F465398

General Info

Members Datasets Scaffolds Average Seq Length
575 269 1150 132

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_12502529|Ga0157375_125025291
Length 157
Sequence LEVAVIEFTLDGRSGVSPYLQVVQQVRQALRLGLLREGDQLPTVKDVVARLAINPNTVLKAYRELERDGLVSARPGVGTFVTRSLVDASHAAHQPLRRELRRWLAKARLAGLDDESIEALFASTFRAAGEEIACPPCRGPTPWASATAAGGRSPTAP

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
96 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
97 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
197 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
202 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
203 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
204 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
205 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
206 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
207 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
208 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
265 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
266 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 1.04
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.3
Nodule 0.17
Rhizoplane 14.26
Rhizosphere 79.83
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_12502529 3300013308 Bacteria 616
2 Ga0070658_10032520 3300005327 Bacteria 4193
3 Ga0070683_100323878 3300005329 Bacteria 1467
4 Ga0070683_100349073 3300005329 Bacteria 1409
5 Ga0070683_101231713 3300005329 Bacteria 719
6 Ga0070683_101800910 3300005329 Bacteria 588
7 Ga0070670_100251650 3300005331 Bacteria 1539
8 Ga0068869_100036929 3300005334 Bacteria 3471
9 Ga0070680_100015121 3300005336 Bacteria 6043
10 Ga0070680_100699229 3300005336 Bacteria 872
11 Ga0070682_100003716 3300005337 Bacteria 8480
12 Ga0070682_101588501 3300005337 Bacteria 565
13 Ga0068868_100318959 3300005338 Bacteria 1323
14 Ga0068868_100370320 3300005338 Bacteria 1231
15 Ga0068868_100642247 3300005338 Bacteria 944
16 Ga0070660_100163165 3300005339 Bacteria 1796
17 Ga0070660_101066290 3300005339 Bacteria 683
18 Ga0070687_100380937 3300005343 Bacteria 919
19 Ga0070687_101304638 3300005343 Bacteria 539
20 Ga0070661_100135735 3300005344 Bacteria 1851
21 Ga0070692_10307094 3300005345 Bacteria 970
22 Ga0070692_10615419 3300005345 Bacteria 720
23 Ga0070668_100159052 3300005347 Bacteria 1832
24 Ga0070669_100214238 3300005353 Bacteria 1521
25 Ga0070669_101205559 3300005353 Bacteria 654
26 Ga0070675_100004857 3300005354 Bacteria 10256
27 Ga0070675_102144943 3300005354 Bacteria 515
28 Ga0070671_100003295 3300005355 Bacteria 12597
29 Ga0070671_100340655 3300005355 Bacteria 1279
30 Ga0070671_101769050 3300005355 Bacteria 549
31 Ga0070674_100875127 3300005356 Bacteria 781
32 Ga0070674_101147294 3300005356 Bacteria 688
33 Ga0070673_100422285 3300005364 Bacteria 1196
34 Ga0070673_101638790 3300005364 Bacteria 608
