F465459

General Info

Members Datasets Scaffolds Average Seq Length
575 347 473 438

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2995726249|2995727289
Length 493
Sequence LLYILGILIVLVGLALSIGLHEIGHLLPAKLFGVKVTQYMVGFGKTLWSRRKGETEYGVKAIPLGGYVAMTGMYPPQKPGEAPRASTTGFLNTVVQEGAPTRQESASGERVEHRSDTIAEIERIGDPGEPLLDPLGDAAGESRRGIAGLVDDARLASAETIDAGEDHRTFYRLPMWKKIVIMLGGPFMNLVLAFVFFGIVLVGFGLPQNSTTLGQVSECLLPADSTATSCGADAEAAPAARAGLLPGDRIVSVDGERIESWDQFRTLVGASPGEELDVRIERDGAGRDVVLTPVPNERAVVGADGAAVTASDGTVVTETVGMIGATPASETVPQPITAVPAYVGQNVERVVGVVVHLPQRMVDIWNAAFGAEERDPNGPISVVGVGRLAGEVVSLDAPVAARAQVMVGLLGSLNVALFVFNLIPLMPLDGGHVAGALYEGAKRGIARLRRKPDPGPIDTARMVPVTFAVVVVLGAMSVLLIYADLVKPVSLFG

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
3 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
4 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
5 2643221553 Microbacterium sp. Root553 Isolate Unclassified
6 2643221561 Nocardioides sp. Root151 Isolate Unclassified
7 2643221566 Microbacterium sp. Root166 Isolate Unclassified
8 2643221572 Leifsonia sp. Root60 Isolate Unclassified
9 2643221597 Microbacterium sp. Root180 Isolate Unclassified
10 2643221630 Microbacterium sp. Root322 Isolate Unclassified
11 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
12 2643221641 Nocardioides sp. Root122 Isolate Unclassified
13 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
14 2643221696 Nocardioides sp. Root140 Isolate Unclassified
15 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
16 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
17 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
18 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
19 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
20 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
21 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
22 2739367898 Nocardioides sp. CF479 Isolate Unclassified
23 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
24 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
25 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
26 2773857759 Microbacterium sp. 1294 Isolate Unclassified
27 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
28 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
29 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
30 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
31 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
32 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
33 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
34 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
35 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
36 2808606394 Promicromonospora sp. C35 Isolate Unclassified
37 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
38 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
39 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
40 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
41 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
42 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
43 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
44 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
45 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
46 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
47 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
48 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
49 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
50 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
51 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
52 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
53 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
54 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
55 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
56 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
57 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
58 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
59 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
60 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
61 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
62 2919395869 Microbacterium resistens 2980 Isolate Unclassified
63 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
64 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
65 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
66 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
67 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
68 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
69 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
70 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
71 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
72 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
73 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
74 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
75 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
76 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
77 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
78 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
79 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
80 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
81 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
82 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
83 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
84 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
85 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
86 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
87 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
88 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
89 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
90 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
91 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
92 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
93 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
94 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
95 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
96 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
97 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
98 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
99 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
100 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
101 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
102 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
103 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
104 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
105 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
106 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
107 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
108 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
109 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
110 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
111 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
112 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
113 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
114 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
115 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
116 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
117 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
118 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
119 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
120 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
121 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
122 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
123 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
124 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
125 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
126 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
127 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
128 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
129 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
130 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
131 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
132 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
133 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
134 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
135 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
136 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
137 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
138 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
139 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
140 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
141 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
142 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
143 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
145 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
146 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
148 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
149 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
150 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
151 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
152 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
153 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
154 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
155 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
156 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
157 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
158 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
159 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
160 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
161 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
162 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
163 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
164 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
165 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
