F465417

General Info

Members Datasets Scaffolds Average Seq Length
575 404 1150 230

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0059557|Ga0373936_0059557_374_1141
Length 255
Sequence LRASNVVPTVDQEGPPMPSKNAYTAVSAAVVVAALAAAFWTLPGRSAERATLVPAPAVDAPAATGDETQTAVLAGGCFWGVQAVFQHVNGVTRVVSGYSGGSKETAQYQVVSSGRTGHAEAVEIKFDPKQISYGRILQIYFSVAHDPTQLNRQGPDDGTQYRSAIFYSDAAQQKVAQAYIAQLDKAGVFKSPVVTQVGQLAAFYPAEAYHQDYATIHPNNPYIVYNDAPKVENLKQLFPDVYRDKPVLVTAAKGS

Samples

Sample ID Description Type Environment
1 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
95 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
167 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
190 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
191 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
192 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
193 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
194 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
195 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
196 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
197 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
215 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
223 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
288 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
293 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
294 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
297 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
301 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
304 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
305 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
306 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
307 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
308 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
309 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
310 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
311 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
312 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
313 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
314 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
318 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
319 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
320 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
321 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
322 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
323 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
324 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
325 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
326 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
327 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
328 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
329 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
330 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
331 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
332 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
333 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
334 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
335 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
336 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
337 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
338 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
339 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
340 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
341 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
342 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
343 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
344 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
345 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
346 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
347 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
348 2838048938 Rhizobium pisi 27/80 Isolate Nodule
349 2838061910 Rhizobium phaseoli L15 Isolate Nodule
350 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
351 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
352 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
353 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
354 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
355 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
356 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
357 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
358 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
359 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
360 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
361 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
362 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
363 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
364 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
365 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
366 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
367 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
368 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
369 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
370 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
371 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
372 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
373 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
374 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
375 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
376 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
377 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
378 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
379 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
380 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
381 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
382 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
383 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
384 2909042592 Labrys sp. LIt4 Isolate Nodule
