F465514

General Info

Members Datasets Scaffolds Average Seq Length
576 317 472 276

Family's Representative Sequence

Representative Sequence 3300025294|Ga0209025_1005630|Ga0209025_10056308
Length 261
Sequence MISMQHIKLRREERQILDDITLHMNEGEHWVILGRNGSGKTTLLEMMTGYMFPSSGQIDVLGNRYGQCDIREVRKKIGYISQSLMEKLTLRDPVWEVVATGEYGFLRFYQEIPEEVVAKAHSLIEEMNLGHVANNLLGTLSQGERKKIMLARALMADPQILILDEPCAGLDLYEREKFLDQINILKNRDIALVYVTHHLEEIVPLFTHVALIHQGKLVAAGTKESVLTPEILKQAYEVPLSLEWVDGRPWIRVQGLEVNNR

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
3 2547132424 Nocardia nova SH22a Isolate Unclassified
4 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
5 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
6 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
7 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
8 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
9 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
10 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
11 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
12 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
13 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
14 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
15 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
16 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
17 2643221692 Nocardia sp. Root136 Isolate Unclassified
18 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
19 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
20 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
21 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
22 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
23 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
24 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
25 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
26 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
27 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
28 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
29 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
30 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
31 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
32 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
33 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
34 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
35 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
36 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
37 2818991459 Paenibacillus sp. 597 Isolate Unclassified
38 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
39 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
40 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
41 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
42 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
43 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
44 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
45 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
46 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
47 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
48 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
49 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
50 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
51 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
52 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
53 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
54 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
55 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
56 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
57 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
58 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
59 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
60 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
61 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
62 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
63 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
64 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
65 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
66 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
67 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
68 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
69 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
70 2920879853 Kocuria salina CV6 Isolate Unclassified
71 2922554459 Rhodococcus sp. 66b Isolate Unclassified
72 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
73 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
74 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
75 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
76 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
77 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
78 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
79 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
80 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
81 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
82 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
83 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
84 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
85 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
86 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
87 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
88 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
89 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
90 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
91 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
92 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
93 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
94 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
95 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
96 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
97 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
98 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
99 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
100 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
101 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
102 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
103 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
104 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
105 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
106 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
107 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
108 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
109 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
110 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
111 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
112 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
113 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
114 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
115 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
116 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
117 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
118 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
119 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
120 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
121 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
122 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
123 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
124 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
125 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
126 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
127 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
128 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
129 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
130 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
131 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
132 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
133 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
134 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
139 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
156 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
159 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
187 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
188 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
189 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
190 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
204 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
205 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
209 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
210 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