168 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
169 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
170 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
171 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
173 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
174 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
175 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
231 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
232 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
233 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
236 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
237 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
238 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
239 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
240 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
241 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
242 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
243 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
244 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
245 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
246 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
247 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
248 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
249 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
250 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
253 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
258 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
261 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
265 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
266 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
268 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
269 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
274 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
291 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
308 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
318 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
319 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
320 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
325 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
326 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
327 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
328 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
329 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
330 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
331 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
332 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
333 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
334 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
337 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
338 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
339 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
340 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
341 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
342 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
343 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
344 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
345 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
346 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
347 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.74
Metatranscriptomes 0.52
Isolates 17.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 6.43
Nodule 0.17
Rhizoplane 5.74
Rhizosphere 71.83
Stem 0
Stem Tuber 0
Unclassified 15.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1001146 3300000549 Bacteria 4000
2 LJQas_1002602 3300000549 Bacteria 2488
3 JGI24735J21928_10008016 3300002067 Bacteria 3430
4 JGI25164J39214_1000498 3300002772 Bacteria 19187
5 JGI25165J46597_1000002 3300003214 Bacteria 765387
6 rootH1_10033147 3300003316 Bacteria 2647
7 rootH1_10033148 3300003316 Bacteria 2616
8 rootH2_10149154 3300003320 Bacteria 2858
9 rootL2_10166258 3300003322 Bacteria 2386
10 JGI25407J50210_10023292 3300003373 Bacteria 1607
11 Ga0006562J51391_1027960 3300003578 Bacteria 3780
12 Ga0006562J51391_1027961 3300003578 Bacteria 3380
13 Ga0006562J51391_1051275 3300003578 Bacteria 2338
14 Ga0055542_1009234 3300003762 Bacteria 1873
15 Ga0070658_10000135 3300005327 Bacteria 64641
16 Ga0070658_10021992 3300005327 Bacteria 5115
17 Ga0070658_10073861 3300005327 Bacteria 2797
18 Ga0070658_10165000 3300005327 Bacteria 1859
19 Ga0070676_10035155 3300005328 Bacteria 2880
20 Ga0070683_100082612 3300005329 Bacteria 3009
21 Ga0070690_100025619 3300005330 Bacteria 3632
22 Ga0070682_100057467 3300005337 Bacteria 2451
23 Ga0070660_100011503 3300005339 Bacteria 6293
24 Ga0070669_100012102 3300005353 Bacteria 6123
25 Ga0070671_100045567 3300005355 Bacteria 3646
26 Ga0070674_100080354 3300005356 Bacteria 2328
27 Ga0070673_100005433 3300005364 Bacteria 8154
28 Ga0070659_100005597 3300005366 Bacteria 9029
29 Ga0070667_100044796 3300005367 Bacteria 3717
30 Ga0070700_100050195 3300005441 Bacteria 2593
31 Ga0070663_100092678 3300005455 Bacteria 2241
32 Ga0070663_100172361 3300005455 Bacteria 1673
33 Ga0070678_100013158 3300005456 Bacteria 5176
34 Ga0070662_100098483 3300005457 Bacteria 2208
35 Ga0070665_100314415 3300005548 Bacteria 1570
36 Ga0068855_100004547 3300005563 Bacteria 16940
37 Ga0068855_100062095 3300005563 Bacteria 4363
38 Ga0070664_100094486 3300005564 Bacteria 2593
39 Ga0068857_100003425 3300005577 Bacteria 13229
40 Ga0068856_100005605 3300005614 Bacteria 12355
41 Ga0068856_100280026 3300005614 Bacteria 1684
42 Ga0068852_100015429 3300005616 Bacteria 5925
43 Ga0068866_10005801 3300005718 Bacteria 5123
44 Ga0068851_10000005 3300005834 Bacteria 262808
45 Ga0068858_100000058 3300005842 Bacteria 117238
46 Ga0068860_100107514 3300005843 Bacteria 2666
47 Ga0081455_10001480 3300005937 Bacteria 29049
48 Ga0081455_10016613 3300005937 Bacteria 7096
49 Ga0081455_10019438 3300005937 Bacteria 6426
50 Ga0081455_10020668 3300005937 Bacteria 6191
51 Ga0081538_10000448 3300005981 Bacteria 46350
52 Ga0081539_10000314 3300005985 Bacteria 108451
53 Ga0075365_10009210 3300006038 Bacteria 5662
54 Ga0075365_10021120 3300006038 Bacteria 4055
55 Ga0075364_10053430 3300006051 Bacteria 2641
56 Ga0075364_10078994 3300006051 Bacteria 2174
57 Ga0075432_10000034 3300006058 Bacteria 25209
58 Ga0075432_10000291 3300006058 Bacteria 13962
59 Ga0075432_10003170 3300006058 Bacteria 5548
60 Ga0075367_10012766 3300006178 Bacteria 4493
61 Ga0075367_10045048 3300006178 Bacteria 2588
62 Ga0075369_10029924 3300006186 Bacteria 2291
63 Ga0075370_10014225 3300006353 Bacteria 4240
64 Ga0075428_100023539 3300006844 Bacteria 6818
65 Ga0075428_100289016 3300006844 Bacteria 1764
66 Ga0075433_10000261 3300006852 Bacteria 30721
67 Ga0075434_100010450 3300006871 Bacteria 8701
68 Ga0075434_100022930 3300006871 Bacteria 6076
69 Ga0068865_100013532 3300006881 Bacteria 5158
70 Ga0075435_100002112 3300007076 Bacteria 13075
71 Ga0075435_100005111 3300007076 Bacteria 9118
72 Ga0105244_10005033 3300009036 Bacteria 8893
73 Ga0105244_10006140 3300009036 Bacteria 7842
74 Ga0105240_10009128 3300009093 Bacteria 14078
75 Ga0111539_10000342 3300009094 Bacteria 57280
76 Ga0111539_10021083 3300009094 Bacteria 8024
77 Ga0105245_10030908 3300009098 Bacteria 4737
78 Ga0105245_10034137 3300009098 Bacteria 4510
79 Ga0105247_10034295 3300009101 Bacteria 3091
80 Ga0114129_10002953 3300009147 Bacteria 23790
81 Ga0105243_10006946 3300009148 Bacteria 8718
82 Ga0105243_10062294 3300009148 Bacteria 2986
83 Ga0105241_10000772 3300009174 Bacteria 24349
84 Ga0105242_10185099 3300009176 Bacteria 1840
85 Ga0105242_10207518 3300009176 Bacteria 1744
86 Ga0105248_10000784 3300009177 Bacteria 35696
87 Ga0105248_10189910 3300009177 Bacteria 2315
88 Ga0105237_10002853 3300009545 Bacteria 21014
89 Ga0105237_10038161 3300009545 Bacteria 4852
90 Ga0105237_10174965 3300009545 Bacteria 2147
91 Ga0105238_10063071 3300009551 Bacteria 3706
92 Ga0105238_10065664 3300009551 Bacteria 3630
93 Ga0105238_10303946 3300009551 Bacteria 1579
94 Ga0105249_10017185 3300009553 Bacteria 6423
95 Ga0105249_10048165 3300009553 Bacteria 3886
96 Ga0105239_10017157 3300010375 Bacteria 8003
97 Ga0105239_10022983 3300010375 Bacteria 6874
98 Ga0105239_10088098 3300010375 Bacteria 3422
99 Ga0105239_10417129 3300010375 Bacteria 1520
100 Ga0105246_10021222 3300011119 Bacteria 4177
101 Ga0105246_10027979 3300011119 Bacteria 3700
102 Ga0157371_10000615 3300013102 Bacteria 42407
103 Ga0157370_10060528 3300013104 Bacteria 3595
104 Ga0157369_10029825 3300013105 Bacteria 6025
105 Ga0157369_10031102 3300013105 Bacteria 5882
106 Ga0157369_10315553 3300013105 Bacteria 1625
107 Ga0157369_10331689 3300013105 Bacteria 1581
108 Ga0171462_1001 3300013250 Bacteria 1135406
109 Ga0157374_10104508 3300013296 Bacteria 2719
110 Ga0163162_10028481 3300013306 Bacteria 5527
111 Ga0157372_10092557 3300013307 Bacteria 3439
112 Ga0157375_10287603 3300013308 Bacteria 1807
113 Ga0163163_10069117 3300014325 Bacteria 3516
114 Ga0157380_10083063 3300014326 Bacteria 2623
115 Ga0157380_10156511 3300014326 Bacteria 1976
116 Ga0157379_10205499 3300014968 Bacteria 1781
117 Ga0163161_10207420 3300017792 Bacteria 1513
118 Ga0207427_100099 3300025231 Bacteria 121767
119 Ga0209437_100360 3300025233 Bacteria 50855
120 Ga0209646_1000098 3300025246 Bacteria 180711
121 Ga0209148_1000907 3300025254 Bacteria 20039
122 Ga0209759_1013915 3300025256 Bacteria 2153
123 Ga0209129_1000079 3300025258 Bacteria 187308
124 Ga0209233_1000001 3300025261 Bacteria 2992747
125 Ga0209455_1000886 3300025272 Bacteria 15732
126 Ga0209025_1001309 3300025294 Bacteria 33979
127 Ga0209051_1019723 3300025303 Bacteria 2931
128 Ga0207697_10001905 3300025315 Bacteria 11109
129 Ga0207697_10023971 3300025315 Bacteria 2499
130 Ga0207656_10000001 3300025321 Bacteria 1323684
131 Ga0207656_10000003 3300025321 Bacteria 771644
132 Ga0207656_10000004 3300025321 Bacteria 632320
133 Ga0207655_1019638 3300025728 Bacteria 3519
134 Ga0207655_1026544 3300025728 Bacteria 2780
