F465490

General Info

Members Datasets Scaffolds Average Seq Length
576 247 1152 278

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100142945|Ga0068862_1001429452
Length 309
Sequence VKSRSAGPFLFSSSPVKKLLLQLDTSALPSVFDRVVAHDGGADDVMAYGGLTPDTVRDLVHGCIFTRGPKDLRNTAIFVGGADMAAGETLFGAVRKAFFGPMRVSVMLDSNGSNTTAVAAVAKVVQAAGGDVKGARAIVMAGTGPVGMRAAGLLAKAGADVTITSRRTVDAAFLTALQQRFGGTSAGAIGAVTMTDAAQAAQVLDGAELLVSAGPAGVCMVPRAAWAGRKGLRVVADLNAVPPQGIEGVEAQDNNAARDGVVVFGALGVGGLKMKIHKACIARLFESNDAVLDAETIAEVAQGVAAPKP

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
175 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.08
Rhizosphere 97.92
Stem 0
Stem Tuber 0
Unclassified 4.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100142945 3300005844 Bacteria 2125
2 JGI24746J21847_1016622 3300001977 Bacteria 1050
3 JGI25406J46586_10000234 3300003203 Bacteria 24700
4 Ga0065712_10078963 3300005290 Bacteria 3277
5 Ga0065715_10005910 3300005293 Bacteria 5779
6 Ga0065707_10024418 3300005295 Bacteria 1289
7 Ga0065707_10099298 3300005295 Bacteria 3016
8 Ga0070658_10551897 3300005327 Bacteria 997
9 Ga0070676_10236367 3300005328 Bacteria 1213
10 Ga0070676_10363293 3300005328 Bacteria 998
11 Ga0070683_100000764 3300005329 Bacteria 23609
12 Ga0070683_100001074 3300005329 Bacteria 20520
13 Ga0070683_100731201 3300005329 Bacteria 948
14 Ga0070690_100028575 3300005330 Bacteria 3454
15 Ga0070690_100158855 3300005330 Bacteria 1547
16 Ga0070670_100016535 3300005331 Bacteria 6332
17 Ga0070670_100146911 3300005331 Bacteria 2040
18 Ga0070670_100159450 3300005331 Bacteria 1955
19 Ga0070677_10004624 3300005333 Bacteria 4501
20 Ga0070677_10179036 3300005333 Bacteria 1008
21 Ga0070677_10217199 3300005333 Bacteria 932
22 Ga0068869_100014225 3300005334 Bacteria 5311
23 Ga0068869_100048423 3300005334 Bacteria 3073
24 Ga0070680_100101469 3300005336 Bacteria 2389
25 Ga0070682_100020283 3300005337 Bacteria 3909
26 Ga0068868_100014006 3300005338 Bacteria 5900
27 Ga0068868_100030242 3300005338 Bacteria 4152
28 Ga0068868_100055441 3300005338 Bacteria 3127
29 Ga0068868_100101186 3300005338 Bacteria 2332
30 Ga0070660_100047251 3300005339 Bacteria 3302
31 Ga0070689_100037523 3300005340 Bacteria 3705
32 Ga0070689_100041631 3300005340 Bacteria 3526
33 Ga0070689_100099007 3300005340 Bacteria 2306
34 Ga0070689_100121689 3300005340 Bacteria 2085
35 Ga0070691_10080899 3300005341 Bacteria 1590
36 Ga0070687_100001693 3300005343 Bacteria 7911
37 Ga0070661_100007999 3300005344 Bacteria 7302
38 Ga0070668_100184965 3300005347 Bacteria 1704
39 Ga0070668_100194821 3300005347 Bacteria 1661
40 Ga0070668_100196056 3300005347 Bacteria 1656
41 Ga0070669_100019212 3300005353 Bacteria 4881
42 Ga0070669_100053926 3300005353 Bacteria 2944
43 Ga0070669_100080595 3300005353 Bacteria 2423
44 Ga0070669_100234076 3300005353 Bacteria 1457
45 Ga0070669_100273931 3300005353 Bacteria 1350
46 Ga0070675_100003162 3300005354 Bacteria 12452
47 Ga0070675_100006651 3300005354 Bacteria 8889
48 Ga0070675_100016617 3300005354 Bacteria 5842
49 Ga0070675_100020036 3300005354 Bacteria 5336
50 Ga0070675_100057013 3300005354 Bacteria 3220
51 Ga0070675_100081337 3300005354 Bacteria 2701
52 Ga0070675_100130310 3300005354 Bacteria 2143
53 Ga0070675_100248041 3300005354 Bacteria 1557
54 Ga0070675_100470207 3300005354 Bacteria 1130
55 Ga0070671_100320526 3300005355 Bacteria 1321
56 Ga0070674_100000464 3300005356 Bacteria 20437
57 Ga0070674_100001325 3300005356 Bacteria 13036
58 Ga0070674_100025350 3300005356 Bacteria 3860
59 Ga0070674_100115833 3300005356 Bacteria 1976
60 Ga0070674_100230737 3300005356 Bacteria 1444
61 Ga0070673_100011428 3300005364 Bacteria 6056
62 Ga0070673_100029954 3300005364 Bacteria 4065
63 Ga0070673_100111067 3300005364 Unclassified 2273
64 Ga0070673_100148031 3300005364 Bacteria 1986
65 Ga0070673_100626717 3300005364 Bacteria 983
66 Ga0070688_100020671 3300005365 Bacteria 3831
67 Ga0070688_100054995 3300005365 Bacteria 2495
68 Ga0070688_100226503 3300005365 Bacteria 1320
69 Ga0070688_100287581 3300005365 Bacteria 1183
70 Ga0070659_100123928 3300005366 Bacteria 2095
71 Ga0070659_100267362 3300005366 Unclassified 1420
72 Ga0070709_10018672 3300005434 Bacteria 3999
73 Ga0070700_100014478 3300005441 Bacteria 4454
74 Ga0070694_100375165 3300005444 Unclassified 1108
75 Ga0070708_100095026 3300005445 Bacteria 2720
76 Ga0070708_100256892 3300005445 Bacteria 1642
77 Ga0070678_100006671 3300005456 Bacteria 6791
78 Ga0070678_100391467 3300005456 Bacteria 1205
79 Ga0070681_10011575 3300005458 Bacteria 8731
80 Ga0068867_100086122 3300005459 Bacteria 2376
81 Ga0070685_10019071 3300005466 Bacteria 3697
82 Ga0070685_10037005 3300005466 Bacteria 2762
83 Ga0070685_10144663 3300005466 Bacteria 1501
84 Ga0070706_100347898 3300005467 Bacteria 1382
85 Ga0070707_100138418 3300005468 Bacteria 2369
86 Ga0070707_100231648 3300005468 Bacteria 1798
87 Ga0070698_100049048 3300005471 Bacteria 4312
88 Ga0070698_100090341 3300005471 Bacteria 3046
89 Ga0070698_100133681 3300005471 Bacteria 2435
90 Ga0070698_100176668 3300005471 Bacteria 2075
91 Ga0070699_100009797 3300005518 Bacteria 8291
92 Ga0070679_100008796 3300005530 Bacteria 9521
93 Ga0070684_100019225 3300005535 Bacteria 5647
94 Ga0070684_100053909 3300005535 Bacteria 3502
95 Ga0070684_100368668 3300005535 Bacteria 1322
96 Ga0068853_100587229 3300005539 Bacteria 1057
97 Ga0070672_100009180 3300005543 Bacteria 6806
98 Ga0070672_100035756 3300005543 Bacteria 3777
99 Ga0070686_100320477 3300005544 Bacteria 1155
100 Ga0070696_100003419 3300005546 Bacteria 10582