211 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
212 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
213 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
214 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
215 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
216 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
217 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
218 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
219 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
220 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
221 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
222 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
223 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
236 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
247 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
267 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
270 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
294 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
300 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
301 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
302 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
303 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
304 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
305 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
306 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
307 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
308 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
309 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
310 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
311 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
312 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
313 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
314 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
315 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
316 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
317 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 81.6
Metatranscriptomes 0.35
Isolates 18.06

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 11.63
Nodule 0.17
Rhizoplane 10.94
Rhizosphere 54.86
Stem 0
Stem Tuber 0.17
Unclassified 22.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1003870 3300000545 Bacteria 1057
2 JGI24034J26672_10008529 3300002239 Bacteria 1498
3 JGI24751J29686_10004841 3300002459 Bacteria 2740
4 JGI25162J39368_1010067 3300002737 Bacteria 1220
5 rootH2_10047012 3300003320 Bacteria 7156
6 Ga0055538_1000080 3300003751 Bacteria 85194
7 Ga0070658_10080545 3300005327 Bacteria 2675
8 Ga0070683_100046768 3300005329 Bacteria 3999
9 Ga0070668_100011153 3300005347 Bacteria 6690
10 Ga0070668_100014542 3300005347 Bacteria 5880
11 Ga0070668_100117223 3300005347 Bacteria 2124
12 Ga0070671_100001509 3300005355 Bacteria 17434
13 Ga0070667_100000042 3300005367 Bacteria 168902
14 Ga0070667_100051191 3300005367 Bacteria 3482
15 Ga0070710_10001225 3300005437 Bacteria 12157
16 Ga0070663_100025826 3300005455 Bacteria 3971
17 Ga0070706_100614104 3300005467 Bacteria 1010
18 Ga0070686_100198675 3300005544 Bacteria 1436
19 Ga0070665_100138495 3300005548 Bacteria 2437
20 Ga0068859_100002953 3300005617 Bacteria 17252
21 Ga0068859_100003293 3300005617 Bacteria 16424
22 Ga0068861_100176270 3300005719 Bacteria 1776
23 Ga0068861_100246726 3300005719 Bacteria 1521
24 Ga0068863_100006121 3300005841 Bacteria 11800
25 Ga0068863_100006656 3300005841 Bacteria 11340
26 Ga0068858_100020513 3300005842 Bacteria 6177
27 Ga0068860_100000020 3300005843 Bacteria 283324
28 Ga0068860_100017670 3300005843 Bacteria 6949
29 Ga0068860_100095371 3300005843 Bacteria 2836
30 Ga0068862_100002277 3300005844 Bacteria 17181
31 Ga0081455_10002484 3300005937 Bacteria 21907
32 Ga0081455_10203258 3300005937 Bacteria 1482
33 Ga0081455_10231314 3300005937 Bacteria 1364
34 Ga0081538_10092152 3300005981 Bacteria 1561
35 Ga0070717_10070845 3300006028 Bacteria 2906
36 Ga0070717_10211539 3300006028 Bacteria 1702
37 Ga0075365_10009336 3300006038 Bacteria 5629
38 Ga0075363_100000083 3300006048 Bacteria 20120
39 Ga0075363_100002132 3300006048 Bacteria 7954
40 Ga0075363_100004597 3300006048 Bacteria 6057
41 Ga0075363_100005241 3300006048 Bacteria 5747
42 Ga0075363_100150373 3300006048 Bacteria 1314
43 Ga0075363_100217723 3300006048 Bacteria 1094
44 Ga0075364_10005547 3300006051 Bacteria 7349
45 Ga0075364_10020980 3300006051 Bacteria 4114
46 Ga0075364_10056426 3300006051 Bacteria 2571
47 Ga0075364_10060600 3300006051 Bacteria 2481
48 Ga0075362_10049852 3300006177 Bacteria 1871
49 Ga0075362_10093269 3300006177 Bacteria 1400
50 Ga0075362_10212721 3300006177 Bacteria 943
51 Ga0075367_10007896 3300006178 Bacteria 5481
52 Ga0075369_10000536 3300006186 Bacteria 12013
53 Ga0075369_10001130 3300006186 Bacteria 8980
54 Ga0075369_10009254 3300006186 Bacteria 3821
55 Ga0075369_10012899 3300006186 Bacteria 3306
56 Ga0075366_10029066 3300006195 Bacteria 3246
57 Ga0075370_10006858 3300006353 Bacteria 5761
58 Ga0075370_10037112 3300006353 Bacteria 2739
59 Ga0075370_10072047 3300006353 Bacteria 1978
60 Ga0075428_100006651 3300006844 Bacteria 12854
61 Ga0075430_100012698 3300006846 Bacteria 7177
62 Ga0075431_100020973 3300006847 Bacteria 6678
63 Ga0075431_100037080 3300006847 Bacteria 5023
64 Ga0097620_100002953 3300006931 Bacteria 17252
65 Ga0097620_100003293 3300006931 Bacteria 16424
66 Ga0105250_10061376 3300009092 Bacteria 1511
67 Ga0105240_10246964 3300009093 Bacteria 2066
68 Ga0105245_10195781 3300009098 Bacteria 1939
69 Ga0105247_10000009 3300009101 Bacteria 385991
70 Ga0105247_10003886 3300009101 Bacteria 9653
71 Ga0105247_10187383 3300009101 Bacteria 1384
72 Ga0114129_10030572 3300009147 Bacteria 7620
73 Ga0105243_10000872 3300009148 Bacteria 28529
74 Ga0105248_10003175 3300009177 Bacteria 18211
75 Ga0105237_10062171 3300009545 Bacteria 3733
76 Ga0105238_10138552 3300009551 Bacteria 2410
77 Ga0105249_10000011 3300009553 Bacteria 292812
78 Ga0105239_10016200 3300010375 Bacteria 8247
79 Ga0105239_10216901 3300010375 Bacteria 2145
80 Ga0157369_10012727 3300013105 Bacteria 9540
81 Ga0157369_10374512 3300013105 Bacteria 1478
82 Ga0157369_10433435 3300013105 Bacteria 1362
83 Ga0157374_10315267 3300013296 Bacteria 1549
84 Ga0163162_10191545 3300013306 Bacteria 2173
85 Ga0157372_10000057 3300013307 Bacteria 125915
86 Ga0163163_10018241 3300014325 Bacteria 6564
87 Ga0163163_10358107 3300014325 Bacteria 1515
88 Ga0157379_10106218 3300014968 Bacteria 2520
89 Ga0157379_10267003 3300014968 Bacteria 1556
90 Ga0163161_10258602 3300017792 Bacteria 1359
91 Ga0206356_10925867 3300020070 Bacteria 2083
92 Ga0206353_11694794 3300020082 Bacteria 2574
93 Ga0213876_10146521 3300021384 Bacteria 1255
94 Ga0209784_100077 3300025224 Bacteria 139569
95 Ga0209566_101547 3300025225 Bacteria 6242
96 Ga0209437_100324 3300025233 Bacteria 61046
97 Ga0209675_1005060 3300025291 Bacteria 5638
98 Ga0209025_1005630 3300025294 Bacteria 10109
99 Ga0207692_10010508 3300025898 Bacteria 3905
100 Ga0207710_10000014 3300025900 Bacteria 408072
101 Ga0207710_10011381 3300025900 Bacteria 3746
102 Ga0207647_10200356 3300025904 Bacteria 1155
103 Ga0207695_10137390 3300025913 Bacteria 2396
104 Ga0207671_10046040 3300025914 Bacteria 3227
105 Ga0207671_10072560 3300025914 Bacteria 2569
106 Ga0207694_10141031 3300025924 Bacteria 1938
107 Ga0207694_10520420 3300025924 Bacteria 997
108 Ga0207650_10223561 3300025925 Bacteria 1516
109 Ga0207687_10302660 3300025927 Bacteria 1288
110 Ga0207664_10012219 3300025929 Bacteria 6136
111 Ga0207664_10204184 3300025929 Bacteria 1707
112 Ga0207644_10034636 3300025931 Bacteria 3534
113 Ga0207644_10146880 3300025931 Bacteria 1821
114 Ga0207709_10036745 3300025935 Bacteria 2905
115 Ga0207665_10015923 3300025939 Bacteria 4936
116 Ga0207711_10002575 3300025941 Bacteria 16131
117 Ga0207712_10000020 3300025961 Bacteria 292796
118 Ga0207668_10004729 3300025972 Bacteria 8009
119 Ga0207668_10083842 3300025972 Bacteria 2320
120 Ga0207668_10235880 3300025972 Bacteria 1477
121 Ga0207658_10000055 3300025986 Bacteria 125014
122 Ga0207703_10014605 3300026035 Bacteria 6128
123 Ga0207703_10047802 3300026035 Bacteria 3451
124 Ga0207703_10221580 3300026035 Bacteria 1691
125 Ga0207678_10001525 3300026067 Bacteria 21244
126 Ga0207678_10084973 3300026067 Bacteria 2706
127 Ga0207678_10402779 3300026067 Bacteria 1185
128 Ga0207702_10605874 3300026078 Bacteria 1075
129 Ga0207641_10001152 3300026088 Bacteria 26560
130 Ga0207641_10001298 3300026088 Bacteria 24828
131 Ga0207641_10027447 3300026088 Bacteria 4701
132 Ga0207674_10185622 3300026116 Bacteria 2030
133 Ga0207675_100078383 3300026118 Bacteria 3096
134 Ga0207675_100137067 3300026118 Bacteria 2323
135 Ga0268266_10002500 3300028379 Bacteria 19615