35 Ga0070688_100699257 3300005365 Bacteria 785
36 Ga0070659_100486621 3300005366 Bacteria 1050
37 Ga0070659_100791729 3300005366 Bacteria 824
38 Ga0070659_100836458 3300005366 Bacteria 802
39 Ga0070667_100072850 3300005367 Bacteria 2928
40 Ga0070667_101767680 3300005367 Bacteria 582
41 Ga0070709_10034595 3300005434 Bacteria 3064
42 Ga0070714_100042725 3300005435 Bacteria 3831
43 Ga0070714_100049492 3300005435 Bacteria 3577
44 Ga0070713_100022114 3300005436 Bacteria 4908
45 Ga0070713_100026977 3300005436 Bacteria 4517
46 Ga0070710_11026900 3300005437 Bacteria 602
47 Ga0070701_10015317 3300005438 Bacteria 3538
48 Ga0070711_100366192 3300005439 Bacteria 1162
49 Ga0070711_101022831 3300005439 Bacteria 709
50 Ga0070705_101584762 3300005440 Bacteria 551
51 Ga0070700_100425056 3300005441 Bacteria 1005
52 Ga0070700_100434934 3300005441 Bacteria 995
53 Ga0070694_101062764 3300005444 Bacteria 674
54 Ga0070708_100114832 3300005445 Bacteria 2478
55 Ga0070708_100217741 3300005445 Bacteria 1790
56 Ga0070708_102073270 3300005445 Bacteria 526
57 Ga0070663_100002605 3300005455 Bacteria 10192
58 Ga0070663_100550114 3300005455 Bacteria 965
59 Ga0070678_100001309 3300005456 Bacteria 13202
60 Ga0070678_101967105 3300005456 Bacteria 553
61 Ga0070662_100202007 3300005457 Bacteria 1578
62 Ga0070662_100891393 3300005457 Bacteria 759
63 Ga0070681_10111387 3300005458 Bacteria 2676
64 Ga0070681_10413167 3300005458 Bacteria 1261
65 Ga0070681_10886424 3300005458 Bacteria 810
66 Ga0068867_100978776 3300005459 Bacteria 766
67 Ga0070706_100000298 3300005467 Bacteria 60360
68 Ga0070706_100002210 3300005467 Bacteria 19798
69 Ga0070706_100010818 3300005467 Bacteria 8470
70 Ga0070706_100020502 3300005467 Bacteria 6092
71 Ga0070706_100677583 3300005467 Bacteria 957
72 Ga0070707_100027458 3300005468 Bacteria 5416
73 Ga0070707_100038788 3300005468 Bacteria 4551
74 Ga0070707_100095423 3300005468 Bacteria 2880
75 Ga0070707_100104118 3300005468 Bacteria 2751
76 Ga0070707_100190542 3300005468 Bacteria 1999
77 Ga0070698_100018862 3300005471 Bacteria 7258
78 Ga0070698_100024547 3300005471 Bacteria 6289
79 Ga0070698_101191164 3300005471 Bacteria 711
80 Ga0070699_100314252 3300005518 Unclassified 1407
81 Ga0070699_100367141 3300005518 Bacteria 1298
82 Ga0070699_100645891 3300005518 Bacteria 966
83 Ga0070679_100250759 3300005530 Bacteria 1726
84 Ga0070684_100818531 3300005535 Bacteria 871
85 Ga0070684_101736503 3300005535 Bacteria 589
86 Ga0070697_100344082 3300005536 Bacteria 1287
87 Ga0068853_100070765 3300005539 Bacteria 3037
88 Ga0068853_100329287 3300005539 Bacteria 1417
89 Ga0070672_100012961 3300005543 Bacteria 5876
90 Ga0070672_100196614 3300005543 Bacteria 1685
91 Ga0070672_100569490 3300005543 Bacteria 985
92 Ga0070672_102038055 3300005543 Bacteria 517
93 Ga0070693_100000859 3300005547 Bacteria 13570
94 Ga0070693_100809859 3300005547 Bacteria 695