385 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
386 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
387 2933599457 Rhizobium phaseoli M3 Isolate Nodule
388 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
389 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
390 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
391 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
392 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
393 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
394 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
395 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
396 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
397 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
398 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
399 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
400 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
401 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
402 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
403 8024501048 Rhizobium sp. H4 Isolate Nodule
404 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.96
Metatranscriptomes 1.74
Isolates 15.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.96
Nodule 13.91
Rhizoplane 2.61
Rhizosphere 70.78
Stem 0
Stem Tuber 0
Unclassified 4.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373936_0059557 3300035113 Bacteria 1557
2 SwRhRL2b_contig_3207873 2162886007 Bacteria 73231
3 MRS1b_contig_1777220 2162886011 Bacteria 821
4 JGI24739J22299_10013673 3300001989 Bacteria 2958
5 JGI24737J22298_10010536 3300001990 Bacteria 3049
6 JGI24735J21928_10018499 3300002067 Bacteria 2147
7 JGI25156J39149_1011524 3300002705 Bacteria 1993
8 JGI25157J39369_1002286 3300002741 Bacteria 5070
9 rootL2_10084468 3300003322 Bacteria 3921
10 Ga0055525_1000242 3300003759 Bacteria 55608
11 Ga0055527_1000063 3300003760 Bacteria 89044
12 Ga0055535_1000406 3300003761 Bacteria 40592
13 Ga0055542_1000146 3300003762 Bacteria 88772
14 Ga0055542_1003953 3300003762 Bacteria 3783
15 Ga0055529_1000597 3300003763 Bacteria 28068
16 Ga0065704_10070205 3300005289 Bacteria 83747
17 Ga0070683_100280050 3300005329 Unclassified 1586
18 Ga0070690_100002154 3300005330 Bacteria 10509
19 Ga0070670_100012748 3300005331 Bacteria 7195
20 Ga0070666_10002154 3300005335 Bacteria 11964
21 Ga0068868_100006389 3300005338 Bacteria 8338
22 Ga0070661_100001122 3300005344 Bacteria 18807
23 Ga0070661_100054868 3300005344 Bacteria 2919
24 Ga0070661_100325400 3300005344 Bacteria 1201
25 Ga0070669_100057936 3300005353 Bacteria 2843
26 Ga0070675_100061708 3300005354 Bacteria 3096
27 Ga0070674_100330084 3300005356 Bacteria 1226
28 Ga0070673_100048139 3300005364 Bacteria 3322
29 Ga0070667_100004657 3300005367 Bacteria 11509
30 Ga0070667_100006083 3300005367 Bacteria 10020
31 Ga0070714_100007079 3300005435 Bacteria 8699
32 Ga0070711_100549780 3300005439 Bacteria 958
33 Ga0070663_100225720 3300005455 Bacteria 1472
34 Ga0070681_10052179 3300005458 Bacteria 4078
35 Ga0070681_10521562 3300005458 Bacteria 1101
36 Ga0070685_10111453 3300005466 Bacteria 1686
37 Ga0070685_10186175 3300005466 Bacteria 1340
38 Ga0070679_100060786 3300005530 Bacteria 3765
39 Ga0070684_100108465 3300005535 Unclassified 2487
40 Ga0070684_100246867 3300005535 Bacteria 1631
41 Ga0068853_100001404 3300005539 Bacteria 17389
42 Ga0068853_100128191 3300005539 Bacteria 2268
43 Ga0070672_100000725 3300005543 Bacteria 19533
44 Ga0070672_100642132 3300005543 Bacteria 927
45 Ga0070686_100118636 3300005544 Unclassified 1813
46 Ga0070696_100166275 3300005546 Bacteria 1628
47 Ga0070693_100303887 3300005547 Unclassified 1076
48 Ga0070665_100315654 3300005548 Bacteria 1567
49 Ga0068855_100001490 3300005563 Bacteria 29300
50 Ga0068855_100029771 3300005563 Bacteria 6528
51 Ga0070664_100000389 3300005564 Bacteria 32754
52 Ga0070664_100353441 3300005564 Unclassified 1337
53 Ga0068857_100025418 3300005577 Bacteria 5214
54 Ga0068857_100063398 3300005577 Bacteria 3285
55 Ga0068854_100020296 3300005578 Bacteria 4493
56 Ga0068856_100000065 3300005614 Bacteria 98683
57 Ga0068856_100044653 3300005614 Bacteria 4362
58 Ga0068852_100005382 3300005616 Bacteria 9151
59 Ga0068859_100574357 3300005617 Unclassified 1221
60 Ga0068864_100011436 3300005618 Bacteria 7331
61 Ga0068851_10001310 3300005834 Bacteria 10842
62 Ga0068863_100010409 3300005841 Bacteria 9040
63 Ga0068858_100057939 3300005842 Bacteria 3580
64 Ga0068858_100229374 3300005842 Bacteria 1760
65 Ga0068860_100099908 3300005843 Bacteria 2768
66 Ga0068862_100059198 3300005844 Bacteria 3289
67 Ga0081455_10094677 3300005937 Bacteria 2412
68 Ga0075363_100004002 3300006048 Bacteria 6374
69 Ga0075363_100013704 3300006048 Bacteria 3942
70 Ga0075364_10015693 3300006051 Bacteria 4701
71 Ga0075362_10004567 3300006177 Bacteria 4989
72 Ga0075367_10007643 3300006178 Bacteria 5552
73 Ga0075369_10011734 3300006186 Bacteria 3451
74 Ga0097621_100000908 3300006237 Bacteria 20694
75 Ga0097621_100475251 3300006237 Bacteria 1129
76 Ga0097621_100887635 3300006237 Bacteria 830
77 Ga0068871_100978791 3300006358 Bacteria 787
78 Ga0075431_100313322 3300006847 Bacteria 1583
79 Ga0075431_100375018 3300006847 Bacteria 1427
80 Ga0075434_100661159 3300006871 Bacteria 1063
81 Ga0097620_100574356 3300006931 Unclassified 1221
82 Ga0099794_10205016 3300007265 Bacteria 1010
83 Ga0105240_10007943 3300009093 Bacteria 15308
84 Ga0105240_10068422 3300009093 Bacteria 4397
85 Ga0105240_10072658 3300009093 Bacteria 4251
86 Ga0105245_10081796 3300009098 Bacteria 2953
87 Ga0105241_10072294 3300009174 Unclassified 2680
88 Ga0105241_10120372 3300009174 Bacteria 2113
89 Ga0105241_10255371 3300009174 Unclassified 1488
90 Ga0105242_10220099 3300009176 Bacteria 1696
91 Ga0105248_10474009 3300009177 Unclassified 1411
92 Ga0105237_10169818 3300009545 Bacteria 2181
93 Ga0105238_10001064 3300009551 Bacteria 27700
94 Ga0105238_10009489 3300009551 Bacteria 9738
95 Ga0105238_10046958 3300009551 Bacteria 4355
96 Ga0105238_11035137 3300009551 Bacteria 842
97 Ga0105249_10835679 3300009553 Bacteria 986