101 Ga0070665_100011109 3300005548 Bacteria 9098
102 Ga0070665_100049449 3300005548 Bacteria 4218
103 Ga0070665_100087533 3300005548 Unclassified 3120
104 Ga0070665_100122052 3300005548 Bacteria 2607
105 Ga0070704_100058506 3300005549 Bacteria 2746
106 Ga0068855_100040847 3300005563 Bacteria 5501
107 Ga0070664_100005933 3300005564 Bacteria 9866
108 Ga0070664_100022659 3300005564 Bacteria 5180
109 Ga0070664_100109942 3300005564 Bacteria 2404
110 Ga0070664_100159540 3300005564 Bacteria 1995
111 Ga0068857_100349276 3300005577 Bacteria 1369
112 Ga0068852_100072577 3300005616 Bacteria 3025
113 Ga0068859_100076318 3300005617 Bacteria 3392
114 Ga0068859_100115865 3300005617 Bacteria 2744
115 Ga0068859_100332318 3300005617 Bacteria 1614
116 Ga0068864_100094642 3300005618 Bacteria 2641
117 Ga0068864_100137826 3300005618 Bacteria 2198
118 Ga0068864_100343607 3300005618 Bacteria 1407
119 Ga0068864_100425063 3300005618 Bacteria 1266
120 Ga0068866_10214678 3300005718 Bacteria 1157
121 Ga0068866_10222073 3300005718 Bacteria 1140
122 Ga0068861_100010123 3300005719 Bacteria 6538
123 Ga0068861_100155563 3300005719 Bacteria 1880
124 Ga0068861_100525819 3300005719 Bacteria 1073
125 Ga0068870_10010605 3300005840 Bacteria 4239
126 Ga0068870_10019170 3300005840 Bacteria 3314
127 Ga0068870_10020013 3300005840 Bacteria 3253
128 Ga0068863_100230009 3300005841 Bacteria 1788
129 Ga0068858_100001194 3300005842 Bacteria 26900
130 Ga0068858_100052758 3300005842 Bacteria 3762
131 Ga0068858_100129202 3300005842 Bacteria 2368
132 Ga0068858_100165193 3300005842 Bacteria 2086
133 Ga0068860_100077287 3300005843 Bacteria 3165
134 Ga0068860_100225559 3300005843 Bacteria 1820
135 Ga0068860_100327257 3300005843 Bacteria 1505
136 Ga0068860_100422815 3300005843 Bacteria 1321
137 Ga0068860_100436225 3300005843 Bacteria 1300
138 Ga0068862_100098656 3300005844 Bacteria 2552
139 Ga0068862_100132593 3300005844 Bacteria 2205
140 Ga0068862_100163750 3300005844 Bacteria 1987
141 Ga0081539_10000108 3300005985 Bacteria 195322
142 Ga0081539_10000512 3300005985 Bacteria 80576
143 Ga0081539_10003122 3300005985 Bacteria 21148
144 Ga0070717_10097735 3300006028 Bacteria 2488
145 Ga0097621_100001945 3300006237 Bacteria 14088
146 Ga0097621_100007603 3300006237 Bacteria 7766
147 Ga0097621_100077712 3300006237 Bacteria 2756
148 Ga0068871_100001004 3300006358 Bacteria 18915
149 Ga0068871_100021395 3300006358 Bacteria 4970
150 Ga0068871_100346990 3300006358 Bacteria 1312
151 Ga0075428_100001922 3300006844 Bacteria 22297
152 Ga0075428_100011099 3300006844 Bacteria 10023
153 Ga0075428_100021968 3300006844 Bacteria 7066
154 Ga0075428_100027309 3300006844 Bacteria 6318
155 Ga0075428_100040166 3300006844 Bacteria 5149
156 Ga0075428_100090672 3300006844 Unclassified 3334
157 Ga0075428_100143620 3300006844 Bacteria 2594
158 Ga0075428_100149544 3300006844 Bacteria 2537
159 Ga0075430_100007337 3300006846 Bacteria 9314
160 Ga0075430_100009714 3300006846 Bacteria 8130
161 Ga0075430_100013698 3300006846 Bacteria 6914
162 Ga0075430_100024641 3300006846 Bacteria 5118
163 Ga0075430_100091788 3300006846 Bacteria 2539
164 Ga0075430_100331573 3300006846 Bacteria 1257
165 Ga0075430_100541852 3300006846 Unclassified 960
166 Ga0075431_100001258 3300006847 Bacteria 23078
167 Ga0075431_100024780 3300006847 Bacteria 6150
168 Ga0075431_100039573 3300006847 Bacteria 4857
169 Ga0075431_100070504 3300006847 Bacteria 3607
170 Ga0075431_100094564 3300006847 Bacteria 3084
171 Ga0075431_100217381 3300006847 Bacteria 1950
172 Ga0075433_10002356 3300006852 Bacteria 14369
173 Ga0075433_10005074 3300006852 Bacteria 10323
174 Ga0075433_10012935 3300006852 Bacteria 6764
175 Ga0075433_10311228 3300006852 Bacteria 1394
176 Ga0075434_100000820 3300006871 Bacteria 24699
177 Ga0075434_100162789 3300006871 Bacteria 2251
178 Ga0075434_100164498 3300006871 Bacteria 2238
179 Ga0075429_100012799 3300006880 Bacteria 7276
180 Ga0075429_100022945 3300006880 Bacteria 5410
181 Ga0075429_100029231 3300006880 Bacteria 4787
182 Ga0075429_100031416 3300006880 Bacteria 4615
183 Ga0075429_100392744 3300006880 Bacteria 1215
184 Ga0068865_100010737 3300006881 Bacteria 5708
185 Ga0068865_100073785 3300006881 Bacteria 2427
186 Ga0075436_100022172 3300006914 Bacteria 4362
187 Ga0097620_100076315 3300006931 Bacteria 3392
188 Ga0097620_100115857 3300006931 Bacteria 2744
189 Ga0097620_100332294 3300006931 Bacteria 1614
190 Ga0075435_100015245 3300007076 Bacteria 5774
191 Ga0075435_100071743 3300007076 Bacteria 2828
192 Ga0105240_10003253 3300009093 Bacteria 25423
193 Ga0105240_10141888 3300009093 Bacteria 2871
194 Ga0111539_10000509 3300009094 Bacteria 49359
195 Ga0111539_10001913 3300009094 Bacteria 27727
196 Ga0111539_10004464 3300009094 Bacteria 18296
197 Ga0111539_10005748 3300009094 Bacteria 16038
198 Ga0111539_10073528 3300009094 Bacteria 4030
199 Ga0111539_10172022 3300009094 Bacteria 2530
200 Ga0111539_10203017 3300009094 Bacteria 2311
201 Ga0111539_10232859 3300009094 Bacteria 2145
202 Ga0105245_10048378 3300009098 Bacteria 3804
203 Ga0105245_10144702 3300009098 Bacteria 2242
204 Ga0105247_10041500 3300009101 Bacteria 2816
205 Ga0114129_10003815 3300009147 Bacteria 21246
206 Ga0114129_10060520 3300009147 Bacteria 5295
207 Ga0114129_10112752 3300009147 Bacteria 3750
208 Ga0114129_10131673 3300009147 Bacteria 3434
209 Ga0114129_10135024 3300009147 Bacteria 3385
210 Ga0114129_10143232 3300009147 Bacteria 3275
211 Ga0114129_10192175 3300009147 Bacteria 2771
212 Ga0114129_10218123 3300009147 Bacteria 2575
213 Ga0114129_10279573 3300009147 Bacteria 2230