95 Ga0070665_100000310 3300005548 Bacteria 75775
96 Ga0070665_100047969 3300005548 Bacteria 4288
97 Ga0068855_100185018 3300005563 Bacteria 2353
98 Ga0068857_100191714 3300005577 Bacteria 1862
99 Ga0068854_100281586 3300005578 Bacteria 1339
100 Ga0068854_100282298 3300005578 Bacteria 1337
101 Ga0068856_100013323 3300005614 Bacteria 7962
102 Ga0070702_100004035 3300005615 Bacteria 6662
103 Ga0068852_100002965 3300005616 Bacteria 11796
104 Ga0068852_100197353 3300005616 Bacteria 1903
105 Ga0068852_100208937 3300005616 Bacteria 1851
106 Ga0068852_100815088 3300005616 Bacteria 948
107 Ga0068852_101428773 3300005616 Bacteria 714
108 Ga0068852_101460532 3300005616 Bacteria 706
109 Ga0068859_100123921 3300005617 Bacteria 2652
110 Ga0068859_100980510 3300005617 Bacteria 928
111 Ga0068859_101747561 3300005617 Bacteria 687
112 Ga0068864_100009916 3300005618 Bacteria 7857
113 Ga0068864_101461945 3300005618 Bacteria 686
114 Ga0068866_11157260 3300005718 Bacteria 557
115 Ga0068851_10017114 3300005834 Bacteria 3478
116 Ga0068870_10000140 3300005840 Bacteria 25200
117 Ga0068870_10441484 3300005840 Bacteria 856
118 Ga0068863_100006628 3300005841 Bacteria 11364
119 Ga0068863_100299476 3300005841 Bacteria 1560
120 Ga0068858_100153652 3300005842 Bacteria 2165
121 Ga0068860_100001155 3300005843 Bacteria 28873
122 Ga0068860_100091611 3300005843 Bacteria 2896
123 Ga0068860_101105072 3300005843 Bacteria 812
124 Ga0068860_101453085 3300005843 Bacteria 707
125 Ga0068862_100073790 3300005844 Bacteria 2949
126 Ga0068862_100842272 3300005844 Bacteria 898
127 Ga0070717_10462720 3300006028 Bacteria 1144
128 Ga0070717_10763287 3300006028 Bacteria 879
129 Ga0075365_10003743 3300006038 Bacteria 7914
130 Ga0075365_10137940 3300006038 Bacteria 1692
131 Ga0075365_10329928 3300006038 Bacteria 1075
132 Ga0075365_10490679 3300006038 Bacteria 868
133 Ga0075365_10890513 3300006038 Bacteria 627
134 Ga0075364_10011296 3300006051 Bacteria 5423
135 Ga0075432_10032764 3300006058 Bacteria 1800
136 Ga0070716_100132891 3300006173 Bacteria 1576
137 Ga0070712_100019133 3300006175 Bacteria 4460
138 Ga0070712_100679544 3300006175 Bacteria 876
139 Ga0097621_100751074 3300006237 Bacteria 901
140 Ga0068871_101335073 3300006358 Bacteria 675
141 Ga0075428_100000760 3300006844 Bacteria 33463
142 Ga0075428_100371859 3300006844 Bacteria 1532
143 Ga0075430_100280469 3300006846 Bacteria 1379
144 Ga0075431_100849340 3300006847 Bacteria 884
145 Ga0075431_101301456 3300006847 Bacteria 688
146 Ga0075433_10003677 3300006852 Bacteria 11863
147 Ga0075434_100032404 3300006871 Bacteria 5153
148 Ga0068865_101667486 3300006881 Bacteria 574
149 Ga0068865_101830320 3300006881 Bacteria 549
150 Ga0068865_101832163 3300006881 Bacteria 549
151 Ga0075436_100002600 3300006914 Bacteria 12404
152 Ga0075436_100024214 3300006914 Bacteria 4173
153 Ga0097620_100123919 3300006931 Bacteria 2652