98 Ga0099796_10021181 3300010159 Bacteria 1998
99 Ga0105239_10010423 3300010375 Bacteria 10394
100 Ga0105239_10047705 3300010375 Bacteria 4694
101 Ga0105239_10342656 3300010375 Bacteria 1687
102 Ga0105246_10182725 3300011119 Bacteria 1616
103 Ga0157371_10097588 3300013102 Bacteria 2083
104 Ga0157370_10139839 3300013104 Bacteria 2256
105 Ga0157369_10000264 3300013105 Bacteria 70855
106 Ga0157374_10000496 3300013296 Bacteria 35685
107 Ga0157374_10114159 3300013296 Bacteria 2600
108 Ga0157378_10011036 3300013297 Bacteria 7907
109 Ga0157378_11049154 3300013297 Bacteria 851
110 Ga0163162_10097868 3300013306 Bacteria 3023
111 Ga0163162_10269401 3300013306 Bacteria 1834
112 Ga0157372_10001696 3300013307 Bacteria 23852
113 Ga0157372_10223501 3300013307 Bacteria 2183
114 Ga0157375_10000631 3300013308 Bacteria 31289
115 Ga0157375_10126084 3300013308 Bacteria 2675
116 Ga0163163_10005157 3300014325 Bacteria 11266
117 Ga0163163_10069266 3300014325 Bacteria 3512
118 Ga0157380_10373996 3300014326 Bacteria 1342
119 Ga0157377_10234060 3300014745 Unclassified 1183
120 Ga0157379_10446658 3300014968 Bacteria 1193
121 Ga0157376_10066812 3300014969 Unclassified 3040
122 Ga0157376_10291159 3300014969 Bacteria 1542
123 Ga0183363_1151 3300015690 Bacteria 17315
124 Ga0163161_10116256 3300017792 Bacteria 2005
125 Ga0197907_10371358 3300020069 Bacteria 810
126 Ga0197907_11490845 3300020069 Bacteria 1068
127 Ga0206356_11908769 3300020070 Bacteria 890
128 Ga0206349_1819953 3300020075 Bacteria 1116
129 Ga0206355_1330646 3300020076 Bacteria 1225
130 Ga0206352_10323814 3300020078 Bacteria 771
131 Ga0206350_10769023 3300020080 Bacteria 972
132 Ga0206353_10866523 3300020082 Bacteria 1292
133 Ga0206353_11323159 3300020082 Bacteria 966
134 Ga0213872_10148801 3300021361 Bacteria 1024
135 Ga0213874_10035085 3300021377 Bacteria 1472
136 Ga0224712_10015693 3300022467 Unclassified 2470
137 Ga0209672_100007 3300025228 Bacteria 959482
138 Ga0209672_102534 3300025228 Bacteria 4398
139 Ga0209563_100071 3300025230 Bacteria 232653
140 Ga0209258_100017 3300025242 Bacteria 590785
141 Ga0209258_100758 3300025242 Bacteria 20275
142 Ga0209148_1000044 3300025254 Bacteria 458417
143 Ga0209148_1003930 3300025254 Bacteria 3835
144 Ga0209759_1000166 3300025256 Bacteria 113080
145 Ga0209455_1000010 3300025272 Bacteria 959482
146 Ga0209758_1002527 3300025297 Bacteria 18490
147 Ga0207656_10005726 3300025321 Bacteria 4417
148 Ga0207692_10242719 3300025898 Bacteria 1076
149 Ga0207647_10020459 3300025904 Bacteria 4438
150 Ga0207705_10359277 3300025909 Bacteria 1123
151 Ga0207684_10222483 3300025910 Bacteria 1629
152 Ga0207654_10000806 3300025911 Bacteria 17257
153 Ga0207654_10041276 3300025911 Unclassified 2604
154 Ga0207707_10301952 3300025912 Bacteria 1384
155 Ga0207707_10475934 3300025912 Bacteria 1067
156 Ga0207695_10003805 3300025913 Bacteria 20923
157 Ga0207695_10058711 3300025913 Bacteria 3993
158 Ga0207671_10108228 3300025914 Bacteria 2112
159 Ga0207671_10194907 3300025914 Bacteria 1581
160 Ga0207663_10364322 3300025916 Bacteria 1097
161 Ga0207660_10268303 3300025917 Unclassified 1351
162 Ga0207649_10000284 3300025920 Bacteria 39562
163 Ga0207652_10016468 3300025921 Bacteria 6037
164 Ga0207652_10139955 3300025921 Bacteria 2163
165 Ga0207694_10000273 3300025924 Bacteria 49024
166 Ga0207650_10002280 3300025925 Bacteria 13385
167 Ga0207659_10211222 3300025926 Bacteria 1555
168 Ga0207687_10100122 3300025927 Bacteria 2131
169 Ga0207687_10101557 3300025927 Bacteria 2117
170 Ga0207706_10049972 3300025933 Bacteria 3695
171 Ga0207686_10252160 3300025934 Bacteria 1290
172 Ga0207709_10244619 3300025935 Bacteria 1307
173 Ga0207669_10299773 3300025937 Bacteria 1221
174 Ga0207665_10070163 3300025939 Bacteria 2390
175 Ga0207691_10003915 3300025940 Bacteria 14465
176 Ga0207691_10125097 3300025940 Bacteria 2275
177 Ga0207711_10257141 3300025941 Unclassified 1604
178 Ga0207661_10413688 3300025944 Bacteria 1224
179 Ga0207667_10000413 3300025949 Bacteria 57875
180 Ga0207667_10010297 3300025949 Bacteria 10943
181 Ga0207667_10230187 3300025949 Bacteria 1898
182 Ga0207651_10029706 3300025960 Bacteria 3468
183 Ga0207668_10086882 3300025972 Bacteria 2286
184 Ga0207640_10044828 3300025981 Bacteria 2836
185 Ga0207640_10107714 3300025981 Bacteria 1968
186 Ga0207658_10020977 3300025986 Bacteria 4529
187 Ga0207658_10034454 3300025986 Bacteria 3619
188 Ga0207677_10020674 3300026023 Bacteria 4002
189 Ga0207703_10013371 3300026035 Bacteria 6396
190 Ga0207703_10072398 3300026035 Bacteria 2849
191 Ga0207703_10089031 3300026035 Bacteria 2592
192 Ga0207639_10005178 3300026041 Bacteria 8797
193 Ga0207639_10024836 3300026041 Bacteria 4342
194 Ga0207678_10406388 3300026067 Bacteria 1179
195 Ga0207702_10000003 3300026078 Bacteria 434196
196 Ga0207702_10000209 3300026078 Bacteria 69358
197 Ga0207702_10067303 3300026078 Bacteria 3074
198 Ga0207702_10716038 3300026078 Bacteria 987
199 Ga0207641_10015952 3300026088 Bacteria 6151
200 Ga0207641_10039799 3300026088 Bacteria 3933
201 Ga0207641_10102875 3300026088 Bacteria 2519
202 Ga0207676_10005705 3300026095 Bacteria 8810
203 Ga0207676_10257604 3300026095 Bacteria 1573
204 Ga0207674_10007519 3300026116 Bacteria 12702
205 Ga0207674_10073263 3300026116 Bacteria 3438
206 Ga0207675_100235392 3300026118 Bacteria 1768
207 Ga0207675_100644600 3300026118 Bacteria 1065
208 Ga0207698_10097751 3300026142 Unclassified 2424
209 Ga0207698_10137713 3300026142 Bacteria 2097
210 Ga0209179_1013762 3300027512 Bacteria 1475
211 Ga0268265_10044953 3300028380 Bacteria 3292
212 Ga0268264_10117934 3300028381 Bacteria 2335
213 Ga0268264_10260651 3300028381 Bacteria 1615
214 Ga0265334_10000033 3300028573 Bacteria 106132
215 Ga0265330_10028027 3300031235 Bacteria 2541
216 Ga0265332_10008046 3300031238 Bacteria 4746
217 Ga0265325_10001741 3300031241 Bacteria 15096
218 Ga0265329_10010776 3300031242 Bacteria 3345
219 Ga0265340_10006067 3300031247 Bacteria 6663
220 Ga0265340_10044431 3300031247 Bacteria 2173
221 Ga0265339_10001424 3300031249 Bacteria 17734
222 Ga0265331_10000002 3300031250 Bacteria 511481
