0496110_0031893
1066 Ga0496110_0119700
1067 Ga0496110_1186902
1068 Ga0496111_0051697
1069 Ga0496111_0184490
1070 Ga0496111_0238612
1071 Ga0496111_0342596
1072 Ga0496112_0041806
1073 Ga0496112_0573019
1074 Ga0496113_0119960
1075 Ga0496114_0059346
1076 Ga0496114_0069987
1077 Ga0496114_0070496
1078 Ga0496114_0085210
1079 Ga0496114_0980137
1080 Ga0496115_0141939
1081 Ga0496115_0221486
1082 Ga0496115_0481727
1083 Ga0496115_0566795
1084 Ga0496115_0844611
1085 Ga0496126_0199027
1086 Ga0501291_004451
1087 Ga0501032_0051153
1088 Ga0501033_0098346
1089 Ga0501034_0296032
1090 Ga0501036_0103004
1091 Ga0501037_0161139
1092 Ga0501039_0077414
1093 Ga0501040_0041391
1094 Ga0501041_0022134
1095 Ga0501042_0069845
1096 Ga0501042_0213540
1097 Ga0501043_0020906
1098 Ga0501046_0093200
1099 Ga0501048_0054398
1100 Ga0501048_0585487
1101 Ga0501067_0007514
1102 Ga0501067_0227669
1103 Ga0501068_0244283
1104 Ga0501069_0009187
1105 Ga0501069_0098699
1106 Ga0501069_0219709
1107 Ga0501069_0872836
1108 Ga0501070_0060693
1109 Ga0501071_0018111
1110 Ga0501072_0126240
1111 Ga0501073_0132593
1112 Ga0501074_0027646
1113 Ga0501074_0744639
1114 Ga0501075_0080011
1115 Ga0501076_0036732
1116 Ga0501076_0541471
1117 Ga0501077_0023283
1118 Ga0501079_0002481
1119 Ga0501080_0127778
1120 Ga0501081_0015757
1121 Ga0501083_0086000
1122 Ga0501271_053922
1123 Ga0501035_0048520
1124 Ga0501044_0468702
1125 Ga0501045_0013319
1126 nmdc:mga03683_130194_c1
1127 nmdc:mga0yw44_92259_c1
1128 nmdc:mga05p37_54403_c1
1129 nmdc:mga08y16_1246192_c1
1130 nmdc:mga0n895_1317134_c1
1131 nmdc:mga0n895_527581_c1
1132 nmdc:mga0rr50_1002517_c1
1133 nmdc:mga0rr50_915780_c1
1134 nmdc:mga08x19_115050_c1
1135 nmdc:mga0a205_408363_c1
1136 Ga0495601_0047709
1137 Ga0495601_0173319
1138 Ga0495595_0004575
1139 Ga0495595_0136974
1140 Ga0495595_0387564
1141 Ga0495619_0052301
1142 Ga0501084_0019305
1143 Ga0501084_0351571
1144 Ga0587083_0181363
1145 Ga0501082_0163601
1146 Ga0530510_0012402
1147 Ga0530510_0024942
1148 2623585900
1149 2643850070
1150 2644136072
1151 2772647039
1152 2819425682

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zxu-assembly1.cif.gz_A x-ray structure of protein from arabidopsis thaliana at5g01750 0.6751 74 111
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6712 42 141
5cwf-assembly4.cif.gz_D crystal structure of de novo designed helical repeat protein dhr8 0.5699 13 73
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.5534 42 141
2i8d-assembly1.cif.gz_B crystal structure of an uncharacterized conserved protein of cog5646 (zp_00384875.1) from lactobacillus casei atcc 334 at 1.69 a resolution 0.5272 47 144
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7505 43 149 3.90.1150.200
af_A0A1D6M2U7_21_185_2.40.160.200 Mainly Beta;Beta Barrel;Porin;LURP1-related 0.7074 74 113 2.40.160.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7027 43 149 3.90.1150.200
af_Q9ZUF7_2_189_2.40.160.200 Mainly Beta;Beta Barrel;Porin;LURP1-related 0.6981 82 111 2.40.160.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6611 43 142 3.90.1150.200
ID Description Score Start End GO Terms
AF-A0A846RBR6-F1-model_v4 deleted 1.001 12 149
AF-A0A518WQN6-F1-model_v4 DUF1801 domain-containing protein 0.9989 22 149
AF-A0A3C1E0B5-F1-model_v4 YdhG-like domain-containing protein 0.9917 19 149
AF-A0A1V4ZD30-F1-model_v4 Uncharacterized protein 0.9887 38 149
AF-F0T5S3-F1-model_v4 Uncharacterized protein 0.9882 43 149

Map