136 Ga0268266_10010404 3300028379 Bacteria 8131
137 Ga0268266_10013099 3300028379 Bacteria 7151
138 Ga0268266_10216720 3300028379 Bacteria 1758
139 Ga0268265_10000004 3300028380 Bacteria 648376
140 Ga0268264_10000024 3300028381 Bacteria 470081
141 Ga0268264_10019520 3300028381 Bacteria 5538
142 Ga0268264_10095391 3300028381 Bacteria 2574
143 Ga0307511_10065324 3300030521 Bacteria 2725
144 Ga0307512_10128169 3300030522 Bacteria 1603
145 Ga0316176_1065654 3300030732 Bacteria 6662
146 Ga0314311_1191344 3300030733 Bacteria 5532
147 Ga0265327_10000195 3300031251 Bacteria 128364
148 Ga0265327_10054975 3300031251 Bacteria 2058
149 Ga0307513_10000001 3300031456 Bacteria 1660464
150 Ga0307509_10083772 3300031507 Bacteria 3286
151 Ga0307413_10011921 3300031824 Bacteria 4301
152 Ga0307413_10056993 3300031824 Bacteria 2387
153 Ga0307413_10183580 3300031824 Bacteria 1494
154 Ga0307410_10029034 3300031852 Bacteria 3517
155 Ga0307406_10189625 3300031901 Bacteria 1504
156 Ga0307409_100026673 3300031995 Bacteria 4079
157 Ga0307409_100148324 3300031995 Bacteria 2032
158 Ga0307416_100038454 3300032002 Bacteria 3692
159 Ga0307411_10058732 3300032005 Bacteria 2547
160 Ga0307510_10045330 3300033180 Bacteria 4748
161 Ga0373956_0014403 3300035119 Bacteria 3303
162 Ga0373935_0058656 3300035692 Bacteria 2459
163 Ga0436364_0123211 3300037853 Bacteria 8481
164 Ga0436364_0911230 3300037853 Bacteria 3411
165 Ga0400485_17256 3300038735 Bacteria 30888
166 Ga0400488_17360 3300038741 Bacteria 4679
167 Ga0400486_26437 3300038742 Bacteria 51148
168 Ga0436365_0091649 3300039437 Bacteria 1253
169 Ga0436365_0098557 3300039437 Bacteria 2403
170 Ga0436365_0571433 3300039437 Bacteria 4595
171 Ga0436365_1140633 3300039437 Bacteria 4288
172 Ga0436365_1479739 3300039437 Bacteria 73434
173 Ga0436365_1640556 3300039437 Bacteria 6256
174 Ga0436363_0589925 3300039450 Bacteria 2337
175 Ga0436362_0233102 3300039453 Bacteria 74564
176 Ga0439461_0004625 3300041410 Bacteria 2306
177 Ga0439466_0002627 3300041411 Bacteria 7031
178 Ga0439466_0003756 3300041411 Bacteria 5862
179 Ga0439465_0028099 3300041413 Bacteria 1782
180 Ga0439465_0034849 3300041413 Bacteria 1612
181 Ga0451806_125850 3300041462 Bacteria 1451
182 Ga0439431_0001978 3300041997 Bacteria 4547
183 Ga0439433_0017456 3300041999 Bacteria 1594
184 Ga0439445_0000297 3300042004 Bacteria 9656
185 Ga0439449_0007726 3300042007 Bacteria 4084
186 Ga0439434_0015500 3300042435 Bacteria 2274
187 Ga0439434_0040879 3300042435 Bacteria 1424
188 Ga0439435_0008559 3300042436 Bacteria 2375
189 Ga0466969_0003311 3300044656 Bacteria 8568
190 Ga0466969_0064378 3300044656 Bacteria 1775
191 Ga0466972_0006692 3300044658 Bacteria 5784
192 Ga0466972_0016967 3300044658 Bacteria 3642
193 Ga0466972_0061243 3300044658 Bacteria 1805
194 Ga0466972_0081370 3300044658 Bacteria 1542
195 Ga0466972_0089605 3300044658 Bacteria 1459
196 Ga0466965_0001686 3300044683 Bacteria 9056
197 Ga0466965_0003040 3300044683 Bacteria 7296
198 Ga0466965_0012970 3300044683 Bacteria 3925
199 Ga0466965_0052965 3300044683 Bacteria 2016
200 Ga0466966_0012961 3300044684 Bacteria 5520
201 Ga0466966_0038429 3300044684 Bacteria 3085
202 Ga0466961_0000997 3300044693 Bacteria 17464
203 Ga0466961_0027789 3300044693 Bacteria 3638
204 Ga0466961_0035403 3300044693 Bacteria 3206
205 Ga0466961_0106502 3300044693 Bacteria 1765
206 Ga0466961_0197876 3300044693 Bacteria 1244
207 Ga0466963_0002115 3300044694 Bacteria 10979
208 Ga0466963_0013047 3300044694 Bacteria 5095
209 Ga0466963_0050055 3300044694 Bacteria 2765
210 Ga0466963_0053554 3300044694 Bacteria 2679
211 Ga0466963_0070648 3300044694 Bacteria 2349
212 Ga0466963_0247749 3300044694 Bacteria 1250
213 Ga0466963_0264386 3300044694 Bacteria 1208
214 Ga0466968_0004191 3300044735 Bacteria 5372
215 Ga0466968_0006279 3300044735 Bacteria 4473
216 Ga0466968_0006916 3300044735 Bacteria 4294
217 Ga0466968_0014662 3300044735 Bacteria 3100
218 Ga0466970_0049766 3300044765 Bacteria 2234
219 Ga0466970_0058863 3300044765 Bacteria 2057
220 Ga0466970_0235971 3300044765 Bacteria 1023
221 Ga0466957_0001718 3300044842 Bacteria 11522
222 Ga0466957_0008290 3300044842 Bacteria 5907
223 Ga0466957_0062093 3300044842 Bacteria 2294
224 Ga0466957_0220372 3300044842 Bacteria 1252
225 Ga0466960_0000175 3300044901 Bacteria 21921
226 Ga0466960_0001664 3300044901 Bacteria 8139
227 Ga0466960_0004904 3300044901 Bacteria 5264
228 Ga0466960_0037935 3300044901 Bacteria 2263
229 Ga0466960_0088171 3300044901 Bacteria 1577
230 Ga0466959_0002409 3300045049 Bacteria 11937
231 Ga0466959_0010817 3300045049 Bacteria 6541
232 Ga0466959_0046294 3300045049 Bacteria 3201
233 Ga0466959_0086935 3300045049 Bacteria 2249
234 Ga0466959_0131210 3300045049 Bacteria 1776
235 Ga0466959_0174882 3300045049 Unclassified 1504
236 Ga0466959_0222416 3300045049 Bacteria 1309
237 Ga0466959_0300773 3300045049 Bacteria 1099
238 Ga0466958_0003953 3300045836 Bacteria 7776
239 Ga0466958_0009168 3300045836 Bacteria 5503
240 Ga0466958_0098944 3300045836 Bacteria 1811
241 Ga0466958_0239648 3300045836 Bacteria 1159
242 Ga0466967_0003181 3300045976 Bacteria 10589
243 Ga0466967_0007276 3300045976 Bacteria 7967
244 Ga0466967_0022814 3300045976 Bacteria 5117
245 Ga0466967_0026481 3300045976 Bacteria 4804
246 Ga0466967_0034810 3300045976 Bacteria 4280
247 Ga0466967_0035445 3300045976 Bacteria 4248
248 Ga0466967_0036571 3300045976 Bacteria 4193
249 Ga0466967_0050945 3300045976 Bacteria 3626
250 Ga0466967_0204905 3300045976 Bacteria 1869
251 Ga0495603_0049154 3300046455 Bacteria 2511
252 Ga0495629_0014161 3300046459 Bacteria 5745
253 Ga0495638_0005895 3300046460 Bacteria 9004
254 Ga0495638_0024351 3300046460 Bacteria 3947
255 Ga0495641_0018720 3300046461 Bacteria 3566
256 Ga0495594_0020881 3300046499 Bacteria 3492
257 Ga0495607_0100782 3300046501 Bacteria 1547
258 Ga0495640_0085277 3300046533 Bacteria 2093
259 Ga0495667_0232611 3300046559 Bacteria 1175
260 Ga0495588_0124689 3300046674 Bacteria 1358
261 Ga0495658_0095629 3300046683 Bacteria 1766
262 Ga0495624_0057333 3300046690 Bacteria 2449
263 Ga0495581_0031098 3300047315 Bacteria 3093
264 Ga0495674_0067579 3300047319 Bacteria 3096
265 Ga0495672_0051481 3300047320 Bacteria 2425
266 Ga0495672_0109180 3300047320 Bacteria 1487
267 Ga0495683_0000668 3300047323 Bacteria 25356
268 Ga0495681_0104151 3300047470 Bacteria 1237
269 Ga0495686_0002065 3300047472 Bacteria 19761
270 Ga0495593_0022395 3300047673 Bacteria 3520
271 Ga0496100_0001549 3300048903 Bacteria 11292
272 Ga0496100_0001596 3300048903 Bacteria 11183
273 Ga0496100_0004179 3300048903 Bacteria 7613
274 Ga0496100_0017871 3300048903 Bacteria 4196
275 Ga0496100_0156950 3300048903 Bacteria 1628
276 Ga0496101_0000094 3300048904 Bacteria 95577
277 Ga0496101_0000507 3300048904 Bacteria 24425
278 Ga0496101_0004143 3300048904 Bacteria 9080
279 Ga0496101_0008392 3300048904 Bacteria 6750
280 Ga0496102_0000014 3300048905 Bacteria 310241
281 Ga0496102_0000030 3300048905 Bacteria 221326
282 Ga0496102_0000207 3300048905 Bacteria 79241
283 Ga0496102_0000248 3300048905 Bacteria 70597
284 Ga0496102_0002893 3300048905 Bacteria 14556
285 Ga0496102_0007781 3300048905 Bacteria 9159
286 Ga0496102_0077137 3300048905 Bacteria 3067
287 Ga0496102_0151733 3300048905 Bacteria 2177
288 Ga0496102_0377670 3300048905 Bacteria 1334
289 Ga0496103_0000004 3300048906 Bacteria 510080
290 Ga0496103_0000068 3300048906 Bacteria 121996
291 Ga0496103_0000268 3300048906 Bacteria 49469
292 Ga0496103_0003281 3300048906 Bacteria 9913
293 Ga0496103_0155160 3300048906 Bacteria 1467
294 Ga0496104_0004249 3300048907 Bacteria 12439
295 Ga0496104_0061581 3300048907 Bacteria 3558
296 Ga0496105_0004863 3300048908 Bacteria 10144
297 Ga0496105_0190193 3300048908 Bacteria 1679
298 Ga0496105_0401943 3300048908 Bacteria 1087
299 Ga0496106_0002441 3300048909 Bacteria 13853
300 Ga0496106_0010215 3300048909 Bacteria 6937
301 Ga0496106_0054918 3300048909 Bacteria 3010
302 Ga0496106_0067973 3300048909 Bacteria 2717
303 Ga0496107_0006654 3300048910 Bacteria 7957
304 Ga0496107_0020769 3300048910 Bacteria 4641
305 Ga0496107_0030884 3300048910 Bacteria 3820
306 Ga0496107_0142583 3300048910 Bacteria 1771
307 Ga0496107_0265101 3300048910 Bacteria 1278
308 Ga0496108_0009018 3300048911 Bacteria 8082
309 Ga0496108_0025579 3300048911 Bacteria 4866
310 Ga0496108_0036021 3300048911 Bacteria 4115
311 Ga0496108_0204225 3300048911 Bacteria 1715
312 Ga0496108_0413611 3300048911 Bacteria 1178
313 Ga0496109_0000098 3300048912 Bacteria 90126
314 Ga0496109_0012064 3300048912 Bacteria 7445
315 Ga0496109_0074217 3300048912 Bacteria 3126
316 Ga0496109_0221735 3300048912 Bacteria 1778
317 Ga0496110_0000051 3300048913 Bacteria 58778
318 Ga0496110_0010261 3300048913 Bacteria 7611
319 Ga0496110_0030444 3300048913 Bacteria 4653
320 Ga0496110_0036979 3300048913 Bacteria 4242