223 Ga0265331_10028117 3300031250 Bacteria 2813
224 Ga0265331_10047000 3300031250 Bacteria 2079
225 Ga0265331_10068403 3300031250 Bacteria 1665
226 Ga0265331_10128618 3300031250 Bacteria 1156
227 Ga0265327_10000074 3300031251 Bacteria 214435
228 Ga0265316_10010203 3300031344 Bacteria 8577
229 Ga0265314_10001465 3300031711 Bacteria 26322
230 Ga0265314_10008922 3300031711 Bacteria 8543
231 Ga0265314_10015545 3300031711 Bacteria 6038
232 Ga0265314_10055700 3300031711 Bacteria 2727
233 Ga0265314_10063383 3300031711 Bacteria 2508
234 Ga0265314_10065678 3300031711 Bacteria 2450
235 Ga0265314_10156494 3300031711 Bacteria 1391
236 Ga0265314_10234126 3300031711 Bacteria 1063
237 Ga0265342_10004642 3300031712 Bacteria 10696
238 Ga0265342_10023159 3300031712 Bacteria 3935
239 Ga0307516_10004445 3300031730 Bacteria 17289
240 Ga0373934_0025045 3300035086 Bacteria 2309
241 Ga0373923_0005091 3300035111 Bacteria 4435
242 Ga0373945_0013035 3300035116 Bacteria 2769
243 Ga0373953_0001606 3300035117 Bacteria 6611
244 Ga0373954_0039304 3300035118 Bacteria 2202
245 Ga0373956_0007284 3300035119 Bacteria 4455
246 Ga0373957_0103545 3300035120 Bacteria 1141
247 Ga0373943_0003490 3300035170 Bacteria 7160
248 Ga0373946_0004458 3300035171 Bacteria 5016
249 Ga0373955_0000346 3300035172 Bacteria 19457
250 Ga0373955_0275809 3300035172 Bacteria 1011
251 Ga0373924_0001455 3300035410 Bacteria 7697
252 Ga0373935_0000056 3300035692 Bacteria 46025
253 Ga0373927_0033737 3300035695 Bacteria 3331
254 Ga0373933_0004205 3300035724 Bacteria 7938
255 Ga0373947_0004488 3300035725 Bacteria 8191
256 Ga0373937_0000075 3300036401 Bacteria 89727
257 Ga0373937_0351196 3300036401 Bacteria 1397
258 Ga0373925_0000159 3300037068 Bacteria 72851
259 Ga0395899_0008203 3300037312 Bacteria 8049
260 Ga0395900_0162295 3300037418 Bacteria 2279
261 Ga0395898_0000460 3300037466 Bacteria 81440
262 Ga0436364_0596856 3300037853 Bacteria 1269
263 Ga0237819_00130 3300038705 Bacteria 28324
264 Ga0436360_0064513 3300039438 Bacteria 1763
265 Ga0436361_0709744 3300039447 Bacteria 2515
266 Ga0436363_0268886 3300039450 Bacteria 1233
267 Ga0436363_1116204 3300039450 Bacteria 1422
268 Ga0436363_1546557 3300039450 Bacteria 3434
269 Ga0439461_0006955 3300041410 Bacteria 1987
270 Ga0451833_0552563 3300041491 Bacteria 1206
271 Ga0451835_0259487 3300041492 Bacteria 3322
272 Ga0451837_0291003 3300041494 Bacteria 1120
273 Ga0451839_1037019 3300041496 Bacteria 991
274 Ga0451845_0815701 3300041501 Bacteria 1170
275 Ga0451849_0008212 3300041505 Bacteria 1757
276 Ga0451843_0322861 3300041509 Bacteria 2485
277 Ga0451855_0762862 3300041511 Bacteria 2452
278 Ga0451853_0670545 3300041512 Bacteria 820
279 Ga0466969_0004995 3300044656 Bacteria 7063
280 Ga0466966_0005052 3300044684 Bacteria 8671
281 Ga0466961_0001260 3300044693 Bacteria 15613
282 Ga0466961_0024959 3300044693 Bacteria 3846
283 Ga0466961_0202667 3300044693 Bacteria 1226
284 Ga0466970_0002513 3300044765 Bacteria 8841
285 Ga0466970_0045572 3300044765 Bacteria 2335
286 Ga0466957_0042584 3300044842 Bacteria 2748
287 Ga0466959_0210400 3300045049 Bacteria 1351
288 Ga0451576_0011229 3300045051 Bacteria 10202
289 Ga0466958_0421763 3300045836 Bacteria 862
290 Ga0495592_0000102 3300046454 Bacteria 75767
291 Ga0495629_0146456 3300046459 Bacteria 1642
292 Ga0495651_0001236 3300046462 Bacteria 19760
293 Ga0495653_0000036 3300046463 Bacteria 129776
294 Ga0495580_0325332 3300046472 Bacteria 1045
295 Ga0495662_0006322 3300046476 Bacteria 5923
296 Ga0495662_0094223 3300046476 Bacteria 1462
297 Ga0495664_0000107 3300046477 Bacteria 41420
298 Ga0495607_0053093 3300046501 Bacteria 2344
299 Ga0495606_0010004 3300046507 Bacteria 7931
300 Ga0495608_0000006 3300046511 Bacteria 324334
301 Ga0495608_0080799 3300046511 Bacteria 2113
302 Ga0495610_0020204 3300046512 Bacteria 3703
303 Ga0495618_0000057 3300046514 Bacteria 80298
304 Ga0495618_0191810 3300046514 Bacteria 1295
305 Ga0495620_0027483 3300046515 Bacteria 2661
306 Ga0495628_0000077 3300046516 Bacteria 77338
307 Ga0495630_0001707 3300046517 Bacteria 15337
308 Ga0495643_0010530 3300046522 Bacteria 5686
309 Ga0495648_0074512 3300046524 Bacteria 1955
310 Ga0495652_0000005 3300046529 Bacteria 524368
311 Ga0495640_0000007 3300046533 Bacteria 265481
312 Ga0495586_0034542 3300046535 Bacteria 2716
313 Ga0495587_0000043 3300046536 Bacteria 109717
314 Ga0495597_0018607 3300046542 Bacteria 3258
315 Ga0495645_0000275 3300046543 Bacteria 37777
316 Ga0495667_0000023 3300046559 Bacteria 169343
317 Ga0495667_0000235 3300046559 Bacteria 36357
318 Ga0495634_0000049 3300046642 Bacteria 95428
319 Ga0495634_0166062 3300046642 Bacteria 1389
320 Ga0495635_0000021 3300046663 Bacteria 164643
321 Ga0495657_0000063 3300046675 Bacteria 94380
322 Ga0495657_0001655 3300046675 Bacteria 19148
323 Ga0495599_0000001 3300046678 Bacteria 537563
324 Ga0495599_0167828 3300046678 Bacteria 1355
325 Ga0495623_0000056 3300046679 Bacteria 69307
326 Ga0495646_0000007 3300046680 Bacteria 236764
327 Ga0495658_0010076 3300046683 Bacteria 4721
328 Ga0495613_0056629 3300046689 Bacteria 2879
329 Ga0495613_0414465 3300046689 Unclassified 917
330 Ga0495600_0000047 3300046809 Bacteria 71546
331 Ga0495600_0566138 3300046809 Bacteria 693
332 Ga0495604_0000014 3300047317 Bacteria 205481
333 Ga0495674_0000014 3300047319 Bacteria 241211
334 Ga0495674_0004659 3300047319 Bacteria 13185
335 Ga0495680_0000744 3300047322 Bacteria 36481
336 Ga0495675_0000940 3300047444 Bacteria 17639
337 Ga0495684_0000272 3300047471 Bacteria 41522
338 Ga0495686_0009589 3300047472 Bacteria 6959
339 Ga0495593_0103367 3300047673 Bacteria 1459
340 Ga0495602_0000017 3300048088 Bacteria 184180
341 Ga0495626_0079418 3300048091 Bacteria 1460
342 Ga0496104_0156832 3300048907 Bacteria 2184
343 Ga0496105_0405953 3300048908 Bacteria 1081
344 Ga0496108_0022862 3300048911 Bacteria 5145
345 Ga0496108_0055537 3300048911 Bacteria 3325
346 Ga0496109_0020142 3300048912 Bacteria 5893
347 Ga0496109_0052104 3300048912 Bacteria 3729
348 Ga0496110_0038590 3300048913 Bacteria 4156
349 Ga0496110_0048100 3300048913 Bacteria 3738
350 Ga0496111_0058755 3300048914 Bacteria 2785