214 Ga0114129_10340404 3300009147 Bacteria 1990
215 Ga0114129_10468695 3300009147 Bacteria 1650
216 Ga0114129_10945332 3300009147 Bacteria 1089
217 Ga0105243_10003070 3300009148 Bacteria 13755
218 Ga0105242_10045872 3300009176 Bacteria 3543
219 Ga0105242_10400278 3300009176 Bacteria 1281
220 Ga0105248_10067368 3300009177 Bacteria 4019
221 Ga0105248_10122728 3300009177 Bacteria 2931
222 Ga0105248_10134039 3300009177 Bacteria 2795
223 Ga0105248_10627204 3300009177 Bacteria 1213
224 Ga0105238_10004289 3300009551 Bacteria 14154
225 Ga0105249_10148266 3300009553 Bacteria 2256
226 Ga0105249_10446686 3300009553 Bacteria 1331
227 Ga0105246_10234182 3300011119 Bacteria 1448
228 Ga0157373_10001979 3300013100 Bacteria 15540
229 Ga0157370_10021330 3300013104 Bacteria 6455
230 Ga0157374_10152177 3300013296 Bacteria 2250
231 Ga0157374_10350692 3300013296 Bacteria 1466
232 Ga0157378_10154090 3300013297 Bacteria 2143
233 Ga0163162_10468571 3300013306 Bacteria 1391
234 Ga0157372_10003100 3300013307 Bacteria 17906
235 Ga0157372_10013456 3300013307 Bacteria 8742
236 Ga0157375_10038331 3300013308 Bacteria 4602
237 Ga0157375_10190145 3300013308 Bacteria 2207
238 Ga0157375_10445050 3300013308 Bacteria 1461
239 Ga0157375_11460062 3300013308 Bacteria 806
240 Ga0163163_10010536 3300014325 Bacteria 8319
241 Ga0163163_10046894 3300014325 Bacteria 4245
242 Ga0163163_10077788 3300014325 Bacteria 3313
243 Ga0157380_10003270 3300014326 Bacteria 11103
244 Ga0157380_10010989 3300014326 Bacteria 6528
245 Ga0157380_10091131 3300014326 Bacteria 2516
246 Ga0157380_10115575 3300014326 Bacteria 2263
247 Ga0157380_10122289 3300014326 Bacteria 2207
248 Ga0157380_10151883 3300014326 Bacteria 2003
249 Ga0157380_10205675 3300014326 Bacteria 1750
250 Ga0157380_10252107 3300014326 Bacteria 1598
251 Ga0157377_10005170 3300014745 Bacteria 6103
252 Ga0157377_10008118 3300014745 Bacteria 5105
253 Ga0157377_10013963 3300014745 Bacteria 4078
254 Ga0157379_10010897 3300014968 Bacteria 7925
255 Ga0157379_10018955 3300014968 Bacteria 6073
256 Ga0157379_10512114 3300014968 Bacteria 1113
257 Ga0157379_10520671 3300014968 Bacteria 1104
258 Ga0157376_10016391 3300014969 Bacteria 5625
259 Ga0157376_10363095 3300014969 Bacteria 1389
260 Ga0157376_10431131 3300014969 Bacteria 1281
261 Ga0157376_10540961 3300014969 Bacteria 1151
262 Ga0157376_10888907 3300014969 Bacteria 908
263 Ga0207673_1001917 3300025290 Bacteria 2323
264 Ga0207697_10004956 3300025315 Bacteria 6275
265 Ga0207682_10001733 3300025893 Bacteria 10004
266 Ga0207682_10125157 3300025893 Bacteria 1143
267 Ga0207682_10140679 3300025893 Bacteria 1083
268 Ga0207688_10006978 3300025901 Bacteria 6146
269 Ga0207680_10011362 3300025903 Bacteria 4498
270 Ga0207680_10094447 3300025903 Bacteria 1909
271 Ga0207645_10002828 3300025907 Bacteria 13472
272 Ga0207645_10021603 3300025907 Bacteria 4195
273 Ga0207645_10069753 3300025907 Bacteria 2248
274 Ga0207645_10140832 3300025907 Bacteria 1572
275 Ga0207643_10025140 3300025908 Bacteria 3290
276 Ga0207643_10051715 3300025908 Bacteria 2332
277 Ga0207643_10175405 3300025908 Bacteria 1295
278 Ga0207705_10403293 3300025909 Bacteria 1058
279 Ga0207684_10264332 3300025910 Bacteria 1485
280 Ga0207707_10003434 3300025912 Bacteria 14054
281 Ga0207707_10011090 3300025912 Bacteria 7837
282 Ga0207695_10007336 3300025913 Bacteria 14078
283 Ga0207695_10019065 3300025913 Bacteria 7912
284 Ga0207660_10002055 3300025917 Bacteria 13364
285 Ga0207662_10009880 3300025918 Bacteria 5265
286 Ga0207662_10270846 3300025918 Bacteria 1121
287 Ga0207657_10073246 3300025919 Bacteria 2895
288 Ga0207652_10003260 3300025921 Bacteria 13441
289 Ga0207652_10006290 3300025921 Bacteria 9585
290 Ga0207646_10525121 3300025922 Bacteria 1065
291 Ga0207681_10015705 3300025923 Bacteria 4726
292 Ga0207681_10036440 3300025923 Bacteria 3245
293 Ga0207681_10078064 3300025923 Bacteria 2330
294 Ga0207681_10121641 3300025923 Bacteria 1915
295 Ga0207681_10136260 3300025923 Bacteria 1822
296 Ga0207681_10157880 3300025923 Bacteria 1706
297 Ga0207694_10015560 3300025924 Bacteria 5736
298 Ga0207694_10258991 3300025924 Bacteria 1425
299 Ga0207650_10001845 3300025925 Bacteria 14942
300 Ga0207650_10027570 3300025925 Bacteria 4067
301 Ga0207650_10063552 3300025925 Bacteria 2760
302 Ga0207650_10218951 3300025925 Bacteria 1531
303 Ga0207659_10000536 3300025926 Bacteria 22653
304 Ga0207659_10006035 3300025926 Bacteria 7391
305 Ga0207659_10009902 3300025926 Bacteria 5963
306 Ga0207659_10051282 3300025926 Bacteria 2934
307 Ga0207659_10139129 3300025926 Bacteria 1883
308 Ga0207659_10259172 3300025926 Bacteria 1414
309 Ga0207659_10394459 3300025926 Bacteria 1156
310 Ga0207687_10118013 3300025927 Bacteria 1980
311 Ga0207644_10008056 3300025931 Bacteria 6894
312 Ga0207644_10189091 3300025931 Bacteria 1618
313 Ga0207690_10237254 3300025932 Unclassified 1403
314 Ga0207706_10016457 3300025933 Bacteria 6675
315 Ga0207706_10058489 3300025933 Bacteria 3395
316 Ga0207706_10101838 3300025933 Bacteria 2527
317 Ga0207709_10037588 3300025935 Bacteria 2878
318 Ga0207709_10040346 3300025935 Bacteria 2795
319 Ga0207670_10034620 3300025936 Bacteria 3266
320 Ga0207669_10002628 3300025937 Bacteria 7692
321 Ga0207669_10004571 3300025937 Bacteria 6103
322 Ga0207669_10111385 3300025937 Bacteria 1835
323 Ga0207669_10179302 3300025937 Bacteria 1517
324 Ga0207704_10141113 3300025938 Unclassified 1686
325 Ga0207691_10010569 3300025940 Bacteria 8853
326 Ga0207691_10034979 3300025940 Bacteria 4668
327 Ga0207691_10084385 3300025940 Bacteria 2851