135 Ga0207682_10067161 3300025893 Bacteria 1513
136 Ga0207688_10044321 3300025901 Bacteria 2479
137 Ga0207647_10040888 3300025904 Bacteria 2918
138 Ga0207645_10009994 3300025907 Bacteria 6534
139 Ga0207705_10000001 3300025909 Bacteria 2061880
140 Ga0207705_10057837 3300025909 Bacteria 2797
141 Ga0207654_10000003 3300025911 Bacteria 1030378
142 Ga0207695_10017181 3300025913 Bacteria 8431
143 Ga0207695_10096594 3300025913 Bacteria 2956
144 Ga0207671_10000001 3300025914 Bacteria 1318881
145 Ga0207671_10058885 3300025914 Bacteria 2848
146 Ga0207657_10022957 3300025919 Bacteria 5822
147 Ga0207657_10033092 3300025919 Bacteria 4664
148 Ga0207681_10133631 3300025923 Bacteria 1838
149 Ga0207694_10000039 3300025924 Bacteria 186164
150 Ga0207694_10130211 3300025924 Bacteria 2016
151 Ga0207659_10100422 3300025926 Bacteria 2180
152 Ga0207687_10006838 3300025927 Bacteria 7513
153 Ga0207690_10001473 3300025932 Bacteria 14697
154 Ga0207690_10065011 3300025932 Bacteria 2493
155 Ga0207706_10047880 3300025933 Bacteria 3782
156 Ga0207686_10058276 3300025934 Bacteria 2434
157 Ga0207686_10133089 3300025934 Unclassified 1708
158 Ga0207704_10017715 3300025938 Bacteria 3701
159 Ga0207691_10000777 3300025940 Bacteria 31597
160 Ga0207711_10000881 3300025941 Bacteria 29003
161 Ga0207661_10077286 3300025944 Bacteria 2737
162 Ga0207667_10002609 3300025949 Bacteria 22348
163 Ga0207667_10011964 3300025949 Bacteria 10046
164 Ga0207658_10021178 3300025986 Bacteria 4509
165 Ga0207703_10000026 3300026035 Bacteria 211591
166 Ga0207639_10155670 3300026041 Bacteria 1919
167 Ga0207678_10122305 3300026067 Bacteria 2221
168 Ga0207678_10256452 3300026067 Bacteria 1498
169 Ga0207702_10086297 3300026078 Bacteria 2737
170 Ga0207648_10037184 3300026089 Bacteria 4287
171 Ga0207674_10006493 3300026116 Bacteria 13753
172 Ga0207683_10031058 3300026121 Bacteria 4634
173 Ga0207698_10001479 3300026142 Bacteria 13677
174 Ga0207428_10000436 3300027907 Bacteria 51096
175 Ga0207428_10007504 3300027907 Bacteria 9938
176 Ga0207428_10014981 3300027907 Bacteria 6719
177 Ga0307408_100002076 3300031548 Bacteria 14432
178 Ga0307408_100002127 3300031548 Bacteria 14211
179 Ga0307408_100005525 3300031548 Bacteria 8446
180 Ga0307408_100023047 3300031548 Bacteria 4237
181 Ga0307408_100036732 3300031548 Bacteria 3445
182 Ga0307408_100037120 3300031548 Bacteria 3430
183 Ga0307514_10010121 3300031649 Bacteria 7894
184 Ga0307514_10057237 3300031649 Bacteria 2988
185 Ga0307405_10044237 3300031731 Bacteria 2722
186 Ga0307405_10088483 3300031731 Bacteria 2043
187 Ga0307405_10104562 3300031731 Bacteria 1905
188 Ga0307405_10132761 3300031731 Bacteria 1723
189 Ga0307413_10003304 3300031824 Bacteria 6766
190 Ga0307413_10036476 3300031824 Bacteria 2830
191 Ga0307413_10150324 3300031824 Bacteria 1622
192 Ga0307410_10004505 3300031852 Bacteria 7213
193 Ga0307410_10020933 3300031852 Bacteria 4013
194 Ga0307410_10056242 3300031852 Bacteria 2674
195 Ga0307410_10058478 3300031852 Bacteria 2628
196 Ga0307410_10068210 3300031852 Bacteria 2455
197 Ga0307410_10122312 3300031852 Bacteria 1900
198 Ga0307410_10125017 3300031852 Bacteria 1881
199 Ga0307410_10138247 3300031852 Bacteria 1798
200 Ga0307406_10000179 3300031901 Bacteria 37960
201 Ga0307406_10000247 3300031901 Bacteria 32783
202 Ga0307406_10001499 3300031901 Bacteria 12888
203 Ga0307406_10071348 3300031901 Bacteria 2276
204 Ga0307406_10079451 3300031901 Bacteria 2175
205 Ga0307406_10103051 3300031901 Bacteria 1948
206 Ga0307406_10108846 3300031901 Bacteria 1903
207 Ga0307407_10005160 3300031903 Bacteria 5635
208 Ga0307407_10009231 3300031903 Bacteria 4581
209 Ga0307407_10029134 3300031903 Bacteria 2962
210 Ga0307407_10050674 3300031903 Bacteria 2376
211 Ga0307407_10089435 3300031903 Bacteria 1884
212 Ga0307412_10036726 3300031911 Bacteria 3142
213 Ga0307412_10149271 3300031911 Bacteria 1722
214 Ga0307409_100000087 3300031995 Bacteria 32874
215 Ga0307409_100010368 3300031995 Bacteria 5790
216 Ga0307409_100019922 3300031995 Bacteria 4556
217 Ga0307409_100177823 3300031995 Bacteria 1880
218 Ga0307409_100207135 3300031995 Bacteria 1759
219 Ga0307409_100235421 3300031995 Bacteria 1663
220 Ga0307416_100000079 3300032002 Bacteria 70731
221 Ga0307416_100001351 3300032002 Bacteria 13232
222 Ga0307416_100012050 3300032002 Bacteria 5804
223 Ga0307416_100033458 3300032002 Bacteria 3896
224 Ga0307416_100053903 3300032002 Bacteria 3229
225 Ga0307416_100054388 3300032002 Bacteria 3217
226 Ga0307416_100064704 3300032002 Bacteria 3001
227 Ga0307416_100148959 3300032002 Bacteria 2142
228 Ga0307414_10018208 3300032004 Bacteria 4316
229 Ga0307414_10025372 3300032004 Bacteria 3796
230 Ga0307414_10047772 3300032004 Bacteria 2948
231 Ga0307414_10083607 3300032004 Bacteria 2345
232 Ga0307414_10237129 3300032004 Bacteria 1508
233 Ga0307411_10248825 3300032005 Bacteria 1396
234 Ga0307415_100002537 3300032126 Bacteria 9132
235 Ga0307415_100022980 3300032126 Bacteria 3861
236 Ga0307415_100090518 3300032126 Bacteria 2213
237 Ga0307415_100111587 3300032126 Bacteria 2030
238 Ga0395899_0033111 3300037312 Bacteria 3882
239 Ga0395899_0060060 3300037312 Bacteria 2801
240 Ga0395900_0006652 3300037418 Bacteria 12018
241 Ga0395900_0006954 3300037418 Bacteria 11739
242 Ga0395900_0010072 3300037418 Bacteria 9669
243 Ga0395900_0037640 3300037418 Bacteria 4987
244 Ga0395900_0044794 3300037418 Bacteria 4558
245 Ga0395898_0000131 3300037466 Bacteria 192369
246 Ga0395898_0018615 3300037466 Bacteria 7080
247 Ga0395898_0085870 3300037466 Bacteria 3033
248 Ga0395905_0006882 3300037471 Bacteria 11367
249 Ga0395901_0027380 3300038443 Bacteria 5857
250 Ga0395901_0027454 3300038443 Bacteria 5849
251 Ga0395901_0038510 3300038443 Bacteria 4946
252 Ga0395901_0043400 3300038443 Bacteria 4664
253 Ga0395901_0122631 3300038443 Bacteria 2731
254 Ga0395901_0192153 3300038443 Bacteria 2141
255 Ga0395901_0206865 3300038443 Bacteria 2055
256 Ga0439436_0009877 3300041404 Bacteria 2919
257 Ga0439466_0026765 3300041411 Bacteria 2002
258 Ga0451793_1843411 3300041452 Bacteria 4392
259 Ga0451793_1924765 3300041452 Bacteria 2214
260 Ga0451837_1762728 3300041494 Bacteria 1916
261 Ga0451853_0152791 3300041512 Bacteria 2557
262 Ga0439433_0001729 3300041999 Bacteria 4536
263 Ga0439442_000087 3300042002 Bacteria 21987
264 Ga0439442_000365 3300042002 Bacteria 10661
265 Ga0439442_003118 3300042002 Bacteria 3281
266 Ga0439442_003325 3300042002 Bacteria 3180
267 Ga0439449_0000105 3300042007 Bacteria 27271
268 Ga0439449_0000529 3300042007 Bacteria 14240
269 Ga0439449_0019950 3300042007 Bacteria 2513
270 Ga0439452_001360 3300042010 Bacteria 10152
271 Ga0439457_001306 3300042014 Bacteria 7467
272 Ga0439462_0017505 3300042015 Bacteria 1856
273 Ga0439463_001543 3300042016 Bacteria 6068
274 Ga0450920_000155 3300042122 Bacteria 9448
275 Ga0450920_001044 3300042122 Bacteria 4535
276 Ga0450920_006490 3300042122 Bacteria 2106
277 Ga0450907_000689 3300042146 Bacteria 8704
278 Ga0439434_0002869 3300042435 Bacteria 5029
279 Ga0439434_0010719 3300042435 Bacteria 2704
280 Ga0439435_0005588 3300042436 Bacteria 2773
281 Ga0450918_000838 3300042531 Bacteria 6484
282 Ga0439440_0000181 3300042993 Bacteria 9647
283 Ga0466972_0017877 3300044658 Bacteria 3548
284 Ga0466965_0000033 3300044683 Bacteria 52298
285 Ga0466965_0028837 3300044683 Bacteria 2698
286 Ga0466965_0031437 3300044683 Bacteria 2589
287 Ga0466961_0026682 3300044693 Bacteria 3714
288 Ga0466961_0088538 3300044693 Bacteria 1956
289 Ga0466961_0089643 3300044693 Bacteria 1942
290 Ga0466963_0037748 3300044694 Bacteria 3157
291 Ga0466970_0000558 3300044765 Bacteria 18194
292 Ga0466970_0019038 3300044765 Bacteria 3557
293 Ga0466970_0030152 3300044765 Bacteria 2859
294 Ga0466970_0043398 3300044765 Bacteria 2392
295 Ga0466970_0060227 3300044765 Bacteria 2033
296 Ga0466960_0008748 3300044901 Bacteria 4155
297 Ga0466960_0017784 3300044901 Bacteria 3106
298 Ga0466960_0023580 3300044901 Bacteria 2764
299 Ga0466960_0047454 3300044901 Bacteria 2060
300 Ga0466960_0066008 3300044901 Bacteria 1788
301 Ga0466960_0078163 3300044901 Bacteria 1661
302 Ga0466959_0069430 3300045049 Bacteria 2553
303 Ga0466958_0019861 3300045836 Bacteria 3914
304 Ga0466967_0001706 3300045976 Bacteria 13078
305 Ga0466967_0212948 3300045976 Bacteria 1833
306 Ga0495627_001615 3300046453 Bacteria 12614
307 Ga0495627_019346 3300046453 Bacteria 2284
308 Ga0495590_0000214 3300046457 Bacteria 31551
309 Ga0495629_0092277 3300046459 Bacteria 2114
310 Ga0495653_0024490 3300046463 Bacteria 4863
311 Ga0495653_0059970 3300046463 Bacteria 2884
312 Ga0495650_0000766 3300046471 Bacteria 39756
313 Ga0495580_0003112 3300046472 Bacteria 14210
314 Ga0495580_0025607 3300046472 Bacteria 4311
315 Ga0495639_0001368 3300046475 Bacteria 10948
316 Ga0495662_0069847 3300046476 Bacteria 1702
317 Ga0495665_0023364 3300046531 Bacteria 3320
318 Ga0495665_0057687 3300046531 Bacteria 2049
319 Ga0495587_0005396 3300046536 Bacteria 8353
320 Ga0495645_0012228 3300046543 Bacteria 6045
321 Ga0495645_0022797 3300046543 Bacteria 4530
322 Ga0495656_0001969 3300046615 Bacteria 6774
323 Ga0495656_0056702 3300046615 Bacteria 1694
324 Ga0495588_0018020 3300046674 Bacteria 3438
325 Ga0495588_0021119 3300046674 Bacteria 3204
326 Ga0495670_0002329 3300046691 Bacteria 9371
327 Ga0495670_0107495 3300046691 Bacteria 1442
328 Ga0495589_0119972 3300046794 Bacteria 1267
329 Ga0495581_0024255 3300047315 Bacteria 3515
330 Ga0495581_0044461 3300047315 Bacteria 2568
331 Ga0495581_0076608 3300047315 Bacteria 1935
332 Ga0495636_0021468 3300047318 Bacteria 2607
333 Ga0495686_0052093 3300047472 Bacteria 2567
334 Ga0496100_0018117 3300048903 Bacteria 4171
335 Ga0496101_0055683 3300048904 Bacteria 2857
336 Ga0496102_0009256 3300048905 Bacteria 8449
337 Ga0496102_0012086 3300048905 Bacteria 7461
338 Ga0496102_0107178 3300048905 Bacteria 2601
339 Ga0496102_0120671 3300048905 Bacteria 2448
340 Ga0496102_0167248 3300048905 Bacteria 2069
341 Ga0496103_0164944 3300048906 Bacteria 1421
342 Ga0496104_0164781 3300048907 Bacteria 2125
343 Ga0496104_0316538 3300048907 Bacteria 1473
344 Ga0496105_0126376 3300048908 Bacteria 2108