321 Ga0496110_0167847 3300048913 Bacteria 1991
322 Ga0496110_0425435 3300048913 Bacteria 1211
323 Ga0496111_0271554 3300048914 Bacteria 1258
324 Ga0496112_0010437 3300048915 Bacteria 8424
325 Ga0496112_0108569 3300048915 Bacteria 2745
326 Ga0496113_0065929 3300048916 Bacteria 2741
327 Ga0496114_0000070 3300048917 Bacteria 73843
328 Ga0496114_0002313 3300048917 Bacteria 14515
329 Ga0496114_0301321 3300048917 Bacteria 1415
330 Ga0496114_0397184 3300048917 Bacteria 1221
331 Ga0496115_0035900 3300048918 Bacteria 3924
332 Ga0496116_0000069 3300048919 Bacteria 252643
333 Ga0496116_0000152 3300048919 Bacteria 141311
334 Ga0496116_0002694 3300048919 Bacteria 18332
335 Ga0496116_0005088 3300048919 Bacteria 12356
336 Ga0496116_0027524 3300048919 Bacteria 4138
337 Ga0496116_0055986 3300048919 Bacteria 2587
338 Ga0496117_0000003 3300048920 Bacteria 1881097
339 Ga0496117_0000059 3300048920 Bacteria 260163
340 Ga0496117_0000280 3300048920 Bacteria 95337
341 Ga0496118_0000001 3300048921 Bacteria 1881100
342 Ga0496118_0000061 3300048921 Bacteria 220889
343 Ga0496118_0003322 3300048921 Bacteria 20385
344 Ga0496118_0005391 3300048921 Bacteria 14559
345 Ga0496118_0015775 3300048921 Bacteria 6969
346 Ga0496118_0201670 3300048921 Bacteria 1177
347 Ga0496119_0001073 3300048922 Bacteria 34598
348 Ga0496119_0001310 3300048922 Bacteria 30642
349 Ga0496119_0002966 3300048922 Bacteria 18024
350 Ga0496119_0003778 3300048922 Bacteria 15490
351 Ga0496119_0023721 3300048922 Bacteria 4339
352 Ga0496120_0001262 3300048923 Bacteria 31801
353 Ga0496120_0005452 3300048923 Bacteria 10146
354 Ga0496120_0007894 3300048923 Bacteria 7841
355 Ga0496120_0019822 3300048923 Bacteria 4290
356 Ga0496120_0020936 3300048923 Bacteria 4142
357 Ga0496121_0000016 3300048924 Bacteria 562911
358 Ga0496121_0000032 3300048924 Bacteria 378997
359 Ga0496121_0001795 3300048924 Bacteria 34679
360 Ga0496121_0010190 3300048924 Bacteria 10643
361 Ga0496121_0039210 3300048924 Bacteria 4179
362 Ga0496121_0047763 3300048924 Bacteria 3649
363 Ga0496121_0062151 3300048924 Bacteria 3061
364 Ga0496121_0075162 3300048924 Bacteria 2700
365 Ga0496122_0000470 3300048925 Bacteria 84015
366 Ga0496122_0019343 3300048925 Bacteria 6225
367 Ga0496122_0020321 3300048925 Bacteria 6007
368 Ga0496122_0192506 3300048925 Bacteria 1202
369 Ga0496123_0005802 3300048926 Bacteria 12262
370 Ga0496123_0006607 3300048926 Bacteria 11200
371 Ga0496123_0031801 3300048926 Bacteria 3832
372 Ga0496124_0000015 3300048927 Bacteria 460700
373 Ga0496124_0007754 3300048927 Bacteria 11341
374 Ga0496124_0025976 3300048927 Bacteria 5290
375 Ga0496124_0040003 3300048927 Bacteria 4058
376 Ga0496125_0000021 3300048928 Bacteria 460688
377 Ga0496125_0001104 3300048928 Bacteria 41482
378 Ga0496125_0002533 3300048928 Bacteria 23549
379 Ga0496125_0008485 3300048928 Bacteria 10752
380 Ga0496125_0134561 3300048928 Bacteria 1732
381 Ga0496125_0161299 3300048928 Bacteria 1522
382 Ga0496126_0000015 3300048929 Bacteria 663212
383 Ga0496126_0000067 3300048929 Bacteria 249091
384 Ga0496126_0000213 3300048929 Bacteria 128366
385 Ga0496126_0007978 3300048929 Bacteria 11499
386 Ga0496126_0011832 3300048929 Bacteria 8979
387 Ga0496126_0012005 3300048929 Bacteria 8902
388 Ga0496126_0025792 3300048929 Bacteria 5647
389 Ga0496126_0353339 3300048929 Bacteria 1202
390 Ga0501032_0012124 3300049569 Bacteria 6171
391 Ga0501032_0014568 3300049569 Bacteria 5568
392 Ga0501032_0038271 3300049569 Bacteria 3268
393 Ga0501032_0068572 3300049569 Bacteria 2367
394 Ga0501033_0021034 3300049570 Bacteria 4925
395 Ga0501033_0026456 3300049570 Bacteria 4366
396 Ga0501034_0001093 3300049571 Bacteria 38149
397 Ga0501034_0008439 3300049571 Bacteria 10882
398 Ga0501034_0097001 3300049571 Bacteria 2944
399 Ga0501034_0545466 3300049571 Bacteria 1069
400 Ga0501036_0123235 3300049572 Bacteria 2189
401 Ga0501037_0000319 3300049573 Bacteria 40792
402 Ga0501037_0024240 3300049573 Bacteria 4487
403 Ga0501038_0005266 3300049574 Bacteria 12029
404 Ga0501038_0005689 3300049574 Bacteria 11563
405 Ga0501043_0004437 3300049579 Bacteria 11397
406 Ga0501043_0043405 3300049579 Bacteria 3534
407 Ga0501046_0004040 3300049580 Bacteria 13390
408 Ga0501047_0028042 3300049581 Bacteria 5426
409 Ga0501047_0039815 3300049581 Bacteria 4545
410 Ga0501047_0077974 3300049581 Bacteria 3186
411 Ga0501047_0120521 3300049581 Bacteria 2506
412 Ga0501048_0017387 3300049582 Bacteria 5299
413 Ga0501068_0090346 3300049584 Bacteria 1889
414 Ga0501070_0000458 3300049586 Bacteria 37000
415 Ga0501070_0010494 3300049586 Bacteria 7834
416 Ga0501070_0051913 3300049586 Bacteria 3403
417 Ga0501070_0096337 3300049586 Bacteria 2448
418 Ga0501070_0099656 3300049586 Bacteria 2404
419 Ga0501080_0206244 3300049742 Bacteria 1803
420 Ga0501080_0236238 3300049742 Bacteria 1670
421 Ga0501083_0035367 3300049744 Bacteria 3413
422 Ga0501035_0002730 3300049822 Bacteria 17127
423 Ga0501035_0016343 3300049822 Bacteria 6844
424 Ga0501044_0000376 3300049823 Bacteria 55707
425 Ga0501044_0015686 3300049823 Bacteria 8158
426 Ga0501044_0035759 3300049823 Bacteria 5200
427 Ga0501044_0057776 3300049823 Bacteria 3980
428 Ga0501044_0065611 3300049823 Bacteria 3702
429 Ga0501044_0474794 3300049823 Bacteria 1154
430 Ga0501044_0610807 3300049823 Bacteria 983
431 nmdc:mga03683_188347_c1 3300050489 Bacteria 943
432 nmdc:mga03683_190799_c1 3300050489 Bacteria 937
433 nmdc:mga03683_47619_c1 3300050489 Bacteria 1779
434 nmdc:mga03n38_15426_c1 3300050490 Bacteria 2950
435 nmdc:mga03n38_2876_c1 3300050490 Bacteria 5424
436 nmdc:mga03n38_28963_c1 3300050490 Bacteria 2313
437 nmdc:mga03n38_2900_c1 3300050490 Bacteria 5408
438 nmdc:mga03n38_5872_c1 3300050490 Bacteria 4219
439 nmdc:mga03n38_69998_c1 3300050490 Bacteria 1621
440 nmdc:mga00v17_11593_c1 3300050491 Bacteria 4846
441 nmdc:mga00v17_124286_c1 3300050491 Bacteria 1645
442 nmdc:mga00v17_166621_c1 3300050491 Bacteria 1420
443 nmdc:mga00v17_17801_c1 3300050491 Bacteria 4030
444 nmdc:mga00v17_26514_c1 3300050491 Bacteria 3378
445 nmdc:mga00v17_2676_c1 3300050491 Bacteria 9136
446 nmdc:mga00v17_4635_c1 3300050491 Bacteria 7173
447 nmdc:mga00v17_5047_c1 3300050491 Bacteria 6930
448 nmdc:mga0yw44_142712_c1 3300050492 Bacteria 1557
449 nmdc:mga0yw44_143578_c1 3300050492 Bacteria 1552
450 nmdc:mga0yw44_26270_c1 3300050492 Bacteria 3324
451 nmdc:mga0yw44_4795_c1 3300050492 Bacteria 6271
452 nmdc:mga0k408_23361_c1 3300050493 Bacteria 3486
453 nmdc:mga06z11_1808_c1 3300050494 Bacteria 8057
454 nmdc:mga04h51_29715_c1 3300050495 Bacteria 1714
455 nmdc:mga07m45_100227_c1 3300050496 Bacteria 1663
456 nmdc:mga07m45_1319_c1 3300050496 Bacteria 11303
457 nmdc:mga07m45_38912_c2 3300050496 Bacteria 1303
458 nmdc:mga07m45_9032_c1 3300050496 Bacteria 5149
459 nmdc:mga0qj67_9791_c1 3300050509 Bacteria 7142
460 nmdc:mga06r32_11741_c1 3300050510 Bacteria 7887
461 nmdc:mga0sz30_19548_c1 3300050516 Bacteria 2724
462 nmdc:mga0sz30_37684_c1 3300050516 Bacteria 2024
463 nmdc:mga0sz30_5016_c1 3300050516 Bacteria 4834
464 Ga0500610_0020642 3300053079 Bacteria 3219
465 Ga0500643_009858 3300053087 Bacteria 3611
466 Ga0500641_0024755 3300053096 Bacteria 2317
467 Ga0500650_0024812 3300053098 Bacteria 2677
468 Ga0500556_0018176 3300053104 Bacteria 2214
469 Ga0500645_000431 3300053730 Bacteria 28734
470 Ga0466962_0022946 3300061719 Bacteria 2999
471 Ga0466962_0158884 3300061719 Bacteria 1098
472 Ga0466962_0159948 3300061719 Bacteria 1094

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2929206907 2929209002 250
2 iso_pu_bacteria 2818991459 2819668933 251
3 iso_pu_bacteria 2904755435 2904762272 251
4 iso_pu_bacteria 2919425241 2919429364 251
5 iso_pu_bacteria 2996706504 2996710036 251
6 iso_pu_bacteria 2563366752 2563927442 253
7 iso_pu_bacteria 2585428059 2587741008 253
8 iso_pu_bacteria 2643221676 2644422322 253
9 iso_pu_bacteria 2721755693 2723604359 253
10 iso_pu_bacteria 2728369359 2730135049 253
11 iso_pu_bacteria 2751185905 2753810099 253
12 iso_pu_bacteria 2802428803 2802436716 253
13 iso_pu_bacteria 2857453340 2857454011 253
14 iso_pu_bacteria 2864997549 2865001610 253
15 iso_pu_bacteria 2889276214 2889280319 253
16 iso_pu_bacteria 2889295896 2889296944 253
17 iso_pu_bacteria 2904595352 2904595750 253
18 iso_pu_bacteria 2939702853 2939705406 253
19 iso_pu_bacteria 2971410472 2971414971 253
20 iso_pu_bacteria 648028048 648170480 253
21 iso_pu_bacteria 8056533031 8056533964 253
22 3300002737 JGI25162J39368_1010067 JGI25162J39368_10100672 254
23 3300044693 Ga0466961_0197876 Ga0466961_0197876_226_990 254
24 3300048923 Ga0496120_0019822 Ga0496120_0019822_148_912 254
25 3300048923 Ga0496120_0020936 Ga0496120_0020936_185_949 254
26 3300048924 Ga0496121_0039210 Ga0496121_0039210_487_1251 254
27 3300048924 Ga0496121_0047763 Ga0496121_0047763_2044_2808 254