351 Ga0496112_0006460 3300048915 Bacteria 10292
352 Ga0496112_0014728 3300048915 Bacteria 7272
353 Ga0496112_0082646 3300048915 Bacteria 3176
354 Ga0496113_0034460 3300048916 Bacteria 3694
355 Ga0496113_0034858 3300048916 Bacteria 3676
356 Ga0496115_0159555 3300048918 Bacteria 1864
357 Ga0496119_0089775 3300048922 Bacteria 1749
358 Ga0496121_0012588 3300048924 Bacteria 9196
359 Ga0496121_0013808 3300048924 Bacteria 8645
360 Ga0496125_0000237 3300048928 Bacteria 113322
361 Ga0496126_0191204 3300048929 Bacteria 1733
362 Ga0496126_0282062 3300048929 Bacteria 1376
363 Ga0501031_0017115 3300049568 Bacteria 4709
364 Ga0501031_0038407 3300049568 Bacteria 3124
365 Ga0501032_0008783 3300049569 Bacteria 7356
366 Ga0501032_0048959 3300049569 Bacteria 2852
367 Ga0501033_0001474 3300049570 Bacteria 20818
368 Ga0501033_0004101 3300049570 Bacteria 11740
369 Ga0501033_0053052 3300049570 Bacteria 3003
370 Ga0501033_0157684 3300049570 Bacteria 1635
371 Ga0501033_0250107 3300049570 Unclassified 1256
372 Ga0501033_0282691 3300049570 Bacteria 1171
373 Ga0501034_0011186 3300049571 Bacteria 9315
374 Ga0501034_0027091 3300049571 Bacteria 5830
375 Ga0501034_0036050 3300049571 Bacteria 5014
376 Ga0501034_0050255 3300049571 Bacteria 4205
377 Ga0501034_0437366 3300049571 Bacteria 1227
378 Ga0501036_0011010 3300049572 Bacteria 7481
379 Ga0501036_0030209 3300049572 Bacteria 4579
380 Ga0501036_0056776 3300049572 Bacteria 3317
381 Ga0501036_0116011 3300049572 Bacteria 2262
382 Ga0501037_0024080 3300049573 Bacteria 4501
383 Ga0501037_0052454 3300049573 Bacteria 2983
384 Ga0501037_0148839 3300049573 Unclassified 1674
385 Ga0501037_0151751 3300049573 Bacteria 1655
386 Ga0501038_0006326 3300049574 Bacteria 10955
387 Ga0501038_0031567 3300049574 Bacteria 4680
388 Ga0501038_0053727 3300049574 Unclassified 3467
389 Ga0501038_0081585 3300049574 Bacteria 2724
390 Ga0501039_0004711 3300049575 Bacteria 10326
391 Ga0501039_0107609 3300049575 Bacteria 2178
392 Ga0501039_0315619 3300049575 Unclassified 1229
393 Ga0501040_0003148 3300049576 Bacteria 10705
394 Ga0501040_0006328 3300049576 Bacteria 7687
395 Ga0501041_0002832 3300049577 Bacteria 9915
396 Ga0501042_0007786 3300049578 Bacteria 7040
397 Ga0501043_0010736 3300049579 Bacteria 7172
398 Ga0501046_0000115 3300049580 Bacteria 84375
399 Ga0501046_0000433 3300049580 Bacteria 41959
400 Ga0501046_0035056 3300049580 Bacteria 4045
401 Ga0501046_0041778 3300049580 Bacteria 3657
402 Ga0501046_0106012 3300049580 Bacteria 2151
403 Ga0501046_0191071 3300049580 Bacteria 1527
404 Ga0501047_0004044 3300049581 Bacteria 13788
405 Ga0501047_0014218 3300049581 Bacteria 7564
406 Ga0501047_0058799 3300049581 Bacteria 3713
407 Ga0501047_0091100 3300049581 Bacteria 2927
408 Ga0501047_0104900 3300049581 Bacteria 2707
409 Ga0501047_0165685 3300049581 Bacteria 2080
410 Ga0501048_0019363 3300049582 Bacteria 4994
411 Ga0501048_0086834 3300049582 Bacteria 2206
412 Ga0501048_0781921 3300049582 Bacteria 686
413 Ga0501067_0040472 3300049583 Bacteria 2588
414 Ga0501067_0062371 3300049583 Bacteria 2063
415 Ga0501068_0024536 3300049584 Bacteria 3542
416 Ga0501068_0374182 3300049584 Bacteria 917
417 Ga0501070_0003773 3300049586 Bacteria 13088
418 Ga0501070_0021689 3300049586 Bacteria 5385
419 Ga0501070_0062243 3300049586 Bacteria 3092
420 Ga0501070_0573833 3300049586 Unclassified 901
421 Ga0501072_0185970 3300049588 Bacteria 1657
422 Ga0501072_0479235 3300049588 Bacteria 984
423 Ga0501073_0006172 3300049589 Bacteria 8945
424 Ga0501073_0008282 3300049589 Bacteria 7710
425 Ga0501073_0041233 3300049589 Bacteria 3262
426 Ga0501073_0076247 3300049589 Unclassified 2333
427 Ga0501073_0179107 3300049589 Bacteria 1467
428 Ga0501074_0007305 3300049590 Bacteria 7988
429 Ga0501074_0008596 3300049590 Bacteria 7395
430 Ga0501074_0260120 3300049590 Bacteria 1234
431 Ga0501076_0002219 3300049592 Bacteria 13304
432 Ga0501076_0257747 3300049592 Bacteria 1428
433 Ga0501077_0016658 3300049593 Bacteria 4633
434 Ga0501079_0005199 3300049741 Bacteria 9673
435 Ga0501080_0005552 3300049742 Bacteria 11263
436 Ga0501080_0012585 3300049742 Bacteria 7757
437 Ga0501080_0020036 3300049742 Bacteria 6189
438 Ga0501081_0006281 3300049743 Bacteria 7703
439 Ga0501083_0006332 3300049744 Bacteria 8389
440 Ga0501083_0018840 3300049744 Bacteria 4806
441 Ga0501083_0045918 3300049744 Bacteria 2954
442 Ga0501083_0219670 3300049744 Bacteria 1238
443 Ga0501035_0001607 3300049822 Bacteria 22855
444 Ga0501035_0002718 3300049822 Bacteria 17190
445 Ga0501035_0010537 3300049822 Bacteria 8566
446 Ga0501035_0059364 3300049822 Bacteria 3406
447 Ga0501044_0001279 3300049823 Bacteria 29728
448 Ga0501044_0008771 3300049823 Bacteria 11060
449 Ga0501044_0013927 3300049823 Bacteria 8689
450 Ga0501044_0014482 3300049823 Bacteria 8510
451 Ga0501044_0240000 3300049823 Unclassified 1756
452 Ga0501044_0328555 3300049823 Bacteria 1452
453 Ga0501044_0860456 3300049823 Bacteria 783
454 Ga0501045_0013884 3300049824 Bacteria 5697
455 Ga0501045_0069875 3300049824 Bacteria 2583
456 nmdc:mga03683_38150_c1 3300050489 Bacteria 1961
457 nmdc:mga03n38_38757_c1 3300050490 Bacteria 2063
458 nmdc:mga00v17_6527_c1 3300050491 Bacteria 6192
459 nmdc:mga0yw44_54033_c1 3300050492 Bacteria 2440
460 nmdc:mga06z11_10355_c1 3300050494 Bacteria 3970
461 nmdc:mga06z11_285571_c1 3300050494 Bacteria 978
462 nmdc:mga06r32_205309_c1 3300050510 Bacteria 1958
463 nmdc:mga06r32_718631_c1 3300050510 Bacteria 964
464 nmdc:mga0n895_138483_c1 3300050512 Bacteria 2461
465 Ga0495601_0000016 3300053077 Bacteria 207486
466 Ga0495612_0000035 3300053078 Bacteria 69194
467 Ga0495595_0000032 3300053084 Bacteria 87066
468 Ga0495619_0000033 3300053085 Bacteria 138925
469 Ga0495619_0123350 3300053085 Bacteria 1777
470 Ga0500643_006600 3300053087 Bacteria 4824
471 Ga0500643_015216 3300053087 Bacteria 2644
472 Ga0500651_0004195 3300053093 Bacteria 8043
473 Ga0500556_0106315 3300053104 Bacteria 1085
474 Ga0500562_017035 3300053108 Bacteria 1871
475 Ga0500569_000647 3300053109 Bacteria 5964
476 Ga0500642_0134604 3300053130 Bacteria 1158
477 Ga0500658_0000491 3300053134 Bacteria 16931