328 Ga0207691_10087503 3300025940 Bacteria 2795
329 Ga0207691_10114924 3300025940 Bacteria 2391
330 Ga0207691_10117003 3300025940 Bacteria 2365
331 Ga0207711_10040552 3300025941 Bacteria 3961
332 Ga0207711_10152490 3300025941 Bacteria 2086
333 Ga0207711_10160772 3300025941 Bacteria 2033
334 Ga0207689_10008964 3300025942 Bacteria 8669
335 Ga0207689_10023054 3300025942 Bacteria 5227
336 Ga0207689_10272010 3300025942 Bacteria 1403
337 Ga0207661_10003031 3300025944 Bacteria 11623
338 Ga0207661_10031960 3300025944 Bacteria 4072
339 Ga0207679_10012983 3300025945 Bacteria 5450
340 Ga0207679_10049136 3300025945 Bacteria 3076
341 Ga0207679_10119576 3300025945 Bacteria 2095
342 Ga0207679_10167558 3300025945 Bacteria 1805
343 Ga0207679_10254888 3300025945 Bacteria 1494
344 Ga0207651_10002714 3300025960 Bacteria 8483
345 Ga0207651_10048784 3300025960 Bacteria 2864
346 Ga0207651_10083846 3300025960 Bacteria 2306
347 Ga0207651_10094512 3300025960 Bacteria 2198
348 Ga0207651_10319843 3300025960 Bacteria 1297
349 Ga0207712_10045968 3300025961 Bacteria 3025
350 Ga0207712_10090763 3300025961 Bacteria 2249
351 Ga0207668_10049988 3300025972 Bacteria 2878
352 Ga0207668_10157966 3300025972 Bacteria 1763
353 Ga0207640_10003234 3300025981 Bacteria 8776
354 Ga0207677_10091837 3300026023 Bacteria 2209
355 Ga0207677_10125765 3300026023 Bacteria 1937
356 Ga0207703_10047750 3300026035 Bacteria 3453
357 Ga0207703_10071891 3300026035 Bacteria 2858
358 Ga0207708_10003271 3300026075 Bacteria 11940
359 Ga0207708_10157914 3300026075 Bacteria 1789
360 Ga0207641_10021301 3300026088 Bacteria 5329
361 Ga0207641_10027966 3300026088 Bacteria 4658
362 Ga0207641_10201843 3300026088 Bacteria 1834
363 Ga0207648_10083376 3300026089 Bacteria 2788
364 Ga0207648_10136027 3300026089 Bacteria 2165
365 Ga0207648_10411578 3300026089 Bacteria 1226
366 Ga0207676_10074160 3300026095 Bacteria 2740
367 Ga0207676_10151419 3300026095 Bacteria 1998
368 Ga0207676_10170847 3300026095 Bacteria 1894
369 Ga0207676_10188642 3300026095 Bacteria 1812
370 Ga0207676_10547921 3300026095 Bacteria 1105
371 Ga0207674_10450548 3300026116 Bacteria 1244
372 Ga0207675_100004738 3300026118 Bacteria 13097
373 Ga0207675_100008210 3300026118 Bacteria 9838
374 Ga0207675_100034025 3300026118 Bacteria 4749
375 Ga0207675_100042989 3300026118 Bacteria 4219
376 Ga0207675_100073291 3300026118 Unclassified 3204
377 Ga0207675_100077077 3300026118 Bacteria 3122
378 Ga0207675_100139337 3300026118 Bacteria 2304
379 Ga0207675_100370377 3300026118 Bacteria 1407
380 Ga0207683_10004875 3300026121 Bacteria 11544
381 Ga0207683_10054019 3300026121 Bacteria 3522
382 Ga0207683_10105527 3300026121 Bacteria 2519
383 Ga0207683_10172114 3300026121 Bacteria 1961
384 Ga0207683_10211191 3300026121 Bacteria 1767
385 Ga0207698_10055749 3300026142 Bacteria 3048
386 Ga0207698_10101753 3300026142 Bacteria 2383
387 Ga0207428_10000145 3300027907 Bacteria 96603
388 Ga0207428_10001320 3300027907 Bacteria 26408
389 Ga0207428_10013853 3300027907 Bacteria 7025
390 Ga0207428_10341687 3300027907 Bacteria 1103
391 Ga0268266_10034599 3300028379 Bacteria 4297
392 Ga0268266_10147497 3300028379 Bacteria 2117
393 Ga0268264_10141353 3300028381 Bacteria 2147
394 Ga0268264_10253525 3300028381 Bacteria 1636
395 Ga0268264_10273879 3300028381 Bacteria 1578
396 Ga0268264_10320176 3300028381 Bacteria 1466
397 Ga0307408_100005836 3300031548 Bacteria 8191
398 Ga0307408_100055299 3300031548 Bacteria 2873
399 Ga0307408_100194477 3300031548 Bacteria 1637
400 Ga0316576_10058408 3300031727 Bacteria 2822
401 Ga0307405_10000706 3300031731 Bacteria 12958
402 Ga0307405_10192924 3300031731 Bacteria 1473
403 Ga0307413_10005745 3300031824 Bacteria 5576
404 Ga0307410_10000847 3300031852 Bacteria 13004
405 Ga0307410_10043882 3300031852 Bacteria 2966
406 Ga0307410_10078424 3300031852 Bacteria 2312
407 Ga0307410_10205395 3300031852 Bacteria 1507
408 Ga0307406_10019365 3300031901 Bacteria 3992
409 Ga0307407_10003019 3300031903 Bacteria 6767
410 Ga0307407_10013235 3300031903 Bacteria 3996
411 Ga0307412_10120948 3300031911 Bacteria 1885
412 Ga0307412_10333553 3300031911 Bacteria 1211
413 Ga0307409_100012129 3300031995 Bacteria 5475
414 Ga0307416_100005961 3300032002 Bacteria 7573
415 Ga0307414_10004469 3300032004 Bacteria 7595
416 Ga0307411_10005903 3300032005 Bacteria 6075
417 Ga0307411_10086842 3300032005 Bacteria 2171
418 Ga0307411_10130909 3300032005 Bacteria 1833
419 Ga0307415_100006913 3300032126 Bacteria 6160
420 Ga0307415_100030410 3300032126 Bacteria 3466
421 Ga0373940_0015675 3300035088 Bacteria 1867
422 Ga0373936_0018177 3300035113 Bacteria 2713
423 Ga0373943_0007526 3300035170 Bacteria 4891
424 Ga0373946_0005764 3300035171 Bacteria 4482
425 Ga0373955_0096237 3300035172 Bacteria 1694
426 Ga0373961_0006788 3300035241 Bacteria 2754
427 Ga0373962_0016141 3300035242 Bacteria 1923
428 Ga0373924_0012605 3300035410 Bacteria 3161
429 Ga0373933_0025694 3300035724 Bacteria 3379
430 Ga0373947_0025162 3300035725 Bacteria 3471
431 Ga0373937_0243361 3300036401 Bacteria 1695
432 Ga0373937_0368519 3300036401 Bacteria 1362
433 Ga0373925_0009948 3300037068 Bacteria 6906
434 Ga0439441_009233 3300042001 Bacteria 1630
435 Ga0439435_0006479 3300042436 Bacteria 2633
436 Ga0451576_0027045 3300045051 Bacteria 6165
437 Ga0495580_0059962 3300046472 Bacteria 2674
438 Ga0495580_0131185 3300046472 Bacteria 1738
439 Ga0495582_0011458 3300046473 Bacteria 4883
440 Ga0495594_0230610 3300046499 Unclassified 1055
441 Ga0495608_0005193 3300046511 Bacteria 9303
442 Ga0495618_0059922 3300046514 Bacteria 2413