154 Ga0097620_100980576 3300006931 Bacteria 928
155 Ga0097620_101748207 3300006931 Bacteria 687
156 Ga0099826_10286290 3300006948 Bacteria 849
157 Ga0075435_100025322 3300007076 Bacteria 4618
158 Ga0105240_10136515 3300009093 Bacteria 2937
159 Ga0111539_10017139 3300009094 Bacteria 8968
160 Ga0105245_10021987 3300009098 Bacteria 5597
161 Ga0105245_10051710 3300009098 Bacteria 3683
162 Ga0105245_10065679 3300009098 Bacteria 3281
163 Ga0105245_10195349 3300009098 Bacteria 1941
164 Ga0105247_10034676 3300009101 Bacteria 3074
165 Ga0114129_10039923 3300009147 Bacteria 6621
166 Ga0114129_10146444 3300009147 Bacteria 3235
167 Ga0105243_10343876 3300009148 Bacteria 1367
168 Ga0105243_10361658 3300009148 Bacteria 1336
169 Ga0105243_10398813 3300009148 Bacteria 1277
170 Ga0105243_11173836 3300009148 Bacteria 780
171 Ga0105243_11353367 3300009148 Bacteria 731
172 Ga0105243_12061697 3300009148 Bacteria 606
173 Ga0105241_10003380 3300009174 Bacteria 11887
174 Ga0105241_10454158 3300009174 Bacteria 1134
175 Ga0105242_10369187 3300009176 Bacteria 1330
176 Ga0105242_10885320 3300009176 Bacteria 891
177 Ga0105242_12806840 3300009176 Bacteria 537
178 Ga0105242_13288375 3300009176 Bacteria 502
179 Ga0105248_10007742 3300009177 Bacteria 11796
180 Ga0105248_11396810 3300009177 Bacteria 792
181 Ga0105248_11692689 3300009177 Bacteria 717
182 Ga0105237_10038516 3300009545 Bacteria 4828
183 Ga0105237_10334557 3300009545 Bacteria 1518
184 Ga0105238_10116362 3300009551 Bacteria 2653
185 Ga0105238_10451552 3300009551 Bacteria 1282
186 Ga0105238_10495126 3300009551 Bacteria 1222
187 Ga0105238_10681532 3300009551 Bacteria 1039
188 Ga0105249_10855794 3300009553 Bacteria 975
189 Ga0105249_11411593 3300009553 Bacteria 768
190 Ga0105239_10034943 3300010375 Bacteria 5520
191 Ga0105239_10145840 3300010375 Bacteria 2639
192 Ga0105239_11075283 3300010375 Bacteria 926
193 Ga0105239_11333918 3300010375 Bacteria 828
194 Ga0105239_11529078 3300010375 Bacteria 771
195 Ga0105239_13539202 3300010375 Bacteria 508
196 Ga0105246_10002181 3300011119 Bacteria 11804
197 Ga0157329_1037437 3300012491 Bacteria 530
198 Ga0157323_1006860 3300012495 Bacteria 807
199 Ga0157339_1056516 3300012505 Bacteria 533
200 Ga0157373_10254487 3300013100 Bacteria 1242
201 Ga0157371_10029759 3300013102 Bacteria 3946
202 Ga0157371_10725537 3300013102 Bacteria 745
203 Ga0157370_10013697 3300013104 Bacteria 8336
204 Ga0157370_10390430 3300013104 Bacteria 1281
205 Ga0157370_10541962 3300013104 Bacteria 1067
206 Ga0157370_11304701 3300013104 Bacteria 654
207 Ga0157370_11911624 3300013104 Bacteria 532
208 Ga0157369_10025627 3300013105 Bacteria 6544
209 Ga0157369_10566788 3300013105 Bacteria 1173
210 Ga0157369_10855131 3300013105 Bacteria 934
211 Ga0157369_11529765 3300013105 Bacteria 679
212 Ga0157374_10016287 3300013296 Bacteria 6532
213 Ga0157374_11239025 3300013296 Bacteria 768