478 Ga0500568_0016163 3300053139 Bacteria 3324
479 Ga0500603_012189 3300053150 Bacteria 1969
480 Ga0500616_0030741 3300053153 Bacteria 2946
481 Ga0500622_0048460 3300053156 Bacteria 2192
482 Ga0500645_000006 3300053730 Bacteria 276677
483 Ga0501084_0022328 3300054114 Bacteria 5281
484 Ga0501084_0839377 3300054114 Bacteria 773
485 Ga0501082_0012565 3300060353 Bacteria 7275
486 Ga0501082_0658814 3300060353 Unclassified 916
487 Ga0530510_0170358 3300061734 Bacteria 1613
488 2510136779 2510065019 Bacteria 6903379
489 2510899956 2510461076 Bacteria 8618824
490 2510900552 2510461076 Bacteria 8618824
491 2513576667 2513237085 Bacteria 7695351
492 2513710068 2513237103 Bacteria 7647401
493 2514021415 2513237162 Bacteria 7468464
494 2515115354 2515075009 Bacteria 7288508
495 2515636083 2515154113 Bacteria 7807172
496 2515644761 2515154114 Bacteria 7848616
497 2515658060 2515154116 Bacteria 7552979
498 2515742215 2515154134 Bacteria 7220242
499 2517041651 2516653077 Bacteria 7555578
500 2517080766 2516653085 Bacteria 7346596
501 2517411063 2517287029 Bacteria 6905599
502 2530644861 2529292951 Bacteria 6916614
503 2585524448 2585427526 Bacteria 7258840
504 2719667880 2718217997 Bacteria 6740740
505 2720494643 2718218199 Bacteria 6740745
506 2720610978 2718218232 Bacteria 6720332
507 2720629227 2718218235 Bacteria 6630699
508 2720771799 2718218269 Bacteria 6906114
509 2723029201 2721755556 Bacteria 6745503
510 2723562836 2721755684 Bacteria 6859907
511 2723570826 2721755685 Bacteria 6704835
512 2724086619 2721755819 Bacteria 6906405
513 2724106777 2721755822 Bacteria 6726041
514 2724107578 2721755823 Bacteria 6752556
515 2730105515 2728369352 Bacteria 6745171
516 2805927891 2802429605 Bacteria 6875453
517 2805933738 2802429606 Bacteria 6346811
518 2838019296 2838016132 Bacteria 6577831
519 2838050361 2838048938 Bacteria 6044578
520 2838063065 2838061910 Bacteria 6794874
521 2838071630 2838068647 Bacteria 6208656
522 2838673696 2838668709 Bacteria 6671819
523 2838692265 2838686498 Bacteria 7807632
524 2838705271 2838701080 Bacteria 6669771
525 2838734317 2838729681 Bacteria 7400765
526 2838746769 2838742623 Bacteria 7396178
527 2841853460 2841851746 Bacteria 7532261
528 2842150239 2842146304 Bacteria 5957337
529 2842161455 2842156927 Bacteria 6894975
530 2842167340 2842163707 Bacteria 6916235
531 2842185744 2842180545 Bacteria 6888678
532 2842195482 2842192696 Bacteria 6147454
533 2842223108 2842217011 Bacteria 7497767
534 2842234085 2842229732 Bacteria 7475766
535 2842246386 2842243621 Bacteria 7421798
536 2842254925 2842250916 Bacteria 6579627
537 2842260754 2842257432 Bacteria 7401195
538 2842269348 2842264693 Bacteria 6472963
539 2842276043 2842271015 Bacteria 7807131
540 2842308638 2842304105 Bacteria 7023636
541 2842311968 2842311132 Bacteria 6616990
542 2842319244 2842317721 Bacteria 6793725
543 2842396694 2842395702 Bacteria 6780583
544 2842425263 2842422224 Bacteria 6239196
545 2842432695 2842428310 Bacteria 6767288
546 2842438857 2842434925 Bacteria 6502746
547 2842445487 2842441272 Bacteria 6769273
548 2842449941 2842447887 Bacteria 6754142
549 2842467732 2842462802 Bacteria 6588055
550 2842473472 2842469257 Bacteria 6752936
551 2842491690 2842489311 Bacteria 6620893
552 2842499761 2842495871 Bacteria 6820686
553 2842924198 2842922631 Bacteria 5824079
554 2844460818 2844454524 Bacteria 7952546
555 2909046438 2909042592 Bacteria 6499737
556 2920825318 2920822456 Bacteria 6897201
557 2933575231 2933570622 Bacteria 7023390
558 2933602429 2933599457 Bacteria 5858799
559 2935906876 2935901341 Bacteria 7341747
560 2936370458 2936367885 Bacteria 7324495
561 2936378123 2936375103 Bacteria 6652732
562 8005288010 8005282627 Bacteria 6675747
563 8005313333 8005307578 Bacteria 7395396
564 8005382132 8005376324 Bacteria 6590079
565 8005431293 8005430974 Bacteria 6689030
566 8005466579 8005460587 Bacteria 7157962
567 8005503291 8005497431 Bacteria 6477605
568 8005625431 8005619151 Bacteria 7030230
569 8005630413 8005626139 Bacteria 6534237
570 8005674809 8005668836 Bacteria 6953162
571 8005696881 8005695170 Bacteria 6912330
572 8018166183 8018163183 Bacteria 7277977
573 8023688347 8023680758 Bacteria 7729763
574 8024503982 8024501048 Bacteria 6427847
575 8057880812 8057874678 Bacteria 7494653
576 Ga0373936_0059557
577 SwRhRL2b_contig_3207873
578 MRS1b_contig_1777220
579 JGI24739J22299_10013673
580 JGI24737J22298_10010536
581 JGI24735J21928_10018499
582 JGI25156J39149_1011524
583 JGI25157J39369_1002286
584 rootL2_10084468
585 Ga0055525_1000242
586 Ga0055527_1000063
587 Ga0055535_1000406
588 Ga0055542_1000146
589 Ga0055542_1003953
590 Ga0055529_1000597
591 Ga0065704_10070205
592 Ga0070683_100280050
593 Ga0070690_100002154
594 Ga0070670_100012748
595 Ga0070666_10002154
596 Ga0068868_100006389
597 Ga0070661_100001122
598 Ga0070661_100054868
599 Ga0070661_100325400
600 Ga0070669_100057936
601 Ga0070675_100061708
602 Ga0070674_100330084
603 Ga0070673_100048139
604 Ga0070667_100004657
605 Ga0070667_100006083
606 Ga0070714_100007079
607 Ga0070711_100549780
608 Ga0070663_100225720
609 Ga0070681_10052179
610 Ga0070681_10521562
611 Ga0070685_10111453
612 Ga0070685_10186175
613 Ga0070679_100060786
614 Ga0070684_100108465
615 Ga0070684_100246867
616 Ga0068853_100001404
617 Ga0068853_100128191
618 Ga0070672_100000725
619 Ga0070672_100642132
620 Ga0070686_100118636
621 Ga0070696_100166275
622 Ga0070693_100303887
623 Ga0070665_100315654
624 Ga0068855_100001490
625 Ga0068855_100029771
626 Ga0070664_100000389
627 Ga0070664_100353441
628 Ga0068857_100025418
629 Ga0068857_100063398
630 Ga0068854_100020296
631 Ga0068856_100000065
632 Ga0068856_100044653
633 Ga0068852_100005382
634 Ga0068859_100574357
635 Ga0068864_100011436
636 Ga0068851_10001310
637 Ga0068863_100010409
638 Ga0068858_100057939
639 Ga0068858_100229374
640 Ga0068860_100099908
641 Ga0068862_100059198
642 Ga0081455_10094677
643 Ga0075363_100004002
644 Ga0075363_100013704
645 Ga0075364_10015693
646 Ga0075362_10004567
647 Ga0075367_10007643
648 Ga0075369_10011734
649 Ga0097621_100000908