28 3300048924 Ga0496121_0075162 Ga0496121_0075162_1100_1864 254
29 3300048925 Ga0496122_0019343 Ga0496122_0019343_4406_5170 254
30 3300048926 Ga0496123_0031801 Ga0496123_0031801_2533_3297 254
31 3300048928 Ga0496125_0001104 Ga0496125_0001104_33761_34525 254
32 3300048929 Ga0496126_0025792 Ga0496126_0025792_2467_3231 254
33 iso_pu_bacteria 2981284811 2981285418 254
34 iso_pu_bacteria 2981289755 2981290364 254
35 iso_pu_bacteria 2981980479 2981981007 254
36 iso_pu_bacteria 2981985349 2981985894 254
37 3300044656 Ga0466969_0003311 Ga0466969_0003311_6140_6907 255
38 3300044693 Ga0466961_0106502 Ga0466961_0106502_848_1615 255
39 3300045049 Ga0466959_0174882 Ga0466959_0174882_14_781 255
40 iso_pu_bacteria 2643221543 2643735594 255
41 iso_pu_bacteria 2864733723 2864736325 255
42 iso_pu_bacteria 2885526491 2885531646 255
43 iso_pu_bacteria 2888578766 2888582470 255
44 iso_pu_bacteria 2889049205 2889055277 255
45 iso_pu_bacteria 2904162308 2904163819 255
46 iso_pu_bacteria 2939679117 2939680963 255
47 iso_pu_bacteria 2945991243 2945991720 255
48 3300025225 Ga0209566_101547 Ga0209566_1015474 256
49 iso_pu_bacteria 2524023129 2524186058 256
50 iso_pu_bacteria 2548877040 2550902300 256
51 iso_pu_bacteria 2571042143 2571528245 256
52 iso_pu_bacteria 2576861424 2578337333 256
53 iso_pu_bacteria 2600255286 2601638200 256
54 iso_pu_bacteria 2728368933 2728535272 256
55 iso_pu_bacteria 2816332305 2817509150 256
56 iso_pu_bacteria 2881636855 2881637332 256
57 iso_pu_bacteria 2938649242 2938653231 256
58 iso_pu_bacteria 2968558590 2968561977 256
59 iso_pu_bacteria 2971403814 2971405570 256
60 iso_pu_bacteria 2971511577 2971511798 256
61 iso_pu_bacteria 2980176882 2980176938 256
62 iso_pu_bacteria 2988225383 2988229762 256
63 iso_pu_bacteria 2996632988 2996634755 256
64 iso_pu_bacteria 8054465665 8054468867 256
65 iso_pu_bacteria 8057977335 8057979995 256
66 3300003751 Ga0055538_1000080 Ga0055538_100008019 257
67 3300005327 Ga0070658_10080545 Ga0070658_100805453 257
68 3300025224 Ga0209784_100077 Ga0209784_100077115 257
69 3300035119 Ga0373956_0014403 Ga0373956_0014403_767_1540 257
70 3300048919 Ga0496116_0027524 Ga0496116_0027524_2508_3281 257
71 iso_pu_bacteria 2571042588 2573040631 257
72 iso_pu_bacteria 2579778775 2580933847 257
73 iso_pu_bacteria 2619619294 2621275639 257
74 iso_pu_bacteria 2738541356 2739144332 257
75 iso_pu_bacteria 2920879853 2920882626 257
76 iso_pu_bacteria 8056060235 8056064783 257
77 3300025291 Ga0209675_1005060 Ga0209675_10050602 258
78 iso_pu_bacteria 2865002811 2865004339 258
79 3300025233 Ga0209437_100324 Ga0209437_1003248 259
80 3300044658 Ga0466972_0081370 Ga0466972_0081370_708_1487 259
81 3300048905 Ga0496102_0377670 Ga0496102_0377670_541_1323 259
82 3300048919 Ga0496116_0005088 Ga0496116_0005088_2322_3101 259
83 3300048925 Ga0496122_0192506 Ga0496122_0192506_388_1167 259
84 3300048927 Ga0496124_0025976 Ga0496124_0025976_1106_1885 259
85 3300048928 Ga0496125_0002533 Ga0496125_0002533_18181_18960 259
86 3300048928 Ga0496125_0134561 Ga0496125_0134561_99_878 259
87 3300041999 Ga0439433_0017456 Ga0439433_0017456_356_1138 260
88 3300042007 Ga0439449_0007726 Ga0439449_0007726_2952_3734 260
89 3300047470 Ga0495681_0104151 Ga0495681_0104151_125_907 260
90 3300005329 Ga0070683_100046768 Ga0070683_1000467683 261
91 3300013105 Ga0157369_10374512 Ga0157369_103745122 261
92 3300025294 Ga0209025_1005630 Ga0209025_10056308 261
93 3300025904 Ga0207647_10200356 Ga0207647_102003561 261
94 3300031852 Ga0307410_10029034 Ga0307410_100290343 261
95 iso_pu_bacteria 2835188231 2835190979 261
96 3300020070 Ga0206356_10925867 Ga0206356_109258672 262
97 3300045976 Ga0466967_0007276 Ga0466967_0007276_2631_3419 262
98 3300049823 Ga0501044_0474794 Ga0501044_0474794_340_1140 262
99 iso_pu_bacteria 2643221961 2645719549 262
100 iso_pu_bacteria 2643221962 2645726452 262
101 3300031456 Ga0307513_10000001 Ga0307513_100000011337 263
102 iso_pu_bacteria 2899370129 2899371319 263
103 iso_pu_bacteria 2899359706 2899362070 264
104 iso_pu_bacteria 2917736166 2917743508 264
105 3300005437 Ga0070710_10001225 Ga0070710_100012252 265
106 3300005617 Ga0068859_100002953 Ga0068859_10000295313 265
107 3300005843 Ga0068860_100017670 Ga0068860_1000176702 265
108 3300006931 Ga0097620_100002953 Ga0097620_10000295313 265
109 3300009101 Ga0105247_10003886 Ga0105247_1000388610 265
110 3300009545 Ga0105237_10062171 Ga0105237_100621712 265
111 3300014968 Ga0157379_10106218 Ga0157379_101062183 265
112 3300020082 Ga0206353_11694794 Ga0206353_116947942 265
113 3300025898 Ga0207692_10010508 Ga0207692_100105084 265
114 3300025900 Ga0207710_10011381 Ga0207710_100113812 265
115 3300025914 Ga0207671_10072560 Ga0207671_100725602 265
116 3300026078 Ga0207702_10605874 Ga0207702_106058742 265
117 3300026088 Ga0207641_10001152 Ga0207641_1000115214 265
118 3300028379 Ga0268266_10013099 Ga0268266_100130992 265
119 3300028381 Ga0268264_10019520 Ga0268264_100195206 265
120 3300044658 Ga0466972_0016967 Ga0466972_0016967_2647_3459 265
121 3300044683 Ga0466965_0001686 Ga0466965_0001686_7260_8063 265
122 3300044683 Ga0466965_0003040 Ga0466965_0003040_4117_4929 265
123 3300044684 Ga0466966_0038429 Ga0466966_0038429_2030_2827 265
124 3300044735 Ga0466968_0006916 Ga0466968_0006916_1117_1929 265
125 3300044765 Ga0466970_0235971 Ga0466970_0235971_37_834 265
126 3300044901 Ga0466960_0004904 Ga0466960_0004904_2869_3681 265
127 3300048903 Ga0496100_0004179 Ga0496100_0004179_6558_7376 265
128 3300048904 Ga0496101_0008392 Ga0496101_0008392_3929_4747 265
129 3300048905 Ga0496102_0000030 Ga0496102_0000030_204037_204855 265
130 3300048905 Ga0496102_0000207 Ga0496102_0000207_3019_3816 265
131 3300048905 Ga0496102_0007781 Ga0496102_0007781_3718_4515 265
132 3300048906 Ga0496103_0000068 Ga0496103_0000068_29255_30073 265
133 3300048906 Ga0496103_0003281 Ga0496103_0003281_6107_6904 265
134 3300048907 Ga0496104_0061581 Ga0496104_0061581_2579_3397 265
135 3300048910 Ga0496107_0142583 Ga0496107_0142583_762_1580 265
136 3300048913 Ga0496110_0036979 Ga0496110_0036979_2074_2892 265
137 3300048919 Ga0496116_0000152 Ga0496116_0000152_22308_23126 265
138 3300048920 Ga0496117_0000059 Ga0496117_0000059_242940_243758 265
139 3300048921 Ga0496118_0000061 Ga0496118_0000061_203655_204473 265
140 3300048921 Ga0496118_0201670 Ga0496118_0201670_346_1143 265
141 3300048922 Ga0496119_0001310 Ga0496119_0001310_16240_17058 265
142 3300048922 Ga0496119_0023721 Ga0496119_0023721_2949_3746 265
143 3300048923 Ga0496120_0005452 Ga0496120_0005452_9210_10028 265
144 3300048924 Ga0496121_0010190 Ga0496121_0010190_7367_8185 265
145 3300048924 Ga0496121_0062151 Ga0496121_0062151_537_1334 265
146 3300048927 Ga0496124_0007754 Ga0496124_0007754_6460_7278 265
147 3300048929 Ga0496126_0000213 Ga0496126_0000213_111065_111883 265
148 iso_pu_bacteria 2870801768 2870802490 265
149 3300005937 Ga0081455_10002484 Ga0081455_1000248414 266
150 3300041462 Ga0451806_125850 Ga0451806_125850_37_867 266
151 3300044694 Ga0466963_0002115 Ga0466963_0002115_3977_4777 266
152 3300048925 Ga0496122_0020321 Ga0496122_0020321_129_977 266
153 3300048926 Ga0496123_0006607 Ga0496123_0006607_3295_4143 266
154 3300050491 nmdc:mga00v17_2676_c1 nmdc:mga00v17_2676_c1_2921_3778 266
155 iso_pu_bacteria 8003314358 8003316152 266
156 3300009093 Ga0105240_10246964 Ga0105240_102469642 267
157 3300009551 Ga0105238_10138552 Ga0105238_101385523 267
158 3300013307 Ga0157372_10000057 Ga0157372_1000005786 267
159 3300021384 Ga0213876_10146521 Ga0213876_101465212 267
160 3300025913 Ga0207695_10137390 Ga0207695_101373902 267
161 3300025924 Ga0207694_10141031 Ga0207694_101410312 267
162 3300025924 Ga0207694_10520420 Ga0207694_105204201 267
163 3300039437 Ga0436365_0091649 Ga0436365_0091649_262_1071 267
164 3300044694 Ga0466963_0247749 Ga0466963_0247749_48_851 267
165 3300044765 Ga0466970_0058863 Ga0466970_0058863_299_1102 267
166 3300044842 Ga0466957_0008290 Ga0466957_0008290_2777_3580 267
167 3300045049 Ga0466959_0222416 Ga0466959_0222416_432_1235 267
168 3300045836 Ga0466958_0003953 Ga0466958_0003953_2550_3353 267
169 3300045976 Ga0466967_0003181 Ga0466967_0003181_5745_6551 267
170 3300005937 Ga0081455_10231314 Ga0081455_102313141 268
171 3300006847 Ga0075431_100037080 Ga0075431_1000370802 268
172 3300013105 Ga0157369_10012727 Ga0157369_100127274 268
173 3300025972 Ga0207668_10083842 Ga0207668_100838422 268
174 3300026067 Ga0207678_10001525 Ga0207678_100015253 268
175 3300026116 Ga0207674_10185622 Ga0207674_101856221 268
176 3300028379 Ga0268266_10216720 Ga0268266_102167201 268
177 3300030522 Ga0307512_10128169 Ga0307512_101281692 268
178 3300033180 Ga0307510_10045330 Ga0307510_100453303 268
179 3300044658 Ga0466972_0089605 Ga0466972_0089605_589_1410 268
180 3300044693 Ga0466961_0027789 Ga0466961_0027789_2212_3021 268