345 Ga0496106_0051740 3300048909 Bacteria 3097
346 Ga0496106_0114950 3300048909 Bacteria 2098
347 Ga0496106_0193054 3300048909 Bacteria 1619
348 Ga0496107_0057952 3300048910 Bacteria 2800
349 Ga0496107_0082354 3300048910 Bacteria 2346
350 Ga0496110_0090882 3300048913 Bacteria 2730
351 Ga0496110_0111270 3300048913 Bacteria 2461
352 Ga0496110_0124813 3300048913 Bacteria 2322
353 Ga0496111_0059862 3300048914 Bacteria 2760
354 Ga0496111_0088892 3300048914 Bacteria 2262
355 Ga0496112_0055857 3300048915 Bacteria 3884
356 Ga0496112_0078978 3300048915 Bacteria 3254
357 Ga0496114_0011656 3300048917 Bacteria 7032
358 Ga0496114_0019145 3300048917 Bacteria 5547
359 Ga0496114_0027727 3300048917 Bacteria 4642
360 Ga0496114_0066516 3300048917 Bacteria 3021
361 Ga0496114_0072788 3300048917 Bacteria 2891
362 Ga0496114_0164618 3300048917 Bacteria 1930
363 Ga0496115_0013216 3300048918 Bacteria 6237
364 Ga0496115_0146807 3300048918 Bacteria 1947
365 Ga0496117_0000028 3300048920 Bacteria 407392
366 Ga0496117_0056001 3300048920 Bacteria 2750
367 Ga0496118_0012057 3300048921 Bacteria 8345
368 Ga0496118_0018394 3300048921 Bacteria 6308
369 Ga0496118_0055315 3300048921 Bacteria 2996
370 Ga0496119_0001300 3300048922 Bacteria 30877
371 Ga0496119_0003166 3300048922 Bacteria 17278
372 Ga0496119_0005398 3300048922 Bacteria 12278
373 Ga0496120_0000856 3300048923 Bacteria 43060
374 Ga0496120_0001790 3300048923 Bacteria 24153
375 Ga0496120_0003107 3300048923 Bacteria 15604
376 Ga0496120_0005308 3300048923 Bacteria 10332
377 Ga0496120_0007101 3300048923 Bacteria 8402
378 Ga0496121_0000040 3300048924 Bacteria 348494
379 Ga0496122_0000055 3300048925 Bacteria 258485
380 Ga0496122_0020734 3300048925 Bacteria 5919
381 Ga0496122_0028990 3300048925 Bacteria 4681
382 Ga0496122_0031021 3300048925 Bacteria 4460
383 Ga0496123_0000003 3300048926 Bacteria 866556
384 Ga0496123_0006755 3300048926 Bacteria 11028
385 Ga0496123_0024488 3300048926 Bacteria 4585
386 Ga0496124_0006992 3300048927 Bacteria 12095
387 Ga0496124_0015530 3300048927 Bacteria 7291
388 Ga0496124_0031029 3300048927 Bacteria 4735
389 Ga0496125_0000120 3300048928 Bacteria 175991
390 Ga0496125_0007507 3300048928 Bacteria 11589
391 Ga0496126_0000436 3300048929 Bacteria 83469
392 Ga0496126_0006051 3300048929 Bacteria 13576
393 Ga0496126_0053675 3300048929 Bacteria 3655
394 Ga0501032_0016545 3300049569 Bacteria 5186
395 Ga0501032_0022471 3300049569 Bacteria 4371
396 Ga0501032_0034365 3300049569 Bacteria 3471
397 Ga0501034_0000015 3300049571 Bacteria 296163
398 Ga0501034_0000851 3300049571 Bacteria 45168
399 Ga0501034_0016405 3300049571 Bacteria 7603
400 Ga0501034_0017370 3300049571 Bacteria 7378
401 Ga0501034_0020568 3300049571 Bacteria 6741
402 Ga0501034_0123589 3300049571 Bacteria 2574
403 Ga0501034_0128291 3300049571 Bacteria 2521
404 Ga0501036_0014153 3300049572 Bacteria 6636
405 Ga0501036_0308235 3300049572 Bacteria 1324
406 Ga0501037_0004688 3300049573 Bacteria 9939
407 Ga0501037_0020747 3300049573 Bacteria 4851
408 Ga0501037_0022074 3300049573 Bacteria 4711
409 Ga0501037_0023271 3300049573 Bacteria 4581
410 Ga0501037_0068962 3300049573 Bacteria 2575
411 Ga0501037_0076300 3300049573 Bacteria 2433
412 Ga0501038_0003816 3300049574 Bacteria 14016
413 Ga0501038_0017049 3300049574 Bacteria 6571
414 Ga0501038_0029186 3300049574 Bacteria 4891
415 Ga0501038_0041311 3300049574 Bacteria 4022
416 Ga0501038_0046763 3300049574 Bacteria 3751
417 Ga0501038_0047160 3300049574 Bacteria 3733
418 Ga0501039_0089100 3300049575 Bacteria 2404
419 Ga0501039_0094813 3300049575 Bacteria 2326
420 Ga0501039_0148619 3300049575 Bacteria 1841
421 Ga0501042_0007374 3300049578 Bacteria 7203
422 Ga0501043_0004672 3300049579 Bacteria 11102
423 Ga0501043_0018618 3300049579 Bacteria 5450
424 Ga0501043_0048214 3300049579 Bacteria 3349
425 Ga0501047_0001409 3300049581 Bacteria 23584
426 Ga0501047_0006879 3300049581 Bacteria 10686
427 Ga0501047_0107716 3300049581 Bacteria 2668
428 Ga0501067_0006260 3300049583 Bacteria 6601
429 Ga0501069_0046133 3300049585 Bacteria 2416
430 Ga0501070_0000483 3300049586 Bacteria 36192
431 Ga0501070_0003397 3300049586 Bacteria 13820
432 Ga0501070_0012881 3300049586 Bacteria 7047
433 Ga0501070_0038919 3300049586 Bacteria 3968
434 Ga0501070_0091806 3300049586 Bacteria 2513
435 Ga0501071_0038291 3300049587 Bacteria 3426
436 Ga0501072_0047623 3300049588 Bacteria 3376
437 Ga0501073_0000222 3300049589 Bacteria 37299
438 Ga0501073_0031835 3300049589 Bacteria 3762
439 Ga0501080_0000062 3300049742 Bacteria 70507
440 Ga0501083_0000113 3300049744 Bacteria 55247
441 Ga0501035_0001462 3300049822 Bacteria 24206
442 Ga0501035_0048873 3300049822 Bacteria 3792
443 Ga0501044_0000898 3300049823 Bacteria 35963
444 Ga0501044_0028799 3300049823 Bacteria 5859
445 Ga0501045_0098540 3300049824 Bacteria 2163
446 nmdc:mga00v17_29783_c2 3300050491 Bacteria 2664
447 nmdc:mga06z11_6658_c1 3300050494 Bacteria 4722
448 nmdc:mga07m45_6409_c1 3300050496 Bacteria 5943
449 nmdc:mga05p37_24775_c1 3300050507 Bacteria 7294
450 nmdc:mga08y16_21869_c1 3300050511 Bacteria 6750
451 nmdc:mga08y16_34189_c1 3300050511 Bacteria 5340
452 nmdc:mga0n895_16109_c1 3300050512 Bacteria 6851
453 nmdc:mga0n895_2505_c1 3300050512 Bacteria 14375
454 nmdc:mga0rr50_12694_c1 3300050513 Bacteria 5456
455 nmdc:mga0rr50_1810_c1 3300050513 Bacteria 11818
456 nmdc:mga0a205_12140_c1 3300050515 Bacteria 7964
457 nmdc:mga0sz30_60478_c1 3300050516 Bacteria 1617
458 Ga0500643_004204 3300053087 Bacteria 6597
459 Ga0500651_0001498 3300053093 Bacteria 11784
460 Ga0500650_0043312 3300053098 Bacteria 2081
461 Ga0500556_0000007 3300053104 Bacteria 331400
462 Ga0500556_0000421 3300053104 Bacteria 30523
463 Ga0500559_0010874 3300053136 Bacteria 3900
464 Ga0500559_0013230 3300053136 Bacteria 3496
465 Ga0500559_0058991 3300053136 Bacteria 1708
466 Ga0500568_0000021 3300053139 Bacteria 185406
467 Ga0500568_0002467 3300053139 Bacteria 10871
468 Ga0500573_0000007 3300053140 Bacteria 272970
469 Ga0500573_0006757 3300053140 Bacteria 6225
470 Ga0500573_0024247 3300053140 Bacteria 3487
471 Ga0500616_0005443 3300053153 Bacteria 8638
472 Ga0501082_0014934 3300060353 Bacteria 6692
473 Ga0530510_0068939 3300061734 Bacteria 2566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046794 Ga0495589_0119972 Ga0495589_0119972_181_1254 347
2 3300049585 Ga0501069_0046133 Ga0501069_0046133_20_1111 349
3 3300037418 Ga0395900_0010072 Ga0395900_0010072_4238_5482 360
4 3300042002 Ga0439442_003325 Ga0439442_003325_1492_2580 362
5 3300046472 Ga0495580_0025607 Ga0495580_0025607_3179_4282 367
6 3300048905 Ga0496102_0107178 Ga0496102_0107178_11_1123 370
7 3300006038 Ga0075365_10021120 Ga0075365_100211202 373
8 3300006178 Ga0075367_10012766 Ga0075367_100127663 373
9 3300006186 Ga0075369_10029924 Ga0075369_100299242 373
10 3300006353 Ga0075370_10014225 Ga0075370_100142253 373
11 3300050494 nmdc:mga06z11_6658_c1 nmdc:mga06z11_6658_c1_1904_3205 385
12 3300050496 nmdc:mga07m45_6409_c1 nmdc:mga07m45_6409_c1_4460_5761 385
13 iso_pu_bacteria 2622736605 2623502055 386
14 3300038443 Ga0395901_0027454 Ga0395901_0027454_1242_2594 387
15 3300044901 Ga0466960_0017784 Ga0466960_0017784_1062_2492 387
16 3300005563 Ga0068855_100062095 Ga0068855_1000620954 389
17 3300025949 Ga0207667_10011964 Ga0207667_100119646 389
18 3300005985 Ga0081539_10000314 Ga0081539_1000031473 390
19 3300013250 Ga0171462_1001 Ga0171462_1001153 390
20 3300048917 Ga0496114_0072788 Ga0496114_0072788_1295_2623 391
21 3300045976 Ga0466967_0001706 Ga0466967_0001706_4184_5449 393
22 3300048907 Ga0496104_0316538 Ga0496104_0316538_24_1283 393
23 3300048924 Ga0496121_0000040 Ga0496121_0000040_344796_346103 394
24 3300049744 Ga0501083_0000113 Ga0501083_0000113_13634_14974 396
25 3300049578 Ga0501042_0007374 Ga0501042_0007374_4701_5990 397
26 3300048917 Ga0496114_0027727 Ga0496114_0027727_1445_2773 399
27 3300048928 Ga0496125_0000120 Ga0496125_0000120_131512_132804 399
28 3300047315 Ga0495581_0044461 Ga0495581_0044461_24_1226 400
29 3300048921 Ga0496118_0012057 Ga0496118_0012057_3828_5141 401
30 3300005327 Ga0070658_10165000 Ga0070658_101650002 402
31 3300005366 Ga0070659_100005597 Ga0070659_1000055978 402
32 3300009098 Ga0105245_10034137 Ga0105245_100341374 402
33 3300013296 Ga0157374_10104508 Ga0157374_101045082 402
34 3300025927 Ga0207687_10006838 Ga0207687_100068385 402
35 3300025932 Ga0207690_10001473 Ga0207690_100014732 402
36 3300003578 Ga0006562J51391_1027960 Ga0006562J51391_10279603 403
37 3300003578 Ga0006562J51391_1027961 Ga0006562J51391_10279612 403
38 3300009545 Ga0105237_10038161 Ga0105237_100381613 403
39 3300014968 Ga0157379_10205499 Ga0157379_102054991 403
40 3300025914 Ga0207671_10058885 Ga0207671_100588853 403
41 3300005330 Ga0070690_100025619 Ga0070690_1000256194 404
42 3300044901 Ga0466960_0047454 Ga0466960_0047454_558_1874 404
43 3300044683 Ga0466965_0028837 Ga0466965_0028837_386_1789 405
44 3300044765 Ga0466970_0030152 Ga0466970_0030152_253_1656 405
45 3300044901 Ga0466960_0008748 Ga0466960_0008748_2344_3747 405
46 3300049572 Ga0501036_0308235 Ga0501036_0308235_10_1311 405
47 3300049581 Ga0501047_0006879 Ga0501047_0006879_1435_2736 405
48 3300009101 Ga0105247_10034295 Ga0105247_100342952 406
49 3300009177 Ga0105248_10000784 Ga0105248_1000078420 406
50 3300025941 Ga0207711_10000881 Ga0207711_1000088114 406
51 3300031901 Ga0307406_10000179 Ga0307406_1000017932 407
52 3300025919 Ga0207657_10022957 Ga0207657_100229574 408
53 3300048922 Ga0496119_0003166 Ga0496119_0003166_15078_16394 408
54 3300014325 Ga0163163_10069117 Ga0163163_100691173 409
55 3300005577 Ga0068857_100003425 Ga0068857_1000034256 410
56 3300005614 Ga0068856_100005605 Ga0068856_10000560512 410
57 3300005616 Ga0068852_100015429 Ga0068852_1000154293 410
58 3300005834 Ga0068851_10000005 Ga0068851_10000005123 410
59 3300009093 Ga0105240_10009128 Ga0105240_1000912812 410
60 3300009174 Ga0105241_10000772 Ga0105241_100007724 410
61 3300009177 Ga0105248_10189910 Ga0105248_101899102 410
62 3300009545 Ga0105237_10002853 Ga0105237_1000285315 410
63 3300009545 Ga0105237_10174965 Ga0105237_101749651 410