650 Ga0097621_100475251
651 Ga0097621_100887635
652 Ga0068871_100978791
653 Ga0075431_100313322
654 Ga0075431_100375018
655 Ga0075434_100661159
656 Ga0097620_100574356
657 Ga0099794_10205016
658 Ga0105240_10007943
659 Ga0105240_10068422
660 Ga0105240_10072658
661 Ga0105245_10081796
662 Ga0105241_10072294
663 Ga0105241_10120372
664 Ga0105241_10255371
665 Ga0105242_10220099
666 Ga0105248_10474009
667 Ga0105237_10169818
668 Ga0105238_10001064
669 Ga0105238_10009489
670 Ga0105238_10046958
671 Ga0105238_11035137
672 Ga0105249_10835679
673 Ga0099796_10021181
674 Ga0105239_10010423
675 Ga0105239_10047705
676 Ga0105239_10342656
677 Ga0105246_10182725
678 Ga0157371_10097588
679 Ga0157370_10139839
680 Ga0157369_10000264
681 Ga0157374_10000496
682 Ga0157374_10114159
683 Ga0157378_10011036
684 Ga0157378_11049154
685 Ga0163162_10097868
686 Ga0163162_10269401
687 Ga0157372_10001696
688 Ga0157372_10223501
689 Ga0157375_10000631
690 Ga0157375_10126084
691 Ga0163163_10005157
692 Ga0163163_10069266
693 Ga0157380_10373996
694 Ga0157377_10234060
695 Ga0157379_10446658
696 Ga0157376_10066812
697 Ga0157376_10291159
698 Ga0183363_1151
699 Ga0163161_10116256
700 Ga0197907_10371358
701 Ga0197907_11490845
702 Ga0206356_11908769
703 Ga0206349_1819953
704 Ga0206355_1330646
705 Ga0206352_10323814
706 Ga0206350_10769023
707 Ga0206353_10866523
708 Ga0206353_11323159
709 Ga0213872_10148801
710 Ga0213874_10035085
711 Ga0224712_10015693
712 Ga0209672_100007
713 Ga0209672_102534
714 Ga0209563_100071
715 Ga0209258_100017
716 Ga0209258_100758
717 Ga0209148_1000044
718 Ga0209148_1003930
719 Ga0209759_1000166
720 Ga0209455_1000010
721 Ga0209758_1002527
722 Ga0207656_10005726
723 Ga0207692_10242719
724 Ga0207647_10020459
725 Ga0207705_10359277
726 Ga0207684_10222483
727 Ga0207654_10000806
728 Ga0207654_10041276
729 Ga0207707_10301952
730 Ga0207707_10475934
731 Ga0207695_10003805
732 Ga0207695_10058711
733 Ga0207671_10108228
734 Ga0207671_10194907
735 Ga0207663_10364322
736 Ga0207660_10268303
737 Ga0207649_10000284
738 Ga0207652_10016468
739 Ga0207652_10139955
740 Ga0207694_10000273
741 Ga0207650_10002280
742 Ga0207659_10211222
743 Ga0207687_10100122
744 Ga0207687_10101557
745 Ga0207706_10049972
746 Ga0207686_10252160
747 Ga0207709_10244619
748 Ga0207669_10299773
749 Ga0207665_10070163
750 Ga0207691_10003915
751 Ga0207691_10125097
752 Ga0207711_10257141
753 Ga0207661_10413688
754 Ga0207667_10000413
755 Ga0207667_10010297
756 Ga0207667_10230187
757 Ga0207651_10029706
758 Ga0207668_10086882
759 Ga0207640_10044828
760 Ga0207640_10107714
761 Ga0207658_10020977
762 Ga0207658_10034454
763 Ga0207677_10020674
764 Ga0207703_10013371
765 Ga0207703_10072398
766 Ga0207703_10089031
767 Ga0207639_10005178
768 Ga0207639_10024836
769 Ga0207678_10406388
770 Ga0207702_10000003
771 Ga0207702_10000209
772 Ga0207702_10067303
773 Ga0207702_10716038
774 Ga0207641_10015952
775 Ga0207641_10039799
776 Ga0207641_10102875
777 Ga0207676_10005705
778 Ga0207676_10257604
779 Ga0207674_10007519
780 Ga0207674_10073263
781 Ga0207675_100235392
782 Ga0207675_100644600
783 Ga0207698_10097751
784 Ga0207698_10137713
785 Ga0209179_1013762
786 Ga0268265_10044953
787 Ga0268264_10117934
788 Ga0268264_10260651
789 Ga0265334_10000033
790 Ga0265330_10028027
791 Ga0265332_10008046
792 Ga0265325_10001741
793 Ga0265329_10010776
794 Ga0265340_10006067
795 Ga0265340_10044431
796 Ga0265339_10001424
797 Ga0265331_10000002
798 Ga0265331_10028117
799 Ga0265331_10047000
800 Ga0265331_10068403
801 Ga0265331_10128618
802 Ga0265327_10000074
803 Ga0265316_10010203
804 Ga0265314_10001465
805 Ga0265314_10008922
806 Ga0265314_10015545
807 Ga0265314_10055700
808 Ga0265314_10063383
809 Ga0265314_10065678
810 Ga0265314_10156494
811 Ga0265314_10234126
812 Ga0265342_10004642
813 Ga0265342_10023159
814 Ga0307516_10004445
815 Ga0373934_0025045
816 Ga0373923_0005091
817 Ga0373945_0013035
818 Ga0373953_0001606
819 Ga0373954_0039304
820 Ga0373956_0007284
821 Ga0373957_0103545
822 Ga0373943_0003490
823 Ga0373946_0004458
824 Ga0373955_0000346
825 Ga0373955_0275809
826 Ga0373924_0001455
827 Ga0373935_0000056
828 Ga0373927_0033737
829 Ga0373933_0004205
830 Ga0373947_0004488
831 Ga0373937_0000075
832 Ga0373937_0351196
833 Ga0373925_0000159
834 Ga0395899_0008203
835 Ga0395900_0162295
836 Ga0395898_0000460
837 Ga0436364_0596856
838 Ga0237819_00130
839 Ga0436360_0064513
840 Ga0436361_0709744
841 Ga0436363_0268886
842 Ga0436363_1116204
843 Ga0436363_1546557
844 Ga0439461_0006955
845 Ga0451833_0552563
846 Ga0451835_0259487
847 Ga0451837_0291003
848 Ga0451839_1037019
849 Ga0451845_0815701
850 Ga0451849_0008212
851 Ga0451843_0322861
852 Ga0451855_0762862
853 Ga0451853_0670545
854 Ga0466969_0004995
855 Ga0466966_0005052
856 Ga0466961_0001260
857 Ga0466961_0024959
858 Ga0466961_0202667
859 Ga0466970_0002513
860 Ga0466970_0045572
861 Ga0466957_0042584
862 Ga0466959_0210400
863 Ga0451576_0011229
864 Ga0466958_0421763
865 Ga0495592_0000102
866 Ga0495629_0146456
867 Ga0495651_0001236
868 Ga0495653_0000036
869 Ga0495580_0325332
870 Ga0495662_0006322
871 Ga0495662_0094223
872 Ga0495664_0000107
873 Ga0495607_0053093
874 Ga0495606_0010004
875 Ga0495608_0000006
876 Ga0495608_0080799
877 Ga0495610_0020204
878 Ga0495618_0000057
879 Ga0495618_0191810
880 Ga0495620_0027483
881 Ga0495628_0000077
882 Ga0495630_0001707
883 Ga0495643_0010530
884 Ga0495648_0074512
885 Ga0495652_0000005
886 Ga0495640_0000007
887 Ga0495586_0034542
888 Ga0495587_0000043
889 Ga0495597_0018607
890 Ga0495645_0000275
891 Ga0495667_0000023
892 Ga0495667_0000235
893 Ga0495634_0000049
894 Ga0495634_0166062
895 Ga0495635_0000021
896 Ga0495657_0000063
897 Ga0495657_0001655
898 Ga0495599_0000001
899 Ga0495599_0167828
900 Ga0495623_0000056
901 Ga0495646_0000007
902 Ga0495658_0010076
903 Ga0495613_0056629
904 Ga0495613_0414465
905 Ga0495600_0000047
906 Ga0495600_0566138
907 Ga0495604_0000014
908 Ga0495674_0000014
909 Ga0495674_0004659
910 Ga0495680_0000744
911 Ga0495675_0000940
912 Ga0495684_0000272
913 Ga0495686_0009589
914 Ga0495593_0103367
915 Ga0495602_0000017
916 Ga0495626_0079418
917 Ga0496104_0156832