443 Ga0495628_0031619 3300046516 Bacteria 4280
444 Ga0495630_0003370 3300046517 Bacteria 11123
445 Ga0495630_0492486 3300046517 Bacteria 940
446 Ga0495640_0135159 3300046533 Bacteria 1593
447 Ga0495598_0027862 3300046537 Bacteria 1562
448 Ga0495621_0043977 3300046539 Bacteria 1577
449 Ga0495645_0012677 3300046543 Bacteria 5945
450 Ga0495633_0162283 3300046558 Bacteria 1031
451 Ga0495659_0085943 3300046664 Unclassified 1201
452 Ga0495657_0057493 3300046675 Bacteria 2586
453 Ga0495599_0249029 3300046678 Bacteria 1082
454 Ga0495646_0198446 3300046680 Bacteria 1094
455 Ga0495658_0104318 3300046683 Bacteria 1696
456 Ga0495669_0009647 3300046684 Bacteria 4073
457 Ga0495613_0002992 3300046689 Bacteria 12650
458 Ga0495600_0063638 3300046809 Bacteria 2411
459 Ga0495581_0217099 3300047315 Unclassified 1118
460 Ga0495604_0032521 3300047317 Bacteria 4133
461 Ga0495674_0020797 3300047319 Bacteria 6076
462 Ga0495684_0000093 3300047471 Bacteria 63048
463 Ga0495602_0125351 3300048088 Bacteria 2059
464 Ga0496100_0111085 3300048903 Bacteria 1904
465 Ga0496100_0189652 3300048903 Bacteria 1492
466 Ga0496101_0001191 3300048904 Bacteria 15532
467 Ga0496102_0384225 3300048905 Bacteria 1321
468 Ga0496104_0015347 3300048907 Bacteria 6936
469 Ga0496104_0325768 3300048907 Bacteria 1449
470 Ga0496106_0075308 3300048909 Bacteria 2585
471 Ga0496108_0280011 3300048911 Bacteria 1452
472 Ga0496108_0399113 3300048911 Bacteria 1201
473 Ga0496109_0039478 3300048912 Bacteria 4273
474 Ga0496114_0001135 3300048917 Bacteria 20151
475 Ga0496114_0384227 3300048917 Bacteria 1243
476 Ga0501033_0030488 3300049570 Bacteria 4053
477 Ga0501033_0142236 3300049570 Bacteria 1734
478 Ga0501034_0020894 3300049571 Bacteria 6683
479 Ga0501036_0029838 3300049572 Bacteria 4609
480 Ga0501036_0050689 3300049572 Bacteria 3515
481 Ga0501036_0318898 3300049572 Bacteria 1299
482 Ga0501036_0392269 3300049572 Unclassified 1158
483 Ga0501036_0499848 3300049572 Bacteria 1012
484 Ga0501038_0226131 3300049574 Bacteria 1491
485 Ga0501038_0371765 3300049574 Unclassified 1110
486 Ga0501039_0113378 3300049575 Bacteria 2120
487 Ga0501040_0026319 3300049576 Bacteria 3912
488 Ga0501040_0177886 3300049576 Bacteria 1507
489 Ga0501040_0270732 3300049576 Bacteria 1213
490 Ga0501041_0001132 3300049577 Bacteria 14621
491 Ga0501041_0019928 3300049577 Bacteria 4007
492 Ga0501042_0006637 3300049578 Bacteria 7536
493 Ga0501042_0085810 3300049578 Bacteria 2258
494 Ga0501042_0130187 3300049578 Unclassified 1813
495 Ga0501043_0008995 3300049579 Bacteria 7858
496 Ga0501043_0270171 3300049579 Bacteria 1305
497 Ga0501046_0004799 3300049580 Bacteria 12190
498 Ga0501046_0014355 3300049580 Bacteria 6687
499 Ga0501046_0109377 3300049580 Bacteria 2113
500 Ga0501047_0277878 3300049581 Bacteria 1520
501 Ga0501048_0074053 3300049582 Bacteria 2403
502 Ga0501068_0133690 3300049584 Bacteria 1552
503 Ga0501071_0008800 3300049587 Bacteria 6689
504 Ga0501071_0165163 3300049587 Unclassified 1656
505 Ga0501071_0173261 3300049587 Bacteria 1616
506 Ga0501072_0024135 3300049588 Bacteria 4728
507 Ga0501072_0033572 3300049588 Bacteria 4021
508 Ga0501074_0073775 3300049590 Bacteria 2451
509 Ga0501075_0029597 3300049591 Bacteria 4050
510 Ga0501075_0036437 3300049591 Bacteria 3672
511 Ga0501075_0172961 3300049591 Unclassified 1648
512 Ga0501075_0515673 3300049591 Unclassified 912
513 Ga0501076_0011234 3300049592 Bacteria 6666
514 Ga0501076_0047019 3300049592 Bacteria 3411
515 Ga0501076_0167325 3300049592 Bacteria 1792
516 Ga0501079_0025643 3300049741 Bacteria 4519
517 Ga0501080_0477334 3300049742 Unclassified 1116
518 Ga0501081_0002107 3300049743 Bacteria 12438
519 Ga0501081_0079019 3300049743 Bacteria 2301
520 Ga0501081_0082742 3300049743 Unclassified 2249
521 Ga0501035_0294896 3300049822 Unclassified 1368
522 Ga0501045_0074530 3300049824 Unclassified 2499
523 nmdc:mga05p37_177868_c1 3300050507 Bacteria 2591
524 nmdc:mga05p37_19570_c1 3300050507 Bacteria 8189
525 nmdc:mga05p37_254448_c1 3300050507 Bacteria 2105
526 nmdc:mga05p37_44308_c1 3300050507 Bacteria 5473
527 nmdc:mga05p37_70433_c1 3300050507 Bacteria 4301
528 nmdc:mga05p37_793444_c1 3300050507 Bacteria 1037
529 nmdc:mga05p37_92302_c1 3300050507 Bacteria 3730
530 nmdc:mga09592_184539_c1 3300050508 Bacteria 1805
531 nmdc:mga09592_300702_c1 3300050508 Bacteria 1391
532 nmdc:mga09592_3099_c1 3300050508 Bacteria 13493
533 nmdc:mga09592_87808_c1 3300050508 Bacteria 2655
534 nmdc:mga09592_91634_c1 3300050508 Bacteria 2597
535 nmdc:mga0qj67_19126_c1 3300050509 Bacteria 5231
536 nmdc:mga0qj67_223310_c1 3300050509 Bacteria 1529
537 nmdc:mga0qj67_23484_c1 3300050509 Bacteria 4746
538 nmdc:mga0qj67_428522_c1 3300050509 Unclassified 1066
539 nmdc:mga0qj67_5188_c1 3300050509 Bacteria 9508
540 nmdc:mga06r32_14640_c1 3300050510 Bacteria 7120
541 nmdc:mga06r32_17836_c1 3300050510 Bacteria 6487
542 nmdc:mga06r32_22779_c1 3300050510 Bacteria 5793
543 nmdc:mga06r32_4650_c1 3300050510 Bacteria 12319
544 nmdc:mga06r32_81666_c1 3300050510 Bacteria 3148
545 nmdc:mga08y16_126830_c1 3300050511 Bacteria 2654
546 nmdc:mga08y16_1791_c1 3300050511 Bacteria 21772
547 nmdc:mga08y16_17995_c1 3300050511 Bacteria 7443
548 nmdc:mga08y16_282001_c1 3300050511 Bacteria 1714
549 nmdc:mga08y16_327163_c1 3300050511 Unclassified 1577
550 nmdc:mga08y16_455113_c1 3300050511 Bacteria 1305
551 nmdc:mga08y16_712559_c1 3300050511 Bacteria 1002
552 nmdc:mga08y16_97214_c1 3300050511 Bacteria 3066
553 nmdc:mga08y16_98205_c1 3300050511 Bacteria 3050
554 nmdc:mga0n895_45650_c1 3300050512 Bacteria 4276