64 3300009551 Ga0105238_10065664 Ga0105238_100656641 410
65 3300025254 Ga0209148_1000907 Ga0209148_100090716 410
66 3300025321 Ga0207656_10000001 Ga0207656_10000001178 410
67 3300025321 Ga0207656_10000003 Ga0207656_10000003284 410
68 3300025321 Ga0207656_10000004 Ga0207656_10000004141 410
69 3300025911 Ga0207654_10000003 Ga0207654_10000003498 410
70 3300025913 Ga0207695_10096594 Ga0207695_100965942 410
71 3300025914 Ga0207671_10000001 Ga0207671_10000001176 410
72 3300025924 Ga0207694_10000039 Ga0207694_10000039164 410
73 3300026116 Ga0207674_10006493 Ga0207674_100064935 410
74 3300026142 Ga0207698_10001479 Ga0207698_1000147911 410
75 3300041512 Ga0451853_0152791 Ga0451853_0152791_292_1632 410
76 3300048923 Ga0496120_0007101 Ga0496120_0007101_4319_5749 410
77 3300005842 Ga0068858_100000058 Ga0068858_10000005888 412
78 3300026035 Ga0207703_10000026 Ga0207703_100000262 412
79 3300037471 Ga0395905_0006882 Ga0395905_0006882_3785_5098 412
80 3300038443 Ga0395901_0043400 Ga0395901_0043400_925_2238 412
81 3300038443 Ga0395901_0206865 Ga0395901_0206865_178_1509 412
82 3300010375 Ga0105239_10417129 Ga0105239_104171291 413
83 3300044765 Ga0466970_0000558 Ga0466970_0000558_5032_6360 413
84 3300003373 JGI25407J50210_10023292 JGI25407J50210_100232922 414
85 3300005981 Ga0081538_10000448 Ga0081538_1000044831 414
86 3300044683 Ga0466965_0031437 Ga0466965_0031437_739_2013 414
87 3300049571 Ga0501034_0123589 Ga0501034_0123589_561_1901 414
88 3300049573 Ga0501037_0004688 Ga0501037_0004688_7813_9153 414
89 3300049581 Ga0501047_0001409 Ga0501047_0001409_5617_6957 414
90 3300049586 Ga0501070_0091806 Ga0501070_0091806_1020_2360 414
91 3300049822 Ga0501035_0001462 Ga0501035_0001462_10873_12213 414
92 3300049823 Ga0501044_0000898 Ga0501044_0000898_24763_26103 414
93 3300005563 Ga0068855_100004547 Ga0068855_1000045472 415
94 3300025949 Ga0207667_10002609 Ga0207667_100026098 415
95 3300031731 Ga0307405_10088483 Ga0307405_100884832 415
96 3300031824 Ga0307413_10003304 Ga0307413_100033043 415
97 3300031852 Ga0307410_10004505 Ga0307410_100045052 415
98 3300031903 Ga0307407_10009231 Ga0307407_100092312 415
99 3300031995 Ga0307409_100019922 Ga0307409_1000199223 415
100 3300032002 Ga0307416_100053903 Ga0307416_1000539032 415
101 3300032004 Ga0307414_10047772 Ga0307414_100477722 415
102 3300037466 Ga0395898_0085870 Ga0395898_0085870_1474_2781 415
103 3300038443 Ga0395901_0122631 Ga0395901_0122631_396_1670 415
104 3300038443 Ga0395901_0192153 Ga0395901_0192153_784_2058 415
105 3300048920 Ga0496117_0056001 Ga0496117_0056001_331_1638 415
106 3300048922 Ga0496119_0005398 Ga0496119_0005398_6395_7711 415
107 3300048923 Ga0496120_0003107 Ga0496120_0003107_9552_10859 415
108 3300048923 Ga0496120_0005308 Ga0496120_0005308_6926_8242 415
109 3300048925 Ga0496122_0000055 Ga0496122_0000055_93693_95000 415
110 3300048926 Ga0496123_0000003 Ga0496123_0000003_710518_711825 415
111 3300048927 Ga0496124_0015530 Ga0496124_0015530_3868_5175 415
112 3300048929 Ga0496126_0006051 Ga0496126_0006051_6526_7839 415
113 iso_pu_bacteria 2515154155 2515854201 415
114 3300005327 Ga0070658_10073861 Ga0070658_100738612 416
115 3300005937 Ga0081455_10016613 Ga0081455_100166136 416
116 3300005937 Ga0081455_10019438 Ga0081455_100194383 416
117 3300005937 Ga0081455_10020668 Ga0081455_100206683 416
118 3300025909 Ga0207705_10057837 Ga0207705_100578371 416
119 3300031901 Ga0307406_10001499 Ga0307406_100014993 416
120 3300037312 Ga0395899_0033111 Ga0395899_0033111_2313_3620 416
121 3300037466 Ga0395898_0018615 Ga0395898_0018615_3463_4770 416
122 3300038443 Ga0395901_0027380 Ga0395901_0027380_2159_3466 416
123 3300046453 Ga0495627_001615 Ga0495627_001615_9029_10342 416
124 3300049571 Ga0501034_0128291 Ga0501034_0128291_528_1805 416
125 3300049586 Ga0501070_0038919 Ga0501070_0038919_454_1758 416
126 3300060353 Ga0501082_0014934 Ga0501082_0014934_812_2089 416
127 3300025246 Ga0209646_1000098 Ga0209646_1000098118 417
128 3300032004 Ga0307414_10025372 Ga0307414_100253722 417
129 3300044765 Ga0466970_0060227 Ga0466970_0060227_191_1528 417
130 3300049569 Ga0501032_0016545 Ga0501032_0016545_2343_3668 417
131 3300049572 Ga0501036_0014153 Ga0501036_0014153_2347_3672 417
132 3300049573 Ga0501037_0023271 Ga0501037_0023271_3181_4506 417
133 3300049589 Ga0501073_0031835 Ga0501073_0031835_2353_3678 417
134 iso_pu_bacteria 8045830549 8045832595 417
135 3300031901 Ga0307406_10103051 Ga0307406_101030512 418
136 3300049571 Ga0501034_0000851 Ga0501034_0000851_41403_42719 418
137 3300049581 Ga0501047_0107716 Ga0501047_0107716_906_2231 418
138 iso_pu_bacteria 2675903058 2676475375 418
139 iso_pu_bacteria 2827628540 2827629694 418
140 3300031903 Ga0307407_10089435 Ga0307407_100894352 419
141 3300053104 Ga0500556_0000007 Ga0500556_0000007_306363_307646 419
142 3300009551 Ga0105238_10063071 Ga0105238_100630712 420
143 3300025924 Ga0207694_10130211 Ga0207694_101302112 420
144 iso_pu_bacteria 2773857759 2774383752 420
145 iso_pu_bacteria 2808606368 2808885158 420
146 iso_pu_bacteria 2977251589 2977251739 420
147 3300031901 Ga0307406_10108846 Ga0307406_101088461 421
148 3300046543 Ga0495645_0012228 Ga0495645_0012228_4439_5767 421
149 3300048917 Ga0496114_0164618 Ga0496114_0164618_202_1530 421
150 iso_pu_bacteria 2643221561 2643825424 421
151 iso_pu_bacteria 2643221696 2644531420 421
152 3300005356 Ga0070674_100080354 Ga0070674_1000803542 422
153 3300005441 Ga0070700_100050195 Ga0070700_1000501952 422
154 3300005457 Ga0070662_100098483 Ga0070662_1000984832 422
155 3300005718 Ga0068866_10005801 Ga0068866_100058014 422
156 3300005843 Ga0068860_100107514 Ga0068860_1001075141 422
157 3300005937 Ga0081455_10001480 Ga0081455_1000148018 422
158 3300006058 Ga0075432_10000034 Ga0075432_1000003417 422
159 3300006058 Ga0075432_10003170 Ga0075432_100031703 422
160 3300006844 Ga0075428_100023539 Ga0075428_1000235393 422
161 3300006844 Ga0075428_100289016 Ga0075428_1002890162 422
162 3300006852 Ga0075433_10000261 Ga0075433_1000026124 422
163 3300006871 Ga0075434_100010450 Ga0075434_1000104503 422
164 3300006871 Ga0075434_100022930 Ga0075434_1000229304 422
165 3300006881 Ga0068865_100013532 Ga0068865_1000135324 422
166 3300007076 Ga0075435_100002112 Ga0075435_10000211210 422
167 3300007076 Ga0075435_100005111 Ga0075435_1000051114 422
168 3300009094 Ga0111539_10000342 Ga0111539_1000034211 422
169 3300009094 Ga0111539_10021083 Ga0111539_100210835 422
170 3300009098 Ga0105245_10030908 Ga0105245_100309081 422
171 3300009147 Ga0114129_10002953 Ga0114129_100029537 422
172 3300009148 Ga0105243_10006946 Ga0105243_100069469 422
173 3300009176 Ga0105242_10185099 Ga0105242_101850992 422
174 3300009176 Ga0105242_10207518 Ga0105242_102075182 422
175 3300009553 Ga0105249_10017185 Ga0105249_100171852 422
176 3300009553 Ga0105249_10048165 Ga0105249_100481652 422
177 3300010375 Ga0105239_10088098 Ga0105239_100880983 422
178 3300013307 Ga0157372_10092557 Ga0157372_100925574 422
179 3300014326 Ga0157380_10083063 Ga0157380_100830632 422
180 3300017792 Ga0163161_10207420 Ga0163161_102074202 422
181 3300025901 Ga0207688_10044321 Ga0207688_100443212 422
182 3300025923 Ga0207681_10133631 Ga0207681_101336311 422
183 3300025933 Ga0207706_10047880 Ga0207706_100478803 422
184 3300025934 Ga0207686_10058276 Ga0207686_100582762 422
185 3300025934 Ga0207686_10133089 Ga0207686_101330892 422
186 3300025938 Ga0207704_10017715 Ga0207704_100177152 422
187 3300026089 Ga0207648_10037184 Ga0207648_100371842 422
188 3300027907 Ga0207428_10000436 Ga0207428_1000043629 422
189 3300027907 Ga0207428_10007504 Ga0207428_100075044 422
190 3300031548 Ga0307408_100002076 Ga0307408_1000020768 422
191 3300031852 Ga0307410_10058478 Ga0307410_100584781 422
192 3300031901 Ga0307406_10000247 Ga0307406_1000024712 422
193 3300031901 Ga0307406_10071348 Ga0307406_100713482 422
194 3300031995 Ga0307409_100000087 Ga0307409_1000000879 422
195 3300032002 Ga0307416_100000079 Ga0307416_10000007926 422
196 3300032004 Ga0307414_10083607 Ga0307414_100836072 422
197 3300032126 Ga0307415_100002537 Ga0307415_1000025372 422
198 3300041452 Ga0451793_1843411 Ga0451793_1843411_954_2252 422
199 3300041452 Ga0451793_1924765 Ga0451793_1924765_341_1666 422
200 3300042016 Ga0439463_001543 Ga0439463_001543_4033_5331 422
201 3300042436 Ga0439435_0005588 Ga0439435_0005588_463_1761 422
202 3300042993 Ga0439440_0000181 Ga0439440_0000181_1326_2624 422
203 3300046615 Ga0495656_0056702 Ga0495656_0056702_240_1538 422
204 3300046691 Ga0495670_0107495 Ga0495670_0107495_35_1333 422
205 3300048913 Ga0496110_0124813 Ga0496110_0124813_160_1458 422
206 3300048920 Ga0496117_0000028 Ga0496117_0000028_288325_289641 422
207 3300048923 Ga0496120_0001790 Ga0496120_0001790_18915_20231 422
208 3300048925 Ga0496122_0031021 Ga0496122_0031021_949_2265 422
209 3300048926 Ga0496123_0006755 Ga0496123_0006755_3186_4502 422
210 3300048927 Ga0496124_0006992 Ga0496124_0006992_7433_8749 422
211 3300048928 Ga0496125_0007507 Ga0496125_0007507_6781_8097 422
212 3300048929 Ga0496126_0000436 Ga0496126_0000436_50597_51913 422
213 3300050507 nmdc:mga05p37_24775_c1 nmdc:mga05p37_24775_c1_2302_3600 422
214 3300050511 nmdc:mga08y16_21869_c1 nmdc:mga08y16_21869_c1_4839_6137 422
215 3300050511 nmdc:mga08y16_34189_c1 nmdc:mga08y16_34189_c1_2077_3375 422
216 3300050512 nmdc:mga0n895_16109_c1 nmdc:mga0n895_16109_c1_741_2039 422
217 3300050512 nmdc:mga0n895_2505_c1 nmdc:mga0n895_2505_c1_11044_12342 422
218 3300050513 nmdc:mga0rr50_12694_c1 nmdc:mga0rr50_12694_c1_807_2105 422
219 3300050513 nmdc:mga0rr50_1810_c1 nmdc:mga0rr50_1810_c1_1128_2426 422
220 3300050515 nmdc:mga0a205_12140_c1 nmdc:mga0a205_12140_c1_4743_6041 422
221 3300053139 Ga0500568_0000021 Ga0500568_0000021_160335_161636 422
222 iso_pu_bacteria 2643221641 2644229066 422
223 iso_pu_bacteria 2739367898 2740166837 422
224 iso_pu_bacteria 2773857763 2774400105 422
225 iso_pu_bacteria 2857720070 2857722600 422
226 iso_pu_bacteria 2928090899 2928091307 422
227 iso_pu_bacteria 2984580707 2984581942 422
228 iso_pu_bacteria 8054609563 8054612570 422
229 3300005614 Ga0068856_100280026 Ga0068856_1002800262 423