214 Ga0157374_12015668 3300013296 Bacteria 603
215 Ga0157378_10069791 3300013297 Bacteria 3153
216 Ga0157378_10181938 3300013297 Bacteria 1978
217 Ga0157378_11879450 3300013297 Bacteria 648
218 Ga0163162_10336454 3300013306 Bacteria 1642
219 Ga0163162_10652604 3300013306 Bacteria 1176
220 Ga0163162_10856232 3300013306 Bacteria 1024
221 Ga0163162_11171264 3300013306 Bacteria 872
222 Ga0163162_11796643 3300013306 Bacteria 701
223 Ga0163162_12446785 3300013306 Bacteria 600
224 Ga0157372_10030708 3300013307 Bacteria 5879
225 Ga0157372_10470626 3300013307 Bacteria 1465
226 Ga0157372_10607933 3300013307 Bacteria 1274
227 Ga0157372_10636540 3300013307 Bacteria 1242
228 Ga0157372_10700242 3300013307 Bacteria 1179
229 Ga0157375_10036014 3300013308 Bacteria 4730
230 Ga0157375_10124659 3300013308 Bacteria 2689
231 Ga0157375_10367741 3300013308 Bacteria 1604
232 Ga0157375_10636454 3300013308 Bacteria 1224
233 Ga0157375_11233123 3300013308 Bacteria 878
234 Ga0157375_11268381 3300013308 Bacteria 865
235 Ga0163163_10081499 3300014325 Bacteria 3237
236 Ga0163163_10349443 3300014325 Bacteria 1535
237 Ga0163163_10371606 3300014325 Bacteria 1487
238 Ga0163163_10417498 3300014325 Bacteria 1400
239 Ga0163163_10452938 3300014325 Bacteria 1343
240 Ga0163163_10576518 3300014325 Bacteria 1188
241 Ga0157380_10452577 3300014326 Bacteria 1233
242 Ga0157380_11481827 3300014326 Bacteria 731
243 Ga0157380_11497531 3300014326 Bacteria 728
244 Ga0157380_12561948 3300014326 Bacteria 576
245 Ga0157380_12897092 3300014326 Bacteria 546
246 Ga0157377_10001415 3300014745 Bacteria 10346
247 Ga0157377_10144194 3300014745 Bacteria 1466
248 Ga0157377_10690876 3300014745 Bacteria 740
249 Ga0157377_11255344 3300014745 Bacteria 577
250 Ga0157379_10159779 3300014968 Bacteria 2034
251 Ga0157379_11380306 3300014968 Bacteria 682
252 Ga0157379_12234626 3300014968 Bacteria 544
253 Ga0157376_10615097 3300014969 Bacteria 1083
254 Ga0157376_10887969 3300014969 Bacteria 909
255 Ga0157376_11762735 3300014969 Bacteria 655
256 Ga0163161_10099587 3300017792 Bacteria 2162
257 Ga0163161_11174638 3300017792 Bacteria 662
258 Ga0163161_11420337 3300017792 Bacteria 607
259 Ga0206354_10863958 3300020081 Bacteria 923
260 Ga0206354_11133445 3300020081 Bacteria 981
261 Ga0206353_10483896 3300020082 Bacteria 1943
262 Ga0206353_11599500 3300020082 Bacteria 1054
263 Ga0224712_10554813 3300022467 Bacteria 558
264 Ga0224572_1006896 3300024225 Bacteria 2066
265 Ga0207656_10014061 3300025321 Bacteria 3075
266 Ga0207713_1114658 3300025735 Bacteria 911
267 Ga0207692_10390253 3300025898 Bacteria 866
268 Ga0207692_10806703 3300025898 Bacteria 614
269 Ga0207642_10314560 3300025899 Bacteria 912
270 Ga0207710_10028187 3300025900 Bacteria 2437
271 Ga0207688_10000944 3300025901 Bacteria 14723
272 Ga0207688_10074838 3300025901 Bacteria 1926
273 Ga0207699_10045206 3300025906 Bacteria 2569
274 Ga0207645_10226875 3300025907 Bacteria 1232