555 nmdc:mga0n895_632692_c1 3300050512 Bacteria 1070
556 nmdc:mga0n895_95502_c1 3300050512 Bacteria 2977
557 nmdc:mga0rr50_117926_c1 3300050513 Bacteria 2108
558 nmdc:mga0rr50_133082_c2 3300050513 Bacteria 1466
559 nmdc:mga0rr50_15425_c1 3300050513 Bacteria 5044
560 nmdc:mga08x19_11671_c1 3300050514 Bacteria 5290
561 nmdc:mga08x19_328173_c1 3300050514 Bacteria 1066
562 nmdc:mga0a205_139_c1 3300050515 Bacteria 46008
563 nmdc:mga0a205_276959_c1 3300050515 Unclassified 1554
564 nmdc:mga0a205_97882_c1 3300050515 Bacteria 2832
565 Ga0495601_0088300 3300053077 Bacteria 1993
566 Ga0495595_0276124 3300053084 Bacteria 843
567 Ga0495619_0005812 3300053085 Bacteria 7817
568 Ga0501084_0034071 3300054114 Bacteria 4258
569 Ga0501084_0151162 3300054114 Bacteria 1957
570 Ga0501082_0003719 3300060353 Bacteria 13327
571 Ga0501082_0443664 3300060353 Bacteria 1134
572 Ga0501082_0590201 3300060353 Bacteria 972
573 Ga0501082_1031038 3300060353 Bacteria 719
574 Ga0530510_0003325 3300061734 Bacteria 11060
575 Ga0530510_0022377 3300061734 Bacteria 4502
576 Ga0530510_0416710 3300061734 Unclassified 1013
577 Ga0068862_100142945
578 JGI24746J21847_1016622
579 JGI25406J46586_10000234
580 Ga0065712_10078963
581 Ga0065715_10005910
582 Ga0065707_10024418
583 Ga0065707_10099298
584 Ga0070658_10551897
585 Ga0070676_10236367
586 Ga0070676_10363293
587 Ga0070683_100000764
588 Ga0070683_100001074
589 Ga0070683_100731201
590 Ga0070690_100028575
591 Ga0070690_100158855
592 Ga0070670_100016535
593 Ga0070670_100146911
594 Ga0070670_100159450
595 Ga0070677_10004624
596 Ga0070677_10179036
597 Ga0070677_10217199
598 Ga0068869_100014225
599 Ga0068869_100048423
600 Ga0070680_100101469
601 Ga0070682_100020283
602 Ga0068868_100014006
603 Ga0068868_100030242
604 Ga0068868_100055441
605 Ga0068868_100101186
606 Ga0070660_100047251
607 Ga0070689_100037523
608 Ga0070689_100041631
609 Ga0070689_100099007
610 Ga0070689_100121689
611 Ga0070691_10080899
612 Ga0070687_100001693
613 Ga0070661_100007999
614 Ga0070668_100184965
615 Ga0070668_100194821
616 Ga0070668_100196056
617 Ga0070669_100019212
618 Ga0070669_100053926
619 Ga0070669_100080595
620 Ga0070669_100234076
621 Ga0070669_100273931
622 Ga0070675_100003162
623 Ga0070675_100006651
624 Ga0070675_100016617
625 Ga0070675_100020036
626 Ga0070675_100057013
627 Ga0070675_100081337
628 Ga0070675_100130310
629 Ga0070675_100248041
630 Ga0070675_100470207
631 Ga0070671_100320526
632 Ga0070674_100000464
633 Ga0070674_100001325
634 Ga0070674_100025350
635 Ga0070674_100115833
636 Ga0070674_100230737
637 Ga0070673_100011428
638 Ga0070673_100029954
639 Ga0070673_100111067
640 Ga0070673_100148031
641 Ga0070673_100626717
642 Ga0070688_100020671
643 Ga0070688_100054995
644 Ga0070688_100226503
645 Ga0070688_100287581
646 Ga0070659_100123928
647 Ga0070659_100267362
648 Ga0070709_10018672
649 Ga0070700_100014478
650 Ga0070694_100375165
651 Ga0070708_100095026
652 Ga0070708_100256892
653 Ga0070678_100006671
654 Ga0070678_100391467
655 Ga0070681_10011575
656 Ga0068867_100086122
657 Ga0070685_10019071
658 Ga0070685_10037005
659 Ga0070685_10144663
660 Ga0070706_100347898
661 Ga0070707_100138418
662 Ga0070707_100231648
663 Ga0070698_100049048
664 Ga0070698_100090341
665 Ga0070698_100133681
666 Ga0070698_100176668
667 Ga0070699_100009797
668 Ga0070679_100008796
669 Ga0070684_100019225
670 Ga0070684_100053909
671 Ga0070684_100368668
672 Ga0068853_100587229
673 Ga0070672_100009180
674 Ga0070672_100035756
675 Ga0070686_100320477
676 Ga0070696_100003419
677 Ga0070665_100011109
678 Ga0070665_100049449
679 Ga0070665_100087533
680 Ga0070665_100122052
681 Ga0070704_100058506
682 Ga0068855_100040847
683 Ga0070664_100005933
684 Ga0070664_100022659
685 Ga0070664_100109942
686 Ga0070664_100159540
687 Ga0068857_100349276
688 Ga0068852_100072577
689 Ga0068859_100076318
690 Ga0068859_100115865
691 Ga0068859_100332318
692 Ga0068864_100094642
693 Ga0068864_100137826
694 Ga0068864_100343607
695 Ga0068864_100425063
696 Ga0068866_10214678
697 Ga0068866_10222073
698 Ga0068861_100010123
699 Ga0068861_100155563
700 Ga0068861_100525819
701 Ga0068870_10010605
702 Ga0068870_10019170
703 Ga0068870_10020013
704 Ga0068863_100230009
705 Ga0068858_100001194
706 Ga0068858_100052758
707 Ga0068858_100129202
708 Ga0068858_100165193
709 Ga0068860_100077287
710 Ga0068860_100225559
711 Ga0068860_100327257
712 Ga0068860_100422815
713 Ga0068860_100436225
714 Ga0068862_100098656
715 Ga0068862_100132593
716 Ga0068862_100163750
717 Ga0081539_10000108
718 Ga0081539_10000512
719 Ga0081539_10003122
720 Ga0070717_10097735
721 Ga0097621_100001945
722 Ga0097621_100007603
723 Ga0097621_100077712
724 Ga0068871_100001004
725 Ga0068871_100021395
726 Ga0068871_100346990
727 Ga0075428_100001922
728 Ga0075428_100011099
729 Ga0075428_100021968
730 Ga0075428_100027309
731 Ga0075428_100040166
732 Ga0075428_100090672
733 Ga0075428_100143620
734 Ga0075428_100149544
735 Ga0075430_100007337
736 Ga0075430_100009714
737 Ga0075430_100013698
738 Ga0075430_100024641
739 Ga0075430_100091788
740 Ga0075430_100331573
741 Ga0075430_100541852
742 Ga0075431_100001258
743 Ga0075431_100024780
744 Ga0075431_100039573
745 Ga0075431_100070504
746 Ga0075431_100094564
747 Ga0075431_100217381
748 Ga0075433_10002356
749 Ga0075433_10005074
750 Ga0075433_10012935
751 Ga0075433_10311228
752 Ga0075434_100000820
753 Ga0075434_100162789
754 Ga0075434_100164498
755 Ga0075429_100012799
756 Ga0075429_100022945
757 Ga0075429_100029231
758 Ga0075429_100031416
759 Ga0075429_100392744
760 Ga0068865_100010737
761 Ga0068865_100073785