230 3300026078 Ga0207702_10086297 Ga0207702_100862972 423
231 3300044683 Ga0466965_0000033 Ga0466965_0000033_41563_42888 423
232 3300045049 Ga0466959_0069430 Ga0466959_0069430_1187_2518 423
233 3300045976 Ga0466967_0212948 Ga0466967_0212948_301_1632 423
234 3300053087 Ga0500643_004204 Ga0500643_004204_2693_3988 423
235 3300002772 JGI25164J39214_1000498 JGI25164J39214_100049810 424
236 3300003214 JGI25165J46597_1000002 JGI25165J46597_100000264 424
237 3300003316 rootH1_10033147 rootH1_100331472 424
238 3300005329 Ga0070683_100082612 Ga0070683_1000826122 424
239 3300005337 Ga0070682_100057467 Ga0070682_1000574672 424
240 3300006038 Ga0075365_10009210 Ga0075365_100092105 424
241 3300006051 Ga0075364_10053430 Ga0075364_100534302 424
242 3300014326 Ga0157380_10156511 Ga0157380_101565112 424
243 3300025231 Ga0207427_100099 Ga0207427_100099107 424
244 3300025233 Ga0209437_100360 Ga0209437_10036013 424
245 3300025261 Ga0209233_1000001 Ga0209233_10000012741 424
246 3300025944 Ga0207661_10077286 Ga0207661_100772862 424
247 3300037418 Ga0395900_0044794 Ga0395900_0044794_1657_2964 424
248 3300044658 Ga0466972_0017877 Ga0466972_0017877_1151_2467 424
249 3300044693 Ga0466961_0026682 Ga0466961_0026682_1454_2770 424
250 3300044694 Ga0466963_0037748 Ga0466963_0037748_1437_2753 424
251 3300044765 Ga0466970_0019038 Ga0466970_0019038_996_2312 424
252 3300044901 Ga0466960_0023580 Ga0466960_0023580_125_1516 424
253 3300045836 Ga0466958_0019861 Ga0466958_0019861_361_1677 424
254 3300046463 Ga0495653_0024490 Ga0495653_0024490_214_1524 424
255 3300046471 Ga0495650_0000766 Ga0495650_0000766_28161_29621 424
256 3300048913 Ga0496110_0090882 Ga0496110_0090882_318_1634 424
257 3300048914 Ga0496111_0059862 Ga0496111_0059862_1352_2668 424
258 3300048917 Ga0496114_0019145 Ga0496114_0019145_3036_4352 424
259 3300048929 Ga0496126_0053675 Ga0496126_0053675_697_2037 424
260 3300049583 Ga0501067_0006260 Ga0501067_0006260_616_1932 424
261 3300050491 nmdc:mga00v17_29783_c2 nmdc:mga00v17_29783_c2_696_1988 424
262 3300061734 Ga0530510_0068939 Ga0530510_0068939_1031_2347 424
263 iso_pu_bacteria 2811994872 2812322551 424
264 iso_pu_bacteria 2887443736 2887447477 424
265 3300005339 Ga0070660_100011503 Ga0070660_1000115032 425
266 3300005455 Ga0070663_100092678 Ga0070663_1000926782 425
267 3300005564 Ga0070664_100094486 Ga0070664_1000944862 425
268 3300010375 Ga0105239_10017157 Ga0105239_100171578 425
269 3300010375 Ga0105239_10022983 Ga0105239_100229834 425
270 3300025913 Ga0207695_10017181 Ga0207695_100171813 425
271 3300025919 Ga0207657_10033092 Ga0207657_100330924 425
272 3300025932 Ga0207690_10065011 Ga0207690_100650112 425
273 3300026067 Ga0207678_10122305 Ga0207678_101223052 425
274 3300044693 Ga0466961_0089643 Ga0466961_0089643_338_1651 425
275 3300044765 Ga0466970_0043398 Ga0466970_0043398_595_1908 425
276 3300044901 Ga0466960_0066008 Ga0466960_0066008_163_1473 425
277 3300044901 Ga0466960_0078163 Ga0466960_0078163_130_1443 425
278 3300053136 Ga0500559_0010874 Ga0500559_0010874_500_1888 425
279 iso_pu_bacteria 2738541272 2738692453 425
280 iso_pu_bacteria 2738543027 2739323540 425
281 iso_pu_bacteria 2739367654 2739608976 425
282 iso_pu_bacteria 2758568621 2760622564 425
283 iso_pu_bacteria 2808606394 2809027313 425
284 iso_pu_bacteria 8056579771 8056584051 425
285 3300048927 Ga0496124_0031029 Ga0496124_0031029_2235_3539 426
286 3300049575 Ga0501039_0148619 Ga0501039_0148619_384_1730 426
287 3300049588 Ga0501072_0047623 Ga0501072_0047623_234_1580 426
288 3300053153 Ga0500616_0005443 Ga0500616_0005443_5382_6689 426
289 iso_pu_bacteria 2870628048 2870629823 426
290 3300002067 JGI24735J21928_10008016 JGI24735J21928_100080162 427
291 3300026041 Ga0207639_10155670 Ga0207639_101556702 427
292 3300031852 Ga0307410_10056242 Ga0307410_100562422 427
293 3300031911 Ga0307412_10036726 Ga0307412_100367262 427
294 3300032002 Ga0307416_100148959 Ga0307416_1001489591 427
295 3300032126 Ga0307415_100111587 Ga0307415_1001115872 427
296 3300041494 Ga0451837_1762728 Ga0451837_1762728_219_1568 427
297 3300048921 Ga0496118_0018394 Ga0496118_0018394_4742_6178 427
298 3300048922 Ga0496119_0001300 Ga0496119_0001300_5586_6968 427
299 3300048923 Ga0496120_0000856 Ga0496120_0000856_34130_35566 427
300 3300053093 Ga0500651_0001498 Ga0500651_0001498_7018_8427 427
301 iso_pu_bacteria 2585428157 2588106652 427
302 iso_pu_bacteria 2808606306 2808631650 427
303 iso_pu_bacteria 2852646457 2852646971 427
304 iso_pu_bacteria 2945968032 2945971422 427
305 iso_pu_bacteria 2643221542 2643734057 428
306 iso_pu_bacteria 2643221553 2643785379 428
307 iso_pu_bacteria 2643221630 2644170645 428
308 iso_pu_bacteria 2643221724 2644679733 428
309 iso_pu_bacteria 2728369380 2730229260 428
310 iso_pu_bacteria 2852663356 2852664831 428
311 iso_pu_bacteria 2946033335 2946034173 428
312 iso_pu_bacteria 2946041624 2946043756 428
313 iso_pu_bacteria 2946080515 2946081330 428
314 iso_pu_bacteria 2974294766 2974297931 428
315 iso_pu_bacteria 2974324384 2974325831 428
316 iso_pu_bacteria 8004182704 8004185513 428
317 iso_pu_bacteria 8004212874 8004214589 428
318 3300046453 Ga0495627_019346 Ga0495627_019346_712_2034 429
319 iso_pu_bacteria 2821268502 2821269473 429
320 iso_pu_bacteria 2833709550 2833710376 429
321 iso_pu_bacteria 2919395869 2919396940 429
322 3300049569 Ga0501032_0034365 Ga0501032_0034365_119_1444 430
323 3300049573 Ga0501037_0022074 Ga0501037_0022074_3193_4518 430
324 3300049573 Ga0501037_0068962 Ga0501037_0068962_310_1617 430
325 3300049574 Ga0501038_0017049 Ga0501038_0017049_1096_2421 430
326 3300049575 Ga0501039_0089100 Ga0501039_0089100_517_1842 430
327 3300049579 Ga0501043_0048214 Ga0501043_0048214_1517_2842 430
328 3300049586 Ga0501070_0012881 Ga0501070_0012881_4845_6185 430
329 3300049822 Ga0501035_0048873 Ga0501035_0048873_2130_3452 430
330 3300049823 Ga0501044_0028799 Ga0501044_0028799_3392_4717 430
331 iso_pu_bacteria 2643221572 2643874777 430
332 iso_pu_bacteria 2643221669 2644381833 430
333 iso_pu_bacteria 2758568522 2760303581 430
334 3300031824 Ga0307413_10150324 Ga0307413_101503241 431
335 iso_pu_bacteria 2643221566 2643849474 431
336 iso_pu_bacteria 2643221597 2643996299 431
337 3300006051 Ga0075364_10078994 Ga0075364_100789942 432
338 3300032004 Ga0307414_10237129 Ga0307414_102371291 432
339 3300048905 Ga0496102_0012086 Ga0496102_0012086_4827_6203 432
340 3300049574 Ga0501038_0003816 Ga0501038_0003816_319_1632 432
341 3300049742 Ga0501080_0000062 Ga0501080_0000062_47295_48608 432
342 iso_pu_bacteria 8002811521 8002813660 432
343 iso_pu_bacteria 8055034563 8055036735 432
344 3300005548 Ga0070665_100314415 Ga0070665_1003144151 433
345 3300048908 Ga0496105_0126376 Ga0496105_0126376_148_1479 433
346 3300048917 Ga0496114_0011656 Ga0496114_0011656_2070_3401 433
347 3300048925 Ga0496122_0028990 Ga0496122_0028990_1281_2633 433
348 3300053140 Ga0500573_0000007 Ga0500573_0000007_100936_102255 433
349 iso_pu_bacteria 2747842429 2747953331 433
350 iso_pu_bacteria 2852643534 2852645109 433
351 iso_pu_bacteria 2857733635 2857736889 433
352 iso_pu_bacteria 2862993130 2862995521 433
353 iso_pu_bacteria 2895660088 2895662846 433
354 iso_pu_bacteria 2995726249 2995727289 433
355 3300025904 Ga0207647_10040888 Ga0207647_100408882 434
356 3300025909 Ga0207705_10000001 Ga0207705_100000011893 434
357 3300031649 Ga0307514_10010121 Ga0307514_100101214 434
358 3300046457 Ga0495590_0000214 Ga0495590_0000214_471_1790 434
359 3300048925 Ga0496122_0020734 Ga0496122_0020734_1230_2558 434
360 3300048926 Ga0496123_0024488 Ga0496123_0024488_1114_2442 434
361 3300049586 Ga0501070_0003397 Ga0501070_0003397_10149_11477 434
362 3300049587 Ga0501071_0038291 Ga0501071_0038291_324_1652 434
363 iso_pu_bacteria 2643221632 2644184010 434
364 iso_pu_bacteria 2857729791 2857732360 434
365 iso_pu_bacteria 2928121344 2928124748 434
366 iso_pu_bacteria 2966924647 2966925113 434
367 iso_pu_bacteria 8055037949 8055040850 434
368 3300005367 Ga0070667_100044796 Ga0070667_1000447963 435
369 3300025986 Ga0207658_10021178 Ga0207658_100211783 435
370 3300048910 Ga0496107_0057952 Ga0496107_0057952_191_1615 435
371 3300049571 Ga0501034_0016405 Ga0501034_0016405_359_1681 435
372 3300013105 Ga0157369_10331689 Ga0157369_103316892 436
373 3300031649 Ga0307514_10057237 Ga0307514_100572372 436
374 3300049571 Ga0501034_0017370 Ga0501034_0017370_5603_6928 436
375 3300049571 Ga0501034_0020568 Ga0501034_0020568_1615_2940 436
376 3300049573 Ga0501037_0076300 Ga0501037_0076300_699_2030 436
377 3300049574 Ga0501038_0041311 Ga0501038_0041311_1227_2552 436
378 3300049824 Ga0501045_0098540 Ga0501045_0098540_277_1608 436
379 3300053139 Ga0500568_0002467 Ga0500568_0002467_6473_7798 436
380 3300005327 Ga0070658_10000135 Ga0070658_1000013556 437
381 3300005355 Ga0070671_100045567 Ga0070671_1000455673 437
382 3300005455 Ga0070663_100172361 Ga0070663_1001723612 437
383 3300013102 Ga0157371_10000615 Ga0157371_100006155 437
384 3300013104 Ga0157370_10060528 Ga0157370_100605282 437
385 3300026067 Ga0207678_10256452 Ga0207678_102564521 437
386 3300047472 Ga0495686_0052093 Ga0495686_0052093_621_1949 437
387 3300053136 Ga0500559_0013230 Ga0500559_0013230_1886_3238 437
388 3300053136 Ga0500559_0058991 Ga0500559_0058991_338_1696 437
389 3300053140 Ga0500573_0006757 Ga0500573_0006757_790_2121 437
390 3300053140 Ga0500573_0024247 Ga0500573_0024247_893_2233 437
391 iso_pu_bacteria 2939657138 2939657490 437
392 iso_pu_bacteria 2964326757 2964329185 437
393 3300003578 Ga0006562J51391_1051275 Ga0006562J51391_10512752 438
394 3300005327 Ga0070658_10021992 Ga0070658_100219923 438
395 3300013105 Ga0157369_10029825 Ga0157369_100298252 438
396 3300025272 Ga0209455_1000886 Ga0209455_10008865 438
397 3300037418 Ga0395900_0006652 Ga0395900_0006652_5091_6422 438
398 3300037466 Ga0395898_0000131 Ga0395898_0000131_28786_30117 438
399 3300044693 Ga0466961_0088538 Ga0466961_0088538_478_1875 438
400 3300048918 Ga0496115_0013216 Ga0496115_0013216_2492_3823 438
401 3300048918 Ga0496115_0146807 Ga0496115_0146807_561_1892 438
402 3300048921 Ga0496118_0055315 Ga0496118_0055315_290_1624 438