181 3300044694 Ga0466963_0013047 Ga0466963_0013047_2973_3782 268
182 3300044694 Ga0466963_0070648 Ga0466963_0070648_938_1747 268
183 3300044842 Ga0466957_0220372 Ga0466957_0220372_23_829 268
184 3300045049 Ga0466959_0086935 Ga0466959_0086935_1227_2036 268
185 3300045049 Ga0466959_0300773 Ga0466959_0300773_96_905 268
186 3300045836 Ga0466958_0098944 Ga0466958_0098944_968_1774 268
187 3300049569 Ga0501032_0068572 Ga0501032_0068572_1058_1867 268
188 3300049574 Ga0501038_0005266 Ga0501038_0005266_10172_10981 268
189 3300049581 Ga0501047_0039815 Ga0501047_0039815_3468_4277 268
190 3300049586 Ga0501070_0051913 Ga0501070_0051913_447_1256 268
191 3300049823 Ga0501044_0065611 Ga0501044_0065611_260_1069 268
192 3300050510 nmdc:mga06r32_11741_c1 nmdc:mga06r32_11741_c1_4734_5552 268
193 3300061719 Ga0466962_0022946 Ga0466962_0022946_457_1263 268
194 3300030732 Ga0316176_1065654 Ga0316176_10656542 269
195 3300030733 Ga0314311_1191344 Ga0314311_11913443 269
196 3300031507 Ga0307509_10083772 Ga0307509_100837722 269
197 3300038735 Ga0400485_17256 Ga0400485_17256_24621_25487 269
198 3300038742 Ga0400486_26437 Ga0400486_26437_24646_25512 269
199 3300039437 Ga0436365_1140633 Ga0436365_1140633_2580_3443 269
200 3300039453 Ga0436362_0233102 Ga0436362_0233102_2657_3520 269
201 3300045049 Ga0466959_0131210 Ga0466959_0131210_215_1030 269
202 iso_pu_bacteria 2565956761 2566993170 269
203 iso_pu_bacteria 2738543034 2739362294 269
204 iso_pu_bacteria 2889300758 2889300849 269
205 iso_pu_bacteria 2904535858 2904538836 269
206 iso_pu_bacteria 2904765812 2904770198 269
207 iso_pu_bacteria 2904770941 2904770952 269
208 iso_pu_bacteria 2908811453 2908814995 269
209 iso_pu_bacteria 2919420072 2919424304 269
210 iso_pu_bacteria 2919432681 2919437112 269
211 iso_pu_bacteria 2922554459 2922556867 269
212 iso_pu_bacteria 2928142448 2928142604 269
213 iso_pu_bacteria 3001119090 3001122130 269
214 3300038741 Ga0400488_17360 Ga0400488_17360_1024_1884 270
215 iso_pu_bacteria 2744054611 2744958142 270
216 iso_pu_bacteria 2956939328 2956939338 270
217 3300025929 Ga0207664_10012219 Ga0207664_100122193 271
218 iso_pu_bacteria 2738541308 2738887086 271
219 iso_pu_bacteria 2751185725 2753038404 271
220 iso_pu_bacteria 2751185792 2753326915 271
221 iso_pu_bacteria 2932398195 2932399385 271
222 iso_pu_bacteria 8047710418 8047715440 271
223 3300044658 Ga0466972_0006692 Ga0466972_0006692_771_1637 272
224 3300044683 Ga0466965_0052965 Ga0466965_0052965_370_1236 272
225 3300044901 Ga0466960_0000175 Ga0466960_0000175_13718_14584 272
226 iso_pu_bacteria 2547132424 2548694235 272
227 iso_pu_bacteria 2738543005 2739203170 272
228 iso_pu_bacteria 2738543011 2739239778 272
229 iso_pu_bacteria 2939743619 2939744359 272
230 3300006177 Ga0075362_10049852 Ga0075362_100498522 273
231 3300006177 Ga0075362_10212721 Ga0075362_102127211 273
232 3300009148 Ga0105243_10000872 Ga0105243_100008727 273
233 3300025935 Ga0207709_10036745 Ga0207709_100367452 273
234 3300045976 Ga0466967_0035445 Ga0466967_0035445_1127_1990 273
235 3300048928 Ga0496125_0161299 Ga0496125_0161299_547_1386 273
236 3300048929 Ga0496126_0353339 Ga0496126_0353339_23_862 273
237 3300049823 Ga0501044_0610807 Ga0501044_0610807_45_875 273
238 3300050489 nmdc:mga03683_188347_c1 nmdc:mga03683_188347_c1_46_888 273
239 3300050489 nmdc:mga03683_190799_c1 nmdc:mga03683_190799_c1_31_861 273
240 3300050491 nmdc:mga00v17_11593_c1 nmdc:mga00v17_11593_c1_3876_4718 273
241 iso_pu_bacteria 2551306166 2552109719 273
242 3300046674 Ga0495588_0124689 Ga0495588_0124689_352_1176 274
243 3300048906 Ga0496103_0155160 Ga0496103_0155160_293_1117 274
244 3300048921 Ga0496118_0015775 Ga0496118_0015775_4141_5058 274
245 3300048922 Ga0496119_0002966 Ga0496119_0002966_11557_12381 274
246 3300048923 Ga0496120_0007894 Ga0496120_0007894_578_1402 274
247 3300048929 Ga0496126_0012005 Ga0496126_0012005_3617_4486 274
248 3300050490 nmdc:mga03n38_28963_c1 nmdc:mga03n38_28963_c1_707_1540 274
249 3300050496 nmdc:mga07m45_100227_c1 nmdc:mga07m45_100227_c1_570_1394 274
250 iso_pu_bacteria 2643221692 2644513217 274
251 iso_pu_bacteria 2974315732 2974317146 274
252 iso_pu_bacteria 2984523437 2984525351 274
253 3300006028 Ga0070717_10070845 Ga0070717_100708452 275
254 3300006186 Ga0075369_10012899 Ga0075369_100128993 275
255 3300026035 Ga0207703_10047802 Ga0207703_100478022 275
256 3300026067 Ga0207678_10402779 Ga0207678_104027791 275
257 3300030521 Ga0307511_10065324 Ga0307511_100653243 275
258 3300031251 Ga0265327_10054975 Ga0265327_100549752 275
259 3300046501 Ga0495607_0100782 Ga0495607_0100782_574_1416 275
260 3300047323 Ga0495683_0000668 Ga0495683_0000668_975_1817 275
261 3300048911 Ga0496108_0413611 Ga0496108_0413611_80_907 275
262 3300049586 Ga0501070_0099656 Ga0501070_0099656_490_1332 275
263 3300049742 Ga0501080_0236238 Ga0501080_0236238_737_1579 275
264 iso_pu_bacteria 2643221715 2644634864 275
265 iso_pu_bacteria 2902810491 2902817088 275
266 3300003320 rootH2_10047012 rootH2_100470125 276
267 3300006028 Ga0070717_10211539 Ga0070717_102115392 276
268 3300006048 Ga0075363_100005241 Ga0075363_1000052413 276
269 3300006186 Ga0075369_10001130 Ga0075369_100011303 276
270 3300006353 Ga0075370_10037112 Ga0075370_100371122 276
271 3300013105 Ga0157369_10433435 Ga0157369_104334352 276
272 3300025929 Ga0207664_10204184 Ga0207664_102041842 276
273 3300039437 Ga0436365_0098557 Ga0436365_0098557_131_973 276
274 3300039437 Ga0436365_1640556 Ga0436365_1640556_3708_4550 276
275 3300039450 Ga0436363_0589925 Ga0436363_0589925_608_1450 276
276 3300044656 Ga0466969_0064378 Ga0466969_0064378_605_1447 276
277 3300044684 Ga0466966_0012961 Ga0466966_0012961_2703_3545 276
278 3300044693 Ga0466961_0000997 Ga0466961_0000997_12215_13057 276
279 3300044693 Ga0466961_0035403 Ga0466961_0035403_991_1833 276
280 3300044694 Ga0466963_0264386 Ga0466963_0264386_58_900 276
281 3300044735 Ga0466968_0006279 Ga0466968_0006279_3163_4005 276
282 3300044735 Ga0466968_0014662 Ga0466968_0014662_502_1344 276
283 3300044842 Ga0466957_0001718 Ga0466957_0001718_2885_3727 276
284 3300044901 Ga0466960_0037935 Ga0466960_0037935_380_1222 276
285 3300045049 Ga0466959_0002409 Ga0466959_0002409_10856_11698 276
286 3300045049 Ga0466959_0010817 Ga0466959_0010817_3482_4324 276
287 3300045836 Ga0466958_0009168 Ga0466958_0009168_2921_3763 276
288 3300045976 Ga0466967_0026481 Ga0466967_0026481_2603_3445 276
289 3300045976 Ga0466967_0036571 Ga0466967_0036571_3050_3892 276
290 3300049569 Ga0501032_0012124 Ga0501032_0012124_2791_3636 276
291 3300049569 Ga0501032_0038271 Ga0501032_0038271_699_1541 276
292 3300049570 Ga0501033_0021034 Ga0501033_0021034_1670_2515 276
293 3300049570 Ga0501033_0026456 Ga0501033_0026456_1928_2770 276
294 3300049571 Ga0501034_0008439 Ga0501034_0008439_1528_2373 276
295 3300049572 Ga0501036_0123235 Ga0501036_0123235_855_1700 276
296 3300049573 Ga0501037_0024240 Ga0501037_0024240_331_1176 276
297 3300049579 Ga0501043_0043405 Ga0501043_0043405_900_1745 276
298 3300049580 Ga0501046_0004040 Ga0501046_0004040_5659_6504 276
299 3300049581 Ga0501047_0028042 Ga0501047_0028042_3881_4726 276
300 3300049581 Ga0501047_0077974 Ga0501047_0077974_1578_2420 276
301 3300049581 Ga0501047_0120521 Ga0501047_0120521_196_1038 276
302 3300049582 Ga0501048_0017387 Ga0501048_0017387_2784_3629 276
303 3300049586 Ga0501070_0010494 Ga0501070_0010494_3347_4192 276
304 3300049744 Ga0501083_0035367 Ga0501083_0035367_1986_2831 276
305 3300049822 Ga0501035_0002730 Ga0501035_0002730_15433_16278 276
306 3300049822 Ga0501035_0016343 Ga0501035_0016343_3143_3985 276
307 3300049823 Ga0501044_0000376 Ga0501044_0000376_2577_3419 276
308 3300049823 Ga0501044_0057776 Ga0501044_0057776_2435_3280 276
309 3300050489 nmdc:mga03683_47619_c1 nmdc:mga03683_47619_c1_27_878 276
310 3300050490 nmdc:mga03n38_2900_c1 nmdc:mga03n38_2900_c1_3540_4400 276
311 3300050491 nmdc:mga00v17_26514_c1 nmdc:mga00v17_26514_c1_771_1631 276
312 3300050516 nmdc:mga0sz30_5016_c1 nmdc:mga0sz30_5016_c1_3570_4430 276
313 3300061719 Ga0466962_0159948 Ga0466962_0159948_124_966 276
314 3300005347 Ga0070668_100011153 Ga0070668_1000111536 277
315 3300006051 Ga0075364_10020980 Ga0075364_100209802 277
316 3300009101 Ga0105247_10187383 Ga0105247_101873832 277
317 3300025972 Ga0207668_10004729 Ga0207668_100047294 277
318 3300031824 Ga0307413_10056993 Ga0307413_100569933 277
319 3300037853 Ga0436364_0123211 Ga0436364_0123211_1071_1925 277
320 3300039437 Ga0436365_1479739 Ga0436365_1479739_53469_54323 277
321 3300041410 Ga0439461_0004625 Ga0439461_0004625_1352_2191 277
322 3300041413 Ga0439465_0028099 Ga0439465_0028099_384_1223 277
323 3300041997 Ga0439431_0001978 Ga0439431_0001978_3148_3987 277
324 3300042004 Ga0439445_0000297 Ga0439445_0000297_2050_2889 277
325 3300042435 Ga0439434_0015500 Ga0439434_0015500_1052_1891 277