275 Ga0207643_10000139 3300025908 Bacteria 48989
276 Ga0207705_10020411 3300025909 Bacteria 4735
277 Ga0207684_10000539 3300025910 Bacteria 46762
278 Ga0207684_10000643 3300025910 Bacteria 41347
279 Ga0207684_10029763 3300025910 Bacteria 4649
280 Ga0207684_10050611 3300025910 Bacteria 3525
281 Ga0207684_11038139 3300025910 Bacteria 684
282 Ga0207654_10003320 3300025911 Bacteria 8142
283 Ga0207707_10233343 3300025912 Bacteria 1601
284 Ga0207707_10326144 3300025912 Bacteria 1325
285 Ga0207707_10807004 3300025912 Bacteria 781
286 Ga0207695_10124753 3300025913 Bacteria 2539
287 Ga0207671_10029265 3300025914 Bacteria 4114
288 Ga0207671_10034166 3300025914 Bacteria 3780
289 Ga0207693_10047650 3300025915 Bacteria 3367
290 Ga0207693_10824385 3300025915 Bacteria 714
291 Ga0207663_10006311 3300025916 Bacteria 6054
292 Ga0207663_10112202 3300025916 Bacteria 1852
293 Ga0207663_10649874 3300025916 Bacteria 832
294 Ga0207660_10058141 3300025917 Bacteria 2771
295 Ga0207660_10378905 3300025917 Bacteria 1137
296 Ga0207662_10994288 3300025918 Bacteria 595
297 Ga0207662_11264311 3300025918 Bacteria 524
298 Ga0207657_10061827 3300025919 Bacteria 3208
299 Ga0207657_10603140 3300025919 Bacteria 857
300 Ga0207649_10003882 3300025920 Bacteria 8154
301 Ga0207652_10005015 3300025921 Bacteria 10726
302 Ga0207646_10017356 3300025922 Bacteria 6737
303 Ga0207646_10024480 3300025922 Bacteria 5530
304 Ga0207646_10067681 3300025922 Bacteria 3188
305 Ga0207681_10224853 3300025923 Bacteria 1454
306 Ga0207681_10815524 3300025923 Bacteria 780
307 Ga0207694_10199109 3300025924 Bacteria 1629
308 Ga0207694_10286072 3300025924 Bacteria 1355
309 Ga0207650_10002194 3300025925 Bacteria 13651
310 Ga0207650_10847024 3300025925 Bacteria 776
311 Ga0207659_10005917 3300025926 Bacteria 7467
312 Ga0207687_10019448 3300025927 Bacteria 4500
313 Ga0207687_10067381 3300025927 Bacteria 2546
314 Ga0207687_10134855 3300025927 Bacteria 1866
315 Ga0207687_10882900 3300025927 Bacteria 765
316 Ga0207700_10016928 3300025928 Bacteria 4855
317 Ga0207700_10029023 3300025928 Bacteria 3899
318 Ga0207664_10048484 3300025929 Bacteria 3340
319 Ga0207664_10567638 3300025929 Bacteria 1018
320 Ga0207644_10020527 3300025931 Bacteria 4492
321 Ga0207644_10607917 3300025931 Bacteria 908
322 Ga0207644_11624691 3300025931 Bacteria 542
323 Ga0207690_10476945 3300025932 Bacteria 1006
324 Ga0207706_10306703 3300025933 Bacteria 1383
325 Ga0207706_10718387 3300025933 Bacteria 853
326 Ga0207686_10201778 3300025934 Bacteria 1425
327 Ga0207686_10624627 3300025934 Bacteria 850
328 Ga0207709_10327115 3300025935 Bacteria 1149
329 Ga0207709_10469577 3300025935 Bacteria 976
330 Ga0207709_10484094 3300025935 Bacteria 963
331 Ga0207670_10841851 3300025936 Bacteria 766
332 Ga0207669_10849783 3300025937 Bacteria 760
333 Ga0207704_10514220 3300025938 Bacteria 967
334 Ga0207704_10736874 3300025938 Bacteria 819