762 Ga0075436_100022172
763 Ga0097620_100076315
764 Ga0097620_100115857
765 Ga0097620_100332294
766 Ga0075435_100015245
767 Ga0075435_100071743
768 Ga0105240_10003253
769 Ga0105240_10141888
770 Ga0111539_10000509
771 Ga0111539_10001913
772 Ga0111539_10004464
773 Ga0111539_10005748
774 Ga0111539_10073528
775 Ga0111539_10172022
776 Ga0111539_10203017
777 Ga0111539_10232859
778 Ga0105245_10048378
779 Ga0105245_10144702
780 Ga0105247_10041500
781 Ga0114129_10003815
782 Ga0114129_10060520
783 Ga0114129_10112752
784 Ga0114129_10131673
785 Ga0114129_10135024
786 Ga0114129_10143232
787 Ga0114129_10192175
788 Ga0114129_10218123
789 Ga0114129_10279573
790 Ga0114129_10340404
791 Ga0114129_10468695
792 Ga0114129_10945332
793 Ga0105243_10003070
794 Ga0105242_10045872
795 Ga0105242_10400278
796 Ga0105248_10067368
797 Ga0105248_10122728
798 Ga0105248_10134039
799 Ga0105248_10627204
800 Ga0105238_10004289
801 Ga0105249_10148266
802 Ga0105249_10446686
803 Ga0105246_10234182
804 Ga0157373_10001979
805 Ga0157370_10021330
806 Ga0157374_10152177
807 Ga0157374_10350692
808 Ga0157378_10154090
809 Ga0163162_10468571
810 Ga0157372_10003100
811 Ga0157372_10013456
812 Ga0157375_10038331
813 Ga0157375_10190145
814 Ga0157375_10445050
815 Ga0157375_11460062
816 Ga0163163_10010536
817 Ga0163163_10046894
818 Ga0163163_10077788
819 Ga0157380_10003270
820 Ga0157380_10010989
821 Ga0157380_10091131
822 Ga0157380_10115575
823 Ga0157380_10122289
824 Ga0157380_10151883
825 Ga0157380_10205675
826 Ga0157380_10252107
827 Ga0157377_10005170
828 Ga0157377_10008118
829 Ga0157377_10013963
830 Ga0157379_10010897
831 Ga0157379_10018955
832 Ga0157379_10512114
833 Ga0157379_10520671
834 Ga0157376_10016391
835 Ga0157376_10363095
836 Ga0157376_10431131
837 Ga0157376_10540961
838 Ga0157376_10888907
839 Ga0207673_1001917
840 Ga0207697_10004956
841 Ga0207682_10001733
842 Ga0207682_10125157
843 Ga0207682_10140679
844 Ga0207688_10006978
845 Ga0207680_10011362
846 Ga0207680_10094447
847 Ga0207645_10002828
848 Ga0207645_10021603
849 Ga0207645_10069753
850 Ga0207645_10140832
851 Ga0207643_10025140
852 Ga0207643_10051715
853 Ga0207643_10175405
854 Ga0207705_10403293
855 Ga0207684_10264332
856 Ga0207707_10003434
857 Ga0207707_10011090
858 Ga0207695_10007336
859 Ga0207695_10019065
860 Ga0207660_10002055
861 Ga0207662_10009880
862 Ga0207662_10270846
863 Ga0207657_10073246
864 Ga0207652_10003260
865 Ga0207652_10006290
866 Ga0207646_10525121
867 Ga0207681_10015705
868 Ga0207681_10036440
869 Ga0207681_10078064
870 Ga0207681_10121641
871 Ga0207681_10136260
872 Ga0207681_10157880
873 Ga0207694_10015560
874 Ga0207694_10258991
875 Ga0207650_10001845
876 Ga0207650_10027570
877 Ga0207650_10063552
878 Ga0207650_10218951
879 Ga0207659_10000536
880 Ga0207659_10006035
881 Ga0207659_10009902
882 Ga0207659_10051282
883 Ga0207659_10139129
884 Ga0207659_10259172
885 Ga0207659_10394459
886 Ga0207687_10118013
887 Ga0207644_10008056
888 Ga0207644_10189091
889 Ga0207690_10237254
890 Ga0207706_10016457
891 Ga0207706_10058489
892 Ga0207706_10101838
893 Ga0207709_10037588
894 Ga0207709_10040346
895 Ga0207670_10034620
896 Ga0207669_10002628
897 Ga0207669_10004571
898 Ga0207669_10111385
899 Ga0207669_10179302
900 Ga0207704_10141113
901 Ga0207691_10010569
902 Ga0207691_10034979
903 Ga0207691_10084385
904 Ga0207691_10087503
905 Ga0207691_10114924
906 Ga0207691_10117003
907 Ga0207711_10040552
908 Ga0207711_10152490
909 Ga0207711_10160772
910 Ga0207689_10008964
911 Ga0207689_10023054
912 Ga0207689_10272010
913 Ga0207661_10003031
914 Ga0207661_10031960
915 Ga0207679_10012983
916 Ga0207679_10049136
917 Ga0207679_10119576
918 Ga0207679_10167558
919 Ga0207679_10254888
920 Ga0207651_10002714
921 Ga0207651_10048784
922 Ga0207651_10083846
923 Ga0207651_10094512
924 Ga0207651_10319843
925 Ga0207712_10045968
926 Ga0207712_10090763
927 Ga0207668_10049988
928 Ga0207668_10157966
929 Ga0207640_10003234
930 Ga0207677_10091837
931 Ga0207677_10125765
932 Ga0207703_10047750
933 Ga0207703_10071891
934 Ga0207708_10003271
935 Ga0207708_10157914
936 Ga0207641_10021301
937 Ga0207641_10027966
938 Ga0207641_10201843
939 Ga0207648_10083376
940 Ga0207648_10136027
941 Ga0207648_10411578
942 Ga0207676_10074160
943 Ga0207676_10151419
944 Ga0207676_10170847
945 Ga0207676_10188642
946 Ga0207676_10547921
947 Ga0207674_10450548
948 Ga0207675_100004738
949 Ga0207675_100008210
950 Ga0207675_100034025
951 Ga0207675_100042989
952 Ga0207675_100073291
953 Ga0207675_100077077
954 Ga0207675_100139337
955 Ga0207675_100370377
956 Ga0207683_10004875
957 Ga0207683_10054019
958 Ga0207683_10105527
959 Ga0207683_10172114
960 Ga0207683_10211191
961 Ga0207698_10055749
962 Ga0207698_10101753
963 Ga0207428_10000145
964 Ga0207428_10001320
965 Ga0207428_10013853
966 Ga0207428_10341687
967 Ga0268266_10034599
968 Ga0268266_10147497
969 Ga0268264_10141353
970 Ga0268264_10253525
971 Ga0268264_10273879
972 Ga0268264_10320176
973 Ga0307408_100005836
974 Ga0307408_100055299
975 Ga0307408_100194477
976 Ga0316576_10058408
977 Ga0307405_10000706
978 Ga0307405_10192924
979 Ga0307413_10005745
980 Ga0307410_10000847
981 Ga0307410_10043882
982 Ga0307410_10078424
983 Ga0307410_10205395
984 Ga0307406_10019365
985 Ga0307407_10003019
986 Ga0307407_10013235
987 Ga0307412_10120948
988 Ga0307412_10333553
989 Ga0307409_100012129
990 Ga0307416_100005961
991 Ga0307414_10004469
992 Ga0307411_10005903
993 Ga0307411_10086842
994 Ga0307411_10130909
995 Ga0307415_100006913
996 Ga0307415_100030410
997 Ga0373940_0015675
998 Ga0373936_0018177
999 Ga0373943_0007526
1000 Ga0373946_0005764