326 3300044683 Ga0466965_0012970 Ga0466965_0012970_2113_2952 277
327 3300044735 Ga0466968_0004191 Ga0466968_0004191_2300_3139 277
328 3300044765 Ga0466970_0049766 Ga0466970_0049766_120_959 277
329 3300044842 Ga0466957_0062093 Ga0466957_0062093_813_1652 277
330 3300045049 Ga0466959_0046294 Ga0466959_0046294_1733_2572 277
331 3300045976 Ga0466967_0022814 Ga0466967_0022814_1635_2474 277
332 3300046460 Ga0495638_0005895 Ga0495638_0005895_1863_2705 277
333 3300048903 Ga0496100_0017871 Ga0496100_0017871_2695_3528 277
334 3300048905 Ga0496102_0151733 Ga0496102_0151733_534_1367 277
335 3300048909 Ga0496106_0054918 Ga0496106_0054918_1256_2089 277
336 3300048917 Ga0496114_0301321 Ga0496114_0301321_540_1373 277
337 3300050491 nmdc:mga00v17_4635_c1 nmdc:mga00v17_4635_c1_3634_4473 277
338 3300053079 Ga0500610_0020642 Ga0500610_0020642_1251_2093 277
339 3300053104 Ga0500556_0018176 Ga0500556_0018176_614_1456 277
340 3300061719 Ga0466962_0158884 Ga0466962_0158884_104_943 277
341 3300006038 Ga0075365_10009336 Ga0075365_100093362 278
342 3300006048 Ga0075363_100000083 Ga0075363_1000000835 278
343 3300006048 Ga0075363_100002132 Ga0075363_1000021324 278
344 3300006051 Ga0075364_10005547 Ga0075364_100055474 278
345 3300006051 Ga0075364_10056426 Ga0075364_100564262 278
346 3300006178 Ga0075367_10007896 Ga0075367_100078964 278
347 3300006195 Ga0075366_10029066 Ga0075366_100290662 278
348 3300006353 Ga0075370_10006858 Ga0075370_100068587 278
349 3300031824 Ga0307413_10011921 Ga0307413_100119214 278
350 3300031901 Ga0307406_10189625 Ga0307406_101896252 278
351 3300031995 Ga0307409_100026673 Ga0307409_1000266734 278
352 3300031995 Ga0307409_100148324 Ga0307409_1001483242 278
353 3300032002 Ga0307416_100038454 Ga0307416_1000384543 278
354 3300032005 Ga0307411_10058732 Ga0307411_100587322 278
355 3300039437 Ga0436365_0571433 Ga0436365_0571433_1617_2507 278
356 3300044694 Ga0466963_0050055 Ga0466963_0050055_805_1686 278
357 3300048903 Ga0496100_0001596 Ga0496100_0001596_5982_6836 278
358 3300048904 Ga0496101_0000094 Ga0496101_0000094_74258_75112 278
359 3300048905 Ga0496102_0000014 Ga0496102_0000014_191048_191902 278
360 3300048906 Ga0496103_0000004 Ga0496103_0000004_191554_192408 278
361 3300048909 Ga0496106_0067973 Ga0496106_0067973_741_1595 278
362 3300048910 Ga0496107_0020769 Ga0496107_0020769_3068_3922 278
363 3300048919 Ga0496116_0000069 Ga0496116_0000069_192505_193359 278
364 3300048920 Ga0496117_0000003 Ga0496117_0000003_1389957_1390811 278
365 3300048921 Ga0496118_0000001 Ga0496118_0000001_1389960_1390814 278
366 3300048922 Ga0496119_0001073 Ga0496119_0001073_13070_13924 278
367 3300048923 Ga0496120_0001262 Ga0496120_0001262_10144_10998 278
368 3300048924 Ga0496121_0000032 Ga0496121_0000032_282727_283581 278
369 3300048929 Ga0496126_0000067 Ga0496126_0000067_118216_119070 278
370 3300049571 Ga0501034_0545466 Ga0501034_0545466_195_1037 278
371 3300050490 nmdc:mga03n38_15426_c1 nmdc:mga03n38_15426_c1_1186_2028 278
372 3300050490 nmdc:mga03n38_2876_c1 nmdc:mga03n38_2876_c1_1803_2645 278
373 3300050490 nmdc:mga03n38_5872_c1 nmdc:mga03n38_5872_c1_1632_2474 278
374 3300050491 nmdc:mga00v17_17801_c1 nmdc:mga00v17_17801_c1_2944_3786 278
375 3300050491 nmdc:mga00v17_5047_c1 nmdc:mga00v17_5047_c1_5303_6145 278
376 3300050492 nmdc:mga0yw44_143578_c1 nmdc:mga0yw44_143578_c1_535_1386 278
377 3300050492 nmdc:mga0yw44_26270_c1 nmdc:mga0yw44_26270_c1_1419_2261 278
378 3300050492 nmdc:mga0yw44_4795_c1 nmdc:mga0yw44_4795_c1_3597_4439 278
379 3300050493 nmdc:mga0k408_23361_c1 nmdc:mga0k408_23361_c1_610_1452 278
380 3300050494 nmdc:mga06z11_1808_c1 nmdc:mga06z11_1808_c1_3911_4753 278
381 3300050495 nmdc:mga04h51_29715_c1 nmdc:mga04h51_29715_c1_609_1451 278
382 3300050496 nmdc:mga07m45_1319_c1 nmdc:mga07m45_1319_c1_6852_7694 278
383 3300050496 nmdc:mga07m45_9032_c1 nmdc:mga07m45_9032_c1_2543_3385 278
384 iso_pu_bacteria 2523231044 2523387190 278
385 iso_pu_bacteria 2902837492 2902840008 278
386 iso_pu_bacteria 2919713450 2919716426 278
387 iso_pu_bacteria 2929212328 2929214699 278
388 3300005455 Ga0070663_100025826 Ga0070663_1000258263 279
389 3300006048 Ga0075363_100004597 Ga0075363_1000045977 279
390 3300009098 Ga0105245_10195781 Ga0105245_101957812 279
391 3300010375 Ga0105239_10216901 Ga0105239_102169012 279
392 3300013296 Ga0157374_10315267 Ga0157374_103152672 279
393 3300014325 Ga0163163_10358107 Ga0163163_103581072 279
394 3300025927 Ga0207687_10302660 Ga0207687_103026601 279
395 3300026067 Ga0207678_10084973 Ga0207678_100849733 279
396 3300031251 Ga0265327_10000195 Ga0265327_1000019567 279
397 3300031824 Ga0307413_10183580 Ga0307413_101835802 279
398 3300035692 Ga0373935_0058656 Ga0373935_0058656_1506_2345 279
399 3300037853 Ga0436364_0911230 Ga0436364_0911230_944_1807 279
400 3300046455 Ga0495603_0049154 Ga0495603_0049154_974_1813 279
401 3300046459 Ga0495629_0014161 Ga0495629_0014161_843_1682 279
402 3300046460 Ga0495638_0024351 Ga0495638_0024351_2541_3398 279
403 3300046461 Ga0495641_0018720 Ga0495641_0018720_686_1525 279
404 3300046499 Ga0495594_0020881 Ga0495594_0020881_1665_2504 279
405 3300046533 Ga0495640_0085277 Ga0495640_0085277_753_1592 279
406 3300046559 Ga0495667_0232611 Ga0495667_0232611_135_974 279
407 3300046683 Ga0495658_0095629 Ga0495658_0095629_276_1115 279
408 3300046690 Ga0495624_0057333 Ga0495624_0057333_811_1650 279
409 3300047315 Ga0495581_0031098 Ga0495581_0031098_1176_2015 279
410 3300047319 Ga0495674_0067579 Ga0495674_0067579_1826_2665 279
411 3300047320 Ga0495672_0051481 Ga0495672_0051481_1208_2065 279
412 3300047472 Ga0495686_0002065 Ga0495686_0002065_16332_17183 279
413 3300047673 Ga0495593_0022395 Ga0495593_0022395_1558_2397 279
414 3300048910 Ga0496107_0265101 Ga0496107_0265101_298_1137 279
415 3300048911 Ga0496108_0036021 Ga0496108_0036021_846_1685 279
416 3300048912 Ga0496109_0012064 Ga0496109_0012064_4717_5556 279
417 3300048913 Ga0496110_0010261 Ga0496110_0010261_1888_2727 279
418 3300048913 Ga0496110_0425435 Ga0496110_0425435_316_1173 279
419 3300048915 Ga0496112_0010437 Ga0496112_0010437_1665_2504 279
420 3300048916 Ga0496113_0065929 Ga0496113_0065929_1650_2489 279
421 3300048929 Ga0496126_0011832 Ga0496126_0011832_4044_4901 279
422 3300049586 Ga0501070_0096337 Ga0501070_0096337_788_1642 279
423 3300049823 Ga0501044_0015686 Ga0501044_0015686_3545_4384 279
424 3300050492 nmdc:mga0yw44_142712_c1 nmdc:mga0yw44_142712_c1_83_922 279
425 3300053087 Ga0500643_009858 Ga0500643_009858_322_1161 279
426 3300053096 Ga0500641_0024755 Ga0500641_0024755_707_1546 279
427 3300053098 Ga0500650_0024812 Ga0500650_0024812_1624_2481 279
428 3300053730 Ga0500645_000431 Ga0500645_000431_2347_3204 279
429 iso_pu_bacteria 2738541274 2738705460 279
430 iso_pu_bacteria 2738543028 2739332249 279
431 iso_pu_bacteria 2842888712 2842888933 279
432 iso_pu_bacteria 2939582691 2939586582 279
433 3300000545 CNXas_1003870 CNXas_10038702 280
434 3300002239 JGI24034J26672_10008529 JGI24034J26672_100085292 280
435 3300002459 JGI24751J29686_10004841 JGI24751J29686_100048415 280
436 3300005347 Ga0070668_100014542 Ga0070668_1000145426 280
437 3300005347 Ga0070668_100117223 Ga0070668_1001172232 280
438 3300005355 Ga0070671_100001509 Ga0070671_10000150913 280
439 3300005367 Ga0070667_100000042 Ga0070667_100000042151 280
440 3300005367 Ga0070667_100051191 Ga0070667_1000511915 280
441 3300005467 Ga0070706_100614104 Ga0070706_1006141041 280
442 3300005544 Ga0070686_100198675 Ga0070686_1001986751 280
443 3300005548 Ga0070665_100138495 Ga0070665_1001384953 280
444 3300005617 Ga0068859_100003293 Ga0068859_1000032936 280
445 3300005719 Ga0068861_100176270 Ga0068861_1001762702 280
446 3300005719 Ga0068861_100246726 Ga0068861_1002467262 280
447 3300005841 Ga0068863_100006121 Ga0068863_1000061215 280
448 3300005841 Ga0068863_100006656 Ga0068863_1000066566 280
449 3300005842 Ga0068858_100020513 Ga0068858_1000205133 280
450 3300005843 Ga0068860_100000020 Ga0068860_1000000208 280
451 3300005843 Ga0068860_100095371 Ga0068860_1000953714 280
452 3300005844 Ga0068862_100002277 Ga0068862_10000227712 280
453 3300005937 Ga0081455_10203258 Ga0081455_102032582 280
454 3300005981 Ga0081538_10092152 Ga0081538_100921522 280
455 3300006048 Ga0075363_100150373 Ga0075363_1001503732 280
456 3300006048 Ga0075363_100217723 Ga0075363_1002177232 280
457 3300006051 Ga0075364_10060600 Ga0075364_100606002 280
458 3300006177 Ga0075362_10093269 Ga0075362_100932692 280
459 3300006186 Ga0075369_10000536 Ga0075369_100005364 280
460 3300006186 Ga0075369_10009254 Ga0075369_100092545 280
461 3300006353 Ga0075370_10072047 Ga0075370_100720472 280
462 3300006844 Ga0075428_100006651 Ga0075428_1000066517 280
463 3300006846 Ga0075430_100012698 Ga0075430_1000126988 280
464 3300006847 Ga0075431_100020973 Ga0075431_1000209734 280
465 3300006931 Ga0097620_100003293 Ga0097620_1000032936 280