918 Ga0496105_0405953
919 Ga0496108_0022862
920 Ga0496108_0055537
921 Ga0496109_0020142
922 Ga0496109_0052104
923 Ga0496110_0038590
924 Ga0496110_0048100
925 Ga0496111_0058755
926 Ga0496112_0006460
927 Ga0496112_0014728
928 Ga0496112_0082646
929 Ga0496113_0034460
930 Ga0496113_0034858
931 Ga0496115_0159555
932 Ga0496119_0089775
933 Ga0496121_0012588
934 Ga0496121_0013808
935 Ga0496125_0000237
936 Ga0496126_0191204
937 Ga0496126_0282062
938 Ga0501031_0017115
939 Ga0501031_0038407
940 Ga0501032_0008783
941 Ga0501032_0048959
942 Ga0501033_0001474
943 Ga0501033_0004101
944 Ga0501033_0053052
945 Ga0501033_0157684
946 Ga0501033_0250107
947 Ga0501033_0282691
948 Ga0501034_0011186
949 Ga0501034_0027091
950 Ga0501034_0036050
951 Ga0501034_0050255
952 Ga0501034_0437366
953 Ga0501036_0011010
954 Ga0501036_0030209
955 Ga0501036_0056776
956 Ga0501036_0116011
957 Ga0501037_0024080
958 Ga0501037_0052454
959 Ga0501037_0148839
960 Ga0501037_0151751
961 Ga0501038_0006326
962 Ga0501038_0031567
963 Ga0501038_0053727
964 Ga0501038_0081585
965 Ga0501039_0004711
966 Ga0501039_0107609
967 Ga0501039_0315619
968 Ga0501040_0003148
969 Ga0501040_0006328
970 Ga0501041_0002832
971 Ga0501042_0007786
972 Ga0501043_0010736
973 Ga0501046_0000115
974 Ga0501046_0000433
975 Ga0501046_0035056
976 Ga0501046_0041778
977 Ga0501046_0106012
978 Ga0501046_0191071
979 Ga0501047_0004044
980 Ga0501047_0014218
981 Ga0501047_0058799
982 Ga0501047_0091100
983 Ga0501047_0104900
984 Ga0501047_0165685
985 Ga0501048_0019363
986 Ga0501048_0086834
987 Ga0501048_0781921
988 Ga0501067_0040472
989 Ga0501067_0062371
990 Ga0501068_0024536
991 Ga0501068_0374182
992 Ga0501070_0003773
993 Ga0501070_0021689
994 Ga0501070_0062243
995 Ga0501070_0573833
996 Ga0501072_0185970
997 Ga0501072_0479235
998 Ga0501073_0006172
999 Ga0501073_0008282
1000 Ga0501073_0041233
1001 Ga0501073_0076247
1002 Ga0501073_0179107
1003 Ga0501074_0007305
1004 Ga0501074_0008596
1005 Ga0501074_0260120
1006 Ga0501076_0002219
1007 Ga0501076_0257747
1008 Ga0501077_0016658
1009 Ga0501079_0005199
1010 Ga0501080_0005552
1011 Ga0501080_0012585
1012 Ga0501080_0020036
1013 Ga0501081_0006281
1014 Ga0501083_0006332
1015 Ga0501083_0018840
1016 Ga0501083_0045918
1017 Ga0501083_0219670
1018 Ga0501035_0001607
1019 Ga0501035_0002718
1020 Ga0501035_0010537
1021 Ga0501035_0059364
1022 Ga0501044_0001279
1023 Ga0501044_0008771
1024 Ga0501044_0013927
1025 Ga0501044_0014482
1026 Ga0501044_0240000
1027 Ga0501044_0328555
1028 Ga0501044_0860456
1029 Ga0501045_0013884
1030 Ga0501045_0069875
1031 nmdc:mga03683_38150_c1
1032 nmdc:mga03n38_38757_c1
1033 nmdc:mga00v17_6527_c1
1034 nmdc:mga0yw44_54033_c1
1035 nmdc:mga06z11_10355_c1
1036 nmdc:mga06z11_285571_c1
1037 nmdc:mga06r32_205309_c1
1038 nmdc:mga06r32_718631_c1
1039 nmdc:mga0n895_138483_c1
1040 Ga0495601_0000016
1041 Ga0495612_0000035
1042 Ga0495595_0000032
1043 Ga0495619_0000033
1044 Ga0495619_0123350
1045 Ga0500643_006600
1046 Ga0500643_015216
1047 Ga0500651_0004195
1048 Ga0500556_0106315
1049 Ga0500562_017035
1050 Ga0500569_000647
1051 Ga0500642_0134604
1052 Ga0500658_0000491
1053 Ga0500568_0016163
1054 Ga0500603_012189
1055 Ga0500616_0030741
1056 Ga0500622_0048460
1057 Ga0500645_000006
1058 Ga0501084_0022328
1059 Ga0501084_0839377
1060 Ga0501082_0012565
1061 Ga0501082_0658814
1062 Ga0530510_0170358
1063 2510136779
1064 2510899956
1065 2510900552
1066 2513576667
1067 2513710068
1068 2514021415
1069 2515115354
1070 2515636083
1071 2515644761
1072 2515658060
1073 2515742215
1074 2517041651
1075 2517080766
1076 2517411063
1077 2530644861
1078 2585524448
1079 2719667880
1080 2720494643
1081 2720610978
1082 2720629227
1083 2720771799
1084 2723029201
1085 2723562836
1086 2723570826
1087 2724086619
1088 2724106777
1089 2724107578
1090 2730105515
1091 2805927891
1092 2805933738
1093 2838019296
1094 2838050361
1095 2838063065
1096 2838071630
1097 2838673696
1098 2838692265
1099 2838705271
1100 2838734317
1101 2838746769
1102 2841853460
1103 2842150239
1104 2842161455
1105 2842167340
1106 2842185744
1107 2842195482
1108 2842223108
1109 2842234085
1110 2842246386
1111 2842254925
1112 2842260754
1113 2842269348
1114 2842276043
1115 2842308638
1116 2842311968
1117 2842319244
1118 2842396694
1119 2842425263
1120 2842432695
1121 2842438857
1122 2842445487
1123 2842449941
1124 2842467732
1125 2842473472
1126 2842491690
1127 2842499761
1128 2842924198
1129 2844460818
1130 2909046438
1131 2920825318
1132 2933575231
1133 2933602429
1134 2935906876
1135 2936370458
1136 2936378123
1137 8005288010
1138 8005313333
1139 8005382132
1140 8005431293
1141 8005466579
1142 8005503291
1143 8005625431
1144 8005630413
1145 8005674809
1146 8005696881
1147 8018166183
1148 8023688347
1149 8024503982
1150 8057880812

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

70

224

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.9504 50 203
7e43-assembly2.cif.gz_A structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori 0.9481 48 198
7e43-assembly1.cif.gz_B structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori 0.9431 48 198
5fa9-assembly1.cif.gz_A bifunctional methionine sulfoxide reductase ab (msrab) from treponema denticola 0.9413 48 200
3bqf-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (complex with a substrate) 0.9394 47 200
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9426 50 196 3.30.1060.10
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9378 46 200 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.924 50 196 3.30.1060.10
af_A4HTE0_2_175_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.917 47 200 3.30.1060.10
af_B6TNT5_14_185_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9164 38 196 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A4Q5W4M2-F1-model_v4 deleted 0.9951 52 224
AF-A0A0Q6KCK6-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9943 37 223 GO:0008113
GO:0033744
GO:0036211
AF-A0A529Y1Q5-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9907 74 224 GO:0008113
GO:0033744
AF-A0A531KWY7-F1-model_v4 deleted 0.9903 42 224
AF-A0A2R7T6Q3-F1-model_v4 deleted 0.9901 107 224

Map