335 Ga0207665_10097196 3300025939 Bacteria 2050
336 Ga0207691_10314576 3300025940 Bacteria 1343
337 Ga0207691_10767031 3300025940 Bacteria 811
338 Ga0207691_11265012 3300025940 Bacteria 610
339 Ga0207711_10598032 3300025941 Bacteria 1029
340 Ga0207689_10003859 3300025942 Bacteria 13663
341 Ga0207661_10002645 3300025944 Bacteria 12327
342 Ga0207661_10210445 3300025944 Bacteria 1714
343 Ga0207661_10302918 3300025944 Bacteria 1433
344 Ga0207661_10970481 3300025944 Bacteria 783
345 Ga0207661_11175701 3300025944 Bacteria 706
346 Ga0207661_12025650 3300025944 Bacteria 522
347 Ga0207679_10001767 3300025945 Bacteria 13452
348 Ga0207667_10293268 3300025949 Bacteria 1662
349 Ga0207651_11931795 3300025960 Bacteria 531
350 Ga0207668_10551705 3300025972 Bacteria 998
351 Ga0207668_10915184 3300025972 Bacteria 781
352 Ga0207668_11675191 3300025972 Bacteria 574
353 Ga0207640_10023190 3300025981 Bacteria 3727
354 Ga0207640_12106596 3300025981 Bacteria 511
355 Ga0207658_10166484 3300025986 Bacteria 1811
356 Ga0207658_10514423 3300025986 Bacteria 1068
357 Ga0207677_10143134 3300026023 Bacteria 1834
358 Ga0207677_10195236 3300026023 Bacteria 1604
359 Ga0207677_10849835 3300026023 Bacteria 820
360 Ga0207677_11053327 3300026023 Bacteria 739
361 Ga0207639_10571432 3300026041 Bacteria 1040
362 Ga0207639_10613890 3300026041 Bacteria 1004
363 Ga0207639_11368542 3300026041 Bacteria 664
364 Ga0207678_10000358 3300026067 Bacteria 41445
365 Ga0207678_10885946 3300026067 Bacteria 789
366 Ga0207678_11422333 3300026067 Bacteria 613
367 Ga0207708_10189132 3300026075 Bacteria 1638
368 Ga0207708_10316952 3300026075 Bacteria 1271
369 Ga0207702_10001590 3300026078 Bacteria 22473
370 Ga0207702_10008632 3300026078 Bacteria 8595
371 Ga0207702_10513260 3300026078 Bacteria 1169
372 Ga0207641_10007769 3300026088 Bacteria 8911
373 Ga0207641_10949394 3300026088 Bacteria 855
374 Ga0207641_11933330 3300026088 Bacteria 591
375 Ga0207676_10007530 3300026095 Bacteria 7726
376 Ga0207676_10172502 3300026095 Bacteria 1886
377 Ga0207676_10547958 3300026095 Bacteria 1105
378 Ga0207674_10011708 3300026116 Bacteria 9845
379 Ga0207675_100947182 3300026118 Bacteria 878
380 Ga0207683_10002974 3300026121 Bacteria 14785
381 Ga0207698_10002013 3300026142 Bacteria 11983
382 Ga0207698_10053468 3300026142 Bacteria 3100
383 Ga0207698_10420223 3300026142 Bacteria 1283
384 Ga0207698_11238907 3300026142 Bacteria 760
385 Ga0207698_12200821 3300026142 Bacteria 564
386 Ga0207428_10002303 3300027907 Bacteria 19128
387 Ga0268266_10004222 3300028379 Bacteria 13835
388 Ga0268266_10736174 3300028379 Bacteria 951
389 Ga0268265_10075967 3300028380 Bacteria 2634
390 Ga0268265_10082250 3300028380 Bacteria 2546
391 Ga0268264_10000703 3300028381 Bacteria 38584
392 Ga0268264_10011308 3300028381 Bacteria 7373
393 Ga0268264_11365427 3300028381 Bacteria 719