466 3300009092 Ga0105250_10061376 Ga0105250_100613762 280
467 3300009101 Ga0105247_10000009 Ga0105247_10000009104 280
468 3300009147 Ga0114129_10030572 Ga0114129_100305725 280
469 3300009177 Ga0105248_10003175 Ga0105248_100031758 280
470 3300009553 Ga0105249_10000011 Ga0105249_10000011108 280
471 3300010375 Ga0105239_10016200 Ga0105239_100162004 280
472 3300013306 Ga0163162_10191545 Ga0163162_101915452 280
473 3300014325 Ga0163163_10018241 Ga0163163_100182417 280
474 3300014968 Ga0157379_10267003 Ga0157379_102670032 280
475 3300017792 Ga0163161_10258602 Ga0163161_102586022 280
476 3300025900 Ga0207710_10000014 Ga0207710_10000014121 280
477 3300025914 Ga0207671_10046040 Ga0207671_100460403 280
478 3300025925 Ga0207650_10223561 Ga0207650_102235612 280
479 3300025931 Ga0207644_10034636 Ga0207644_100346365 280
480 3300025931 Ga0207644_10146880 Ga0207644_101468802 280
481 3300025939 Ga0207665_10015923 Ga0207665_100159234 280
482 3300025941 Ga0207711_10002575 Ga0207711_100025758 280
483 3300025961 Ga0207712_10000020 Ga0207712_10000020171 280
484 3300025972 Ga0207668_10235880 Ga0207668_102358802 280
485 3300025986 Ga0207658_10000055 Ga0207658_100000558 280
486 3300026035 Ga0207703_10014605 Ga0207703_100146052 280
487 3300026035 Ga0207703_10221580 Ga0207703_102215802 280
488 3300026088 Ga0207641_10001298 Ga0207641_1000129815 280
489 3300026088 Ga0207641_10027447 Ga0207641_100274475 280
490 3300026118 Ga0207675_100078383 Ga0207675_1000783834 280
491 3300026118 Ga0207675_100137067 Ga0207675_1001370673 280
492 3300028379 Ga0268266_10002500 Ga0268266_1000250016 280
493 3300028379 Ga0268266_10010404 Ga0268266_100104046 280
494 3300028380 Ga0268265_10000004 Ga0268265_10000004262 280
495 3300028381 Ga0268264_10000024 Ga0268264_10000024264 280
496 3300028381 Ga0268264_10095391 Ga0268264_100953914 280
497 3300041411 Ga0439466_0002627 Ga0439466_0002627_1717_2559 280
498 3300041411 Ga0439466_0003756 Ga0439466_0003756_4923_5768 280
499 3300041413 Ga0439465_0034849 Ga0439465_0034849_688_1533 280
500 3300042435 Ga0439434_0040879 Ga0439434_0040879_262_1104 280
501 3300042436 Ga0439435_0008559 Ga0439435_0008559_641_1486 280
502 3300044658 Ga0466972_0061243 Ga0466972_0061243_898_1740 280
503 3300044694 Ga0466963_0053554 Ga0466963_0053554_918_1796 280
504 3300044901 Ga0466960_0001664 Ga0466960_0001664_3209_4084 280
505 3300044901 Ga0466960_0088171 Ga0466960_0088171_296_1138 280
506 3300045836 Ga0466958_0239648 Ga0466958_0239648_150_1001 280
507 3300045976 Ga0466967_0034810 Ga0466967_0034810_1970_2812 280
508 3300045976 Ga0466967_0050945 Ga0466967_0050945_2557_3432 280
509 3300045976 Ga0466967_0204905 Ga0466967_0204905_749_1600 280
510 3300047320 Ga0495672_0109180 Ga0495672_0109180_633_1475 280
511 3300048903 Ga0496100_0001549 Ga0496100_0001549_8099_8971 280
512 3300048903 Ga0496100_0156950 Ga0496100_0156950_658_1503 280
513 3300048904 Ga0496101_0000507 Ga0496101_0000507_4600_5490 280
514 3300048904 Ga0496101_0004143 Ga0496101_0004143_5856_6728 280
515 3300048905 Ga0496102_0000248 Ga0496102_0000248_11187_12074 280
516 3300048905 Ga0496102_0002893 Ga0496102_0002893_7394_8239 280
517 3300048905 Ga0496102_0077137 Ga0496102_0077137_2085_2957 280
518 3300048906 Ga0496103_0000268 Ga0496103_0000268_20469_21356 280
519 3300048907 Ga0496104_0004249 Ga0496104_0004249_5913_6785 280
520 3300048908 Ga0496105_0004863 Ga0496105_0004863_2296_3168 280
521 3300048908 Ga0496105_0190193 Ga0496105_0190193_666_1553 280
522 3300048908 Ga0496105_0401943 Ga0496105_0401943_166_1029 280
523 3300048909 Ga0496106_0002441 Ga0496106_0002441_8724_9596 280
524 3300048909 Ga0496106_0010215 Ga0496106_0010215_5209_6099 280
525 3300048910 Ga0496107_0006654 Ga0496107_0006654_1395_2285 280
526 3300048910 Ga0496107_0030884 Ga0496107_0030884_1985_2872 280
527 3300048911 Ga0496108_0009018 Ga0496108_0009018_3994_4884 280
528 3300048911 Ga0496108_0025579 Ga0496108_0025579_2441_3286 280
529 3300048911 Ga0496108_0204225 Ga0496108_0204225_455_1297 280
530 3300048912 Ga0496109_0000098 Ga0496109_0000098_29407_30297 280
531 3300048912 Ga0496109_0074217 Ga0496109_0074217_1478_2323 280
532 3300048912 Ga0496109_0221735 Ga0496109_0221735_473_1318 280
533 3300048913 Ga0496110_0000051 Ga0496110_0000051_26620_27510 280
534 3300048913 Ga0496110_0030444 Ga0496110_0030444_2326_3171 280
535 3300048913 Ga0496110_0167847 Ga0496110_0167847_1082_1927 280
536 3300048914 Ga0496111_0271554 Ga0496111_0271554_46_891 280
537 3300048915 Ga0496112_0108569 Ga0496112_0108569_1798_2643 280
538 3300048917 Ga0496114_0000070 Ga0496114_0000070_23424_24314 280
539 3300048917 Ga0496114_0002313 Ga0496114_0002313_9304_10176 280
540 3300048917 Ga0496114_0397184 Ga0496114_0397184_198_1085 280
541 3300048918 Ga0496115_0035900 Ga0496115_0035900_461_1351 280
542 3300048919 Ga0496116_0002694 Ga0496116_0002694_3398_4288 280
543 3300048919 Ga0496116_0055986 Ga0496116_0055986_919_1806 280
544 3300048920 Ga0496117_0000280 Ga0496117_0000280_53115_54002 280
545 3300048921 Ga0496118_0003322 Ga0496118_0003322_2955_3830 280
546 3300048921 Ga0496118_0005391 Ga0496118_0005391_11307_12194 280
547 3300048922 Ga0496119_0003778 Ga0496119_0003778_9770_10657 280
548 3300048924 Ga0496121_0000016 Ga0496121_0000016_155534_156424 280
549 3300048924 Ga0496121_0001795 Ga0496121_0001795_33170_34057 280
550 3300048925 Ga0496122_0000470 Ga0496122_0000470_58455_59345 280
551 3300048926 Ga0496123_0005802 Ga0496123_0005802_3229_4119 280
552 3300048927 Ga0496124_0000015 Ga0496124_0000015_221966_222856 280
553 3300048927 Ga0496124_0040003 Ga0496124_0040003_3122_4009 280
554 3300048928 Ga0496125_0000021 Ga0496125_0000021_237845_238735 280
555 3300048928 Ga0496125_0008485 Ga0496125_0008485_4951_5838 280
556 3300048929 Ga0496126_0000015 Ga0496126_0000015_237845_238735 280
557 3300048929 Ga0496126_0007978 Ga0496126_0007978_751_1638 280
558 3300049569 Ga0501032_0014568 Ga0501032_0014568_2380_3234 280
559 3300049571 Ga0501034_0001093 Ga0501034_0001093_6689_7543 280
560 3300049571 Ga0501034_0097001 Ga0501034_0097001_1272_2114 280
561 3300049573 Ga0501037_0000319 Ga0501037_0000319_13437_14291 280
562 3300049574 Ga0501038_0005689 Ga0501038_0005689_2916_3770 280
563 3300049579 Ga0501043_0004437 Ga0501043_0004437_5386_6240 280
564 3300049584 Ga0501068_0090346 Ga0501068_0090346_673_1527 280
565 3300049586 Ga0501070_0000458 Ga0501070_0000458_20124_20978 280
566 3300049742 Ga0501080_0206244 Ga0501080_0206244_216_1058 280
567 3300049823 Ga0501044_0035759 Ga0501044_0035759_3533_4387 280
568 3300050490 nmdc:mga03n38_69998_c1 nmdc:mga03n38_69998_c1_479_1321 280
569 3300050491 nmdc:mga00v17_124286_c1 nmdc:mga00v17_124286_c1_51_893 280
570 3300050491 nmdc:mga00v17_166621_c1 nmdc:mga00v17_166621_c1_55_900 280
571 3300050496 nmdc:mga07m45_38912_c2 nmdc:mga07m45_38912_c2_422_1264 280
572 3300050509 nmdc:mga0qj67_9791_c1 nmdc:mga0qj67_9791_c1_5781_6623 280
573 3300050516 nmdc:mga0sz30_19548_c1 nmdc:mga0sz30_19548_c1_1667_2512 280
574 3300050516 nmdc:mga0sz30_37684_c1 nmdc:mga0sz30_37684_c1_215_1057 280
575 iso_pu_bacteria 2842134933 2842138594 280
576 iso_pu_bacteria 2902792274 2902798265 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

17

168

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ihy-assembly1.cif.gz_A structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.9505 13 270
2ihy-assembly1.cif.gz_A structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.9432 13 270
2ihy-assembly1.cif.gz_B structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.9356 12 270
2ihy-assembly1.cif.gz_B structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.9253 12 270
4hzi-assembly1.cif.gz_B crystal structure of the leptospira interrogans atpase subunit of an orphan abc transporter 0.9113 13 271
ID Description Score Start End Superfamily
af_I6YF11_12_276_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9803 7 269 3.40.50.300
af_I6YF11_12_276_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9693 7 269 3.40.50.300
af_Q2FWA1_1_260_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9612 14 271 3.40.50.300
af_Q2FWA1_1_260_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9505 14 271 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9234 15 237 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6I5N1R5-F1-model_v4 ABC transporter ATP-binding protein 0.9213 15 242 GO:0005524
GO:0016887
AF-A0A2N6SMT4-F1-model_v4 ABC transporter 0.9154 14 270 GO:0005524
GO:0016887
AF-A0A0V8J7U4-F1-model_v4 Antibiotic ABC transporter ATP-binding protein 0.9101 13 242 GO:0005524
GO:0016887
AF-A0A2T1N1T5-F1-model_v4 deleted 0.9082 15 237
AF-A0A1C5DDP8-F1-model_v4 Sulfonate transport system ATP-binding protein 0.9062 12 239 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
91.52 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map