403 3300049586 Ga0501070_0000483 Ga0501070_0000483_9135_10466 438
404 3300049589 Ga0501073_0000222 Ga0501073_0000222_30143_31483 438
405 3300050516 nmdc:mga0sz30_60478_c1 nmdc:mga0sz30_60478_c1_31_1371 438
406 3300053104 Ga0500556_0000421 Ga0500556_0000421_10521_11882 438
407 iso_pu_bacteria 2808606371 2808895866 438
408 iso_pu_bacteria 2905926851 2905927600 438
409 iso_pu_bacteria 2905926851 2905929059 438
410 iso_pu_bacteria 2946059875 2946063386 438
411 iso_pu_bacteria 8004021418 8004024105 438
412 iso_pu_bacteria 8004025490 8004026069 438
413 iso_pu_bacteria 8054107350 8054111550 438
414 iso_pu_bacteria 2690315906 2691513405 439
415 iso_pu_bacteria 2775506735 2775656229 439
416 iso_pu_bacteria 2808606357 2808830657 439
417 iso_pu_bacteria 2808606360 2808851844 439
418 iso_pu_bacteria 2808606366 2808879840 439
419 iso_pu_bacteria 2808606370 2808894907 439
420 iso_pu_bacteria 2811994871 2812321790 439
421 iso_pu_bacteria 2844849076 2844852211 439
422 iso_pu_bacteria 2857740372 2857743707 439
423 iso_pu_bacteria 2904497146 2904499609 439
424 iso_pu_bacteria 2904776348 2904778703 439
425 iso_pu_bacteria 2910809715 2910812016 439
426 iso_pu_bacteria 2919034639 2919036060 439
427 iso_pu_bacteria 2919051321 2919053269 439
428 iso_pu_bacteria 2919059106 2919060775 439
429 iso_pu_bacteria 2919391150 2919392338 439
430 iso_pu_bacteria 2919538618 2919538727 439
431 iso_pu_bacteria 2932426870 2932431009 439
432 iso_pu_bacteria 2933418574 2933419090 439
433 iso_pu_bacteria 2939598168 2939599967 439
434 iso_pu_bacteria 2939647034 2939647965 439
435 iso_pu_bacteria 2939674588 2939678454 439
436 iso_pu_bacteria 2945916053 2945919662 439
437 iso_pu_bacteria 2945920336 2945924428 439
438 iso_pu_bacteria 2945956166 2945957976 439
439 iso_pu_bacteria 2946024296 2946025207 439
440 iso_pu_bacteria 2946037020 2946039806 439
441 iso_pu_bacteria 2953998280 2954001028 439
442 iso_pu_bacteria 2974302888 2974303302 439
443 3300042014 Ga0439457_001306 Ga0439457_001306_835_2157 440
444 3300042122 Ga0450920_001044 Ga0450920_001044_2415_3737 440
445 3300053098 Ga0500650_0043312 Ga0500650_0043312_260_1600 440
446 3300031731 Ga0307405_10132761 Ga0307405_101327612 442
447 3300031995 Ga0307409_100177823 Ga0307409_1001778231 442
448 3300000549 LJQas_1001146 LJQas_10011462 443
449 3300000549 LJQas_1002602 LJQas_10026022 443
450 3300003316 rootH1_10033148 rootH1_100331482 443
451 3300003320 rootH2_10149154 rootH2_101491542 443
452 3300003322 rootL2_10166258 rootL2_101662582 443
453 3300003762 Ga0055542_1009234 Ga0055542_10092341 443
454 3300005328 Ga0070676_10035155 Ga0070676_100351551 443
455 3300005353 Ga0070669_100012102 Ga0070669_1000121026 443
456 3300005364 Ga0070673_100005433 Ga0070673_1000054337 443
457 3300005456 Ga0070678_100013158 Ga0070678_1000131582 443
458 3300006058 Ga0075432_10000291 Ga0075432_100002918 443
459 3300006178 Ga0075367_10045048 Ga0075367_100450482 443
460 3300009036 Ga0105244_10005033 Ga0105244_100050334 443
461 3300009036 Ga0105244_10006140 Ga0105244_100061403 443
462 3300009148 Ga0105243_10062294 Ga0105243_100622942 443
463 3300009551 Ga0105238_10303946 Ga0105238_103039461 443
464 3300011119 Ga0105246_10021222 Ga0105246_100212225 443
465 3300011119 Ga0105246_10027979 Ga0105246_100279793 443
466 3300013105 Ga0157369_10031102 Ga0157369_100311022 443
467 3300013105 Ga0157369_10315553 Ga0157369_103155532 443
468 3300013306 Ga0163162_10028481 Ga0163162_100284813 443
469 3300013308 Ga0157375_10287603 Ga0157375_102876032 443
470 3300025256 Ga0209759_1013915 Ga0209759_10139152 443
471 3300025258 Ga0209129_1000079 Ga0209129_1000079104 443
472 3300025294 Ga0209025_1001309 Ga0209025_10013092 443
473 3300025303 Ga0209051_1019723 Ga0209051_10197232 443
474 3300025315 Ga0207697_10001905 Ga0207697_1000190510 443
475 3300025315 Ga0207697_10023971 Ga0207697_100239712 443
476 3300025728 Ga0207655_1019638 Ga0207655_10196382 443
477 3300025728 Ga0207655_1026544 Ga0207655_10265442 443
478 3300025893 Ga0207682_10067161 Ga0207682_100671611 443
479 3300025907 Ga0207645_10009994 Ga0207645_100099947 443
480 3300025926 Ga0207659_10100422 Ga0207659_101004222 443
481 3300025940 Ga0207691_10000777 Ga0207691_1000077727 443
482 3300026121 Ga0207683_10031058 Ga0207683_100310584 443
483 3300027907 Ga0207428_10014981 Ga0207428_100149813 443
484 3300031548 Ga0307408_100002127 Ga0307408_10000212714 443
485 3300031548 Ga0307408_100005525 Ga0307408_1000055257 443
486 3300031548 Ga0307408_100023047 Ga0307408_1000230472 443
487 3300031548 Ga0307408_100036732 Ga0307408_1000367322 443
488 3300031548 Ga0307408_100037120 Ga0307408_1000371202 443
489 3300031731 Ga0307405_10044237 Ga0307405_100442372 443
490 3300031731 Ga0307405_10104562 Ga0307405_101045621 443
491 3300031824 Ga0307413_10036476 Ga0307413_100364763 443
492 3300031852 Ga0307410_10020933 Ga0307410_100209332 443
493 3300031852 Ga0307410_10068210 Ga0307410_100682103 443
494 3300031852 Ga0307410_10122312 Ga0307410_101223122 443
495 3300031852 Ga0307410_10125017 Ga0307410_101250172 443
496 3300031852 Ga0307410_10138247 Ga0307410_101382471 443
497 3300031901 Ga0307406_10079451 Ga0307406_100794512 443
498 3300031903 Ga0307407_10005160 Ga0307407_100051602 443
499 3300031903 Ga0307407_10029134 Ga0307407_100291342 443
500 3300031903 Ga0307407_10050674 Ga0307407_100506742 443
501 3300031911 Ga0307412_10149271 Ga0307412_101492712 443
502 3300031995 Ga0307409_100010368 Ga0307409_1000103685 443
503 3300031995 Ga0307409_100207135 Ga0307409_1002071351 443
504 3300031995 Ga0307409_100235421 Ga0307409_1002354212 443
505 3300032002 Ga0307416_100001351 Ga0307416_1000013513 443
506 3300032002 Ga0307416_100012050 Ga0307416_1000120506 443
507 3300032002 Ga0307416_100033458 Ga0307416_1000334583 443
508 3300032002 Ga0307416_100054388 Ga0307416_1000543881 443
509 3300032002 Ga0307416_100064704 Ga0307416_1000647042 443
510 3300032004 Ga0307414_10018208 Ga0307414_100182082 443
511 3300032005 Ga0307411_10248825 Ga0307411_102488251 443
512 3300032126 Ga0307415_100022980 Ga0307415_1000229803 443
513 3300032126 Ga0307415_100090518 Ga0307415_1000905182 443
514 3300037312 Ga0395899_0060060 Ga0395899_0060060_829_2163 443
515 3300037418 Ga0395900_0006954 Ga0395900_0006954_4475_5809 443
516 3300037418 Ga0395900_0037640 Ga0395900_0037640_2944_4275 443
517 3300038443 Ga0395901_0038510 Ga0395901_0038510_1571_2902 443
518 3300041404 Ga0439436_0009877 Ga0439436_0009877_1060_2391 443
519 3300041411 Ga0439466_0026765 Ga0439466_0026765_383_1714 443
520 3300041999 Ga0439433_0001729 Ga0439433_0001729_212_1543 443
521 3300042002 Ga0439442_000087 Ga0439442_000087_10270_11601 443
522 3300042002 Ga0439442_000365 Ga0439442_000365_1757_3088 443
523 3300042002 Ga0439442_003118 Ga0439442_003118_1192_2523 443
524 3300042007 Ga0439449_0000105 Ga0439449_0000105_2900_4231 443
525 3300042007 Ga0439449_0000529 Ga0439449_0000529_3393_4724 443
526 3300042007 Ga0439449_0019950 Ga0439449_0019950_85_1416 443
527 3300042010 Ga0439452_001360 Ga0439452_001360_1889_3220 443
528 3300042015 Ga0439462_0017505 Ga0439462_0017505_409_1740 443
529 3300042122 Ga0450920_000155 Ga0450920_000155_6618_7949 443
530 3300042122 Ga0450920_006490 Ga0450920_006490_86_1417 443
531 3300042146 Ga0450907_000689 Ga0450907_000689_1739_3070 443
532 3300042435 Ga0439434_0002869 Ga0439434_0002869_1625_2956 443
533 3300042435 Ga0439434_0010719 Ga0439434_0010719_64_1395 443
534 3300042531 Ga0450918_000838 Ga0450918_000838_298_1629 443
535 3300046459 Ga0495629_0092277 Ga0495629_0092277_222_1553 443
536 3300046463 Ga0495653_0059970 Ga0495653_0059970_595_1926 443
537 3300046472 Ga0495580_0003112 Ga0495580_0003112_11140_12471 443
538 3300046475 Ga0495639_0001368 Ga0495639_0001368_1098_2429 443
539 3300046476 Ga0495662_0069847 Ga0495662_0069847_46_1377 443
540 3300046531 Ga0495665_0023364 Ga0495665_0023364_1099_2430 443
541 3300046531 Ga0495665_0057687 Ga0495665_0057687_529_1860 443
542 3300046536 Ga0495587_0005396 Ga0495587_0005396_458_1789 443
543 3300046543 Ga0495645_0022797 Ga0495645_0022797_1140_2471 443
544 3300046615 Ga0495656_0001969 Ga0495656_0001969_401_1732 443
545 3300046674 Ga0495588_0018020 Ga0495588_0018020_1684_3015 443
546 3300046674 Ga0495588_0021119 Ga0495588_0021119_817_2148 443
547 3300046691 Ga0495670_0002329 Ga0495670_0002329_1058_2389 443
548 3300047315 Ga0495581_0024255 Ga0495581_0024255_1289_2620 443
549 3300047315 Ga0495581_0076608 Ga0495581_0076608_266_1597 443
550 3300047318 Ga0495636_0021468 Ga0495636_0021468_924_2255 443
551 3300048903 Ga0496100_0018117 Ga0496100_0018117_1311_2642 443
552 3300048904 Ga0496101_0055683 Ga0496101_0055683_160_1491 443
553 3300048905 Ga0496102_0009256 Ga0496102_0009256_1658_2989 443
554 3300048905 Ga0496102_0120671 Ga0496102_0120671_302_1633 443
555 3300048905 Ga0496102_0167248 Ga0496102_0167248_519_1850 443
556 3300048906 Ga0496103_0164944 Ga0496103_0164944_58_1389 443
557 3300048907 Ga0496104_0164781 Ga0496104_0164781_54_1385 443
558 3300048909 Ga0496106_0051740 Ga0496106_0051740_1381_2712 443
559 3300048909 Ga0496106_0114950 Ga0496106_0114950_161_1492 443
560 3300048909 Ga0496106_0193054 Ga0496106_0193054_235_1566 443
561 3300048910 Ga0496107_0082354 Ga0496107_0082354_744_2075 443
562 3300048913 Ga0496110_0111270 Ga0496110_0111270_329_1660 443
563 3300048914 Ga0496111_0088892 Ga0496111_0088892_130_1461 443
564 3300048915 Ga0496112_0055857 Ga0496112_0055857_173_1504 443
565 3300048915 Ga0496112_0078978 Ga0496112_0078978_638_1969 443
566 3300048917 Ga0496114_0066516 Ga0496114_0066516_1275_2606 443
567 3300049569 Ga0501032_0022471 Ga0501032_0022471_721_2052 443
568 3300049571 Ga0501034_0000015 Ga0501034_0000015_92797_94128 443
569 3300049573 Ga0501037_0020747 Ga0501037_0020747_1913_3244 443
570 3300049574 Ga0501038_0029186 Ga0501038_0029186_800_2131 443
571 3300049574 Ga0501038_0046763 Ga0501038_0046763_1548_2879 443
572 3300049574 Ga0501038_0047160 Ga0501038_0047160_1463_2794 443
573 3300049575 Ga0501039_0094813 Ga0501039_0094813_671_2002 443
574 3300049579 Ga0501043_0004672 Ga0501043_0004672_2265_3596 443
575 3300049579 Ga0501043_0018618 Ga0501043_0018618_1820_3151 443