1001 Ga0373955_0096237
1002 Ga0373961_0006788
1003 Ga0373962_0016141
1004 Ga0373924_0012605
1005 Ga0373933_0025694
1006 Ga0373947_0025162
1007 Ga0373937_0243361
1008 Ga0373937_0368519
1009 Ga0373925_0009948
1010 Ga0439441_009233
1011 Ga0439435_0006479
1012 Ga0451576_0027045
1013 Ga0495580_0059962
1014 Ga0495580_0131185
1015 Ga0495582_0011458
1016 Ga0495594_0230610
1017 Ga0495608_0005193
1018 Ga0495618_0059922
1019 Ga0495628_0031619
1020 Ga0495630_0003370
1021 Ga0495630_0492486
1022 Ga0495640_0135159
1023 Ga0495598_0027862
1024 Ga0495621_0043977
1025 Ga0495645_0012677
1026 Ga0495633_0162283
1027 Ga0495659_0085943
1028 Ga0495657_0057493
1029 Ga0495599_0249029
1030 Ga0495646_0198446
1031 Ga0495658_0104318
1032 Ga0495669_0009647
1033 Ga0495613_0002992
1034 Ga0495600_0063638
1035 Ga0495581_0217099
1036 Ga0495604_0032521
1037 Ga0495674_0020797
1038 Ga0495684_0000093
1039 Ga0495602_0125351
1040 Ga0496100_0111085
1041 Ga0496100_0189652
1042 Ga0496101_0001191
1043 Ga0496102_0384225
1044 Ga0496104_0015347
1045 Ga0496104_0325768
1046 Ga0496106_0075308
1047 Ga0496108_0280011
1048 Ga0496108_0399113
1049 Ga0496109_0039478
1050 Ga0496114_0001135
1051 Ga0496114_0384227
1052 Ga0501033_0030488
1053 Ga0501033_0142236
1054 Ga0501034_0020894
1055 Ga0501036_0029838
1056 Ga0501036_0050689
1057 Ga0501036_0318898
1058 Ga0501036_0392269
1059 Ga0501036_0499848
1060 Ga0501038_0226131
1061 Ga0501038_0371765
1062 Ga0501039_0113378
1063 Ga0501040_0026319
1064 Ga0501040_0177886
1065 Ga0501040_0270732
1066 Ga0501041_0001132
1067 Ga0501041_0019928
1068 Ga0501042_0006637
1069 Ga0501042_0085810
1070 Ga0501042_0130187
1071 Ga0501043_0008995
1072 Ga0501043_0270171
1073 Ga0501046_0004799
1074 Ga0501046_0014355
1075 Ga0501046_0109377
1076 Ga0501047_0277878
1077 Ga0501048_0074053
1078 Ga0501068_0133690
1079 Ga0501071_0008800
1080 Ga0501071_0165163
1081 Ga0501071_0173261
1082 Ga0501072_0024135
1083 Ga0501072_0033572
1084 Ga0501074_0073775
1085 Ga0501075_0029597
1086 Ga0501075_0036437
1087 Ga0501075_0172961
1088 Ga0501075_0515673
1089 Ga0501076_0011234
1090 Ga0501076_0047019
1091 Ga0501076_0167325
1092 Ga0501079_0025643
1093 Ga0501080_0477334
1094 Ga0501081_0002107
1095 Ga0501081_0079019
1096 Ga0501081_0082742
1097 Ga0501035_0294896
1098 Ga0501045_0074530
1099 nmdc:mga05p37_177868_c1
1100 nmdc:mga05p37_19570_c1
1101 nmdc:mga05p37_254448_c1
1102 nmdc:mga05p37_44308_c1
1103 nmdc:mga05p37_70433_c1
1104 nmdc:mga05p37_793444_c1
1105 nmdc:mga05p37_92302_c1
1106 nmdc:mga09592_184539_c1
1107 nmdc:mga09592_300702_c1
1108 nmdc:mga09592_3099_c1
1109 nmdc:mga09592_87808_c1
1110 nmdc:mga09592_91634_c1
1111 nmdc:mga0qj67_19126_c1
1112 nmdc:mga0qj67_223310_c1
1113 nmdc:mga0qj67_23484_c1
1114 nmdc:mga0qj67_428522_c1
1115 nmdc:mga0qj67_5188_c1
1116 nmdc:mga06r32_14640_c1
1117 nmdc:mga06r32_17836_c1
1118 nmdc:mga06r32_22779_c1
1119 nmdc:mga06r32_4650_c1
1120 nmdc:mga06r32_81666_c1
1121 nmdc:mga08y16_126830_c1
1122 nmdc:mga08y16_1791_c1
1123 nmdc:mga08y16_17995_c1
1124 nmdc:mga08y16_282001_c1
1125 nmdc:mga08y16_327163_c1
1126 nmdc:mga08y16_455113_c1
1127 nmdc:mga08y16_712559_c1
1128 nmdc:mga08y16_97214_c1
1129 nmdc:mga08y16_98205_c1
1130 nmdc:mga0n895_45650_c1
1131 nmdc:mga0n895_632692_c1
1132 nmdc:mga0n895_95502_c1
1133 nmdc:mga0rr50_117926_c1
1134 nmdc:mga0rr50_133082_c2
1135 nmdc:mga0rr50_15425_c1
1136 nmdc:mga08x19_11671_c1
1137 nmdc:mga08x19_328173_c1
1138 nmdc:mga0a205_139_c1
1139 nmdc:mga0a205_276959_c1
1140 nmdc:mga0a205_97882_c1
1141 Ga0495601_0088300
1142 Ga0495595_0276124
1143 Ga0495619_0005812
1144 Ga0501084_0034071
1145 Ga0501084_0151162
1146 Ga0501082_0003719
1147 Ga0501082_0443664
1148 Ga0501082_0590201
1149 Ga0501082_1031038
1150 Ga0530510_0003325
1151 Ga0530510_0022377
1152 Ga0530510_0416710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09176

Mpt_N

Methylene-tetrahydromethanopterin dehydrogenase, N-terminal

31

111

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tm3-assembly1.cif.gz_A structure of methylene-tetrahydromethanopterin dehydrogenase from methylorubrum extorquens am1 in a close conformation containing nadp+ and methylene-h4mpt 0.9214 1 268
6tm3-assembly1.cif.gz_A structure of methylene-tetrahydromethanopterin dehydrogenase from methylorubrum extorquens am1 in a close conformation containing nadp+ and methylene-h4mpt 0.9149 1 268
2z1n-assembly1.cif.gz_A crystal structure of ape0912 from aeropyrum pernix k1 0.8709 101 182
3ftp-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.8541 101 178
1gee-assembly1.cif.gz_A crystal structure of glucose dehydrogenase mutant q252l complexed with nad+ 0.8434 101 179
ID Description Score Start End Superfamily
1lu9A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9571 91 237 3.40.50.720
1luaC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylene-tetrahydromethanopterin dehydrogenase, N-terminal domain 0.9351 1 268 3.40.50.10280
1lu9A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9266 91 237 3.40.50.720
2z1nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8709 101 182 3.40.50.720
1jayB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.866 105 180 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A351KV42-F1-model_v4 Methylenetetrahydrofolate dehydrogenase 0.9753 161 268
AF-A0A2G2J921-F1-model_v4 deleted 0.9697 65 268
AF-A0A7Y4Z9D4-F1-model_v4 Methylenetetrahydrofolate dehydrogenase 0.9677 144 268
AF-Q6PW18-F1-model_v4 Methylene tetrahydrofolate/methylene tetrahydromethanopterin dehydrogenase-like protein 0.9634 45 208
AF-A0A519XJP6-F1-model_v4 deleted 0.9626 115 268

Map