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02163

Peptidase_M50

Peptidase family M50

9

452

0.95

PF17820

PDZ_6

PDZ domain

234

282

0.95

PF13180

PDZ_2

PDZ domain

234

292

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wyn-assembly1.cif.gz_A htra2 pathogenic mutant 0.904 187 241
5to0-assembly1.cif.gz_A htra2 s276c mutant 0.902 187 245
5fht-assembly1.cif.gz_A htra2 protease mutant v226k 0.9015 187 245
5to1-assembly1.cif.gz_A htra2 exposed (l266r, f303a) mutant 0.8935 187 241
5gnd-assembly1.cif.gz_A structure of deg protease hhoa from synechocystis sp. pcc 6803 0.8867 187 241
ID Description Score Start End Superfamily
3pv2A03 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.911 187 240 2.30.42.10
af_A0A1D6FKP2_357_461_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8993 187 241 2.30.42.10
af_Q2G1Z5_167_256_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8614 159 277 2.30.42.10
2zpmA00 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8592 161 275 2.30.42.10
af_Q2G1Z5_167_256_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8528 159 277 2.30.42.10
ID Description Score Start End GO Terms
AF-A0A6B3H9H0-F1-model_v4 Site-2 protease family protein 0.9713 5 126 GO:0004222
GO:0006508
GO:0016020
AF-A0A3S4A027-F1-model_v4 PDZ domain-containing protein 0.9398 3 443 GO:0004222
GO:0006508
GO:0016020
AF-A0A3S4A027-F1-model_v4 PDZ domain-containing protein 0.9337 3 443 GO:0004222
GO:0006508
GO:0016020
AF-A0A7M4DPA1-F1-model_v4 Zinc metalloprotease Rip1 (EC 3.4.24.-) 0.9317 7 442 GO:0004222
GO:0006508
GO:0016020
AF-A0A496MTS6-F1-model_v4 Zinc metalloprotease Rip1 0.9299 7 141 GO:0004222
GO:0006508
GO:0016020

Feature Viewer

pLDDT pTM Quality
83.63 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map