394 Ga0307515_10094590 3300028794 Bacteria 3689
395 Ga0307515_10118307 3300028794 Bacteria 3025
396 Ga0307515_10170104 3300028794 Bacteria 2177
397 Ga0265762_1097367 3300030760 Bacteria 648
398 Ga0265327_10303004 3300031251 Bacteria 703
399 Ga0307513_10041702 3300031456 Bacteria 5062
400 Ga0307513_10089531 3300031456 Bacteria 3141
401 Ga0307408_101047141 3300031548 Bacteria 754
402 Ga0307514_10036163 3300031649 Bacteria 3926
403 Ga0307514_10069000 3300031649 Bacteria 2662
404 Ga0307413_10155837 3300031824 Bacteria 1598
405 Ga0307410_10021241 3300031852 Bacteria 3989
406 Ga0307406_10109093 3300031901 Bacteria 1902
407 Ga0307407_10344411 3300031903 Bacteria 1053
408 Ga0307412_11475109 3300031911 Bacteria 618
409 Ga0307409_100118755 3300031995 Bacteria 2234
410 Ga0307416_100049273 3300032002 Bacteria 3348
411 Ga0307414_10321042 3300032004 Bacteria 1318
412 Ga0307411_10316739 3300032005 Bacteria 1258
413 Ga0307415_100032385 3300032126 Bacteria 3379
414 Ga0373938_0080148 3300034957 Bacteria 794
415 Ga0373952_0089674 3300035092 Bacteria 797
416 Ga0373937_0672983 3300036401 Bacteria 981
417 Ga0436364_1074918 3300037853 Bacteria 4027
418 Ga0395901_1081576 3300038443 Bacteria 773
419 Ga0395901_1423218 3300038443 Bacteria 651
420 Ga0451793_0034132 3300041452 Bacteria 657
421 Ga0451793_1105032 3300041452 Bacteria 893
422 Ga0451797_1340853 3300041453 Bacteria 581
423 Ga0451795_0937696 3300041456 Bacteria 595
424 Ga0451795_1714623 3300041456 Bacteria 776
425 Ga0451804_0569249 3300041463 Bacteria 623
426 Ga0451835_0382443 3300041492 Bacteria 828
427 Ga0451843_0261434 3300041509 Bacteria 1164
428 Ga0451843_1437509 3300041509 Bacteria 776
429 Ga0451853_0422966 3300041512 Bacteria 789
430 Ga0451853_3059178 3300041512 Bacteria 720
431 Ga0466969_0402479 3300044656 Bacteria 621
432 Ga0466966_0207075 3300044684 Bacteria 1186
433 Ga0466961_0464898 3300044693 Bacteria 765
434 Ga0466961_0845384 3300044693 Bacteria 546
435 Ga0466963_0058366 3300044694 Bacteria 2573
436 Ga0466964_0013907 3300044706 Bacteria 3057
437 Ga0466964_0620361 3300044706 Bacteria 595
438 Ga0466970_0334876 3300044765 Bacteria 857
439 Ga0466957_0002668 3300044842 Bacteria 9634
440 Ga0466957_0632559 3300044842 Bacteria 751
441 Ga0466959_0468047 3300045049 Bacteria 854
442 Ga0466959_0910999 3300045049 Bacteria 586
443 Ga0466958_0027433 3300045836 Bacteria 3370
444 Ga0466967_0293223 3300045976 Bacteria 1563
445 Ga0466967_0790221 3300045976 Bacteria 942
446 Ga0495603_0227492 3300046455 Bacteria 1076
447 Ga0495641_0063636 3300046461 Bacteria 1662
448 Ga0495653_0595891 3300046463 Bacteria 680
449 Ga0495596_0214882 3300046500 Bacteria 747
450 Ga0495596_0388413 3300046500 Bacteria 544
451 Ga0495608_0531700 3300046511 Bacteria 710
452 Ga0495652_0230451 3300046529 Bacteria 1386
453 Ga0495587_0384389 3300046536 Bacteria 781
454 Ga0495635_0262835 3300046663 Bacteria 1162
455 Ga0495588_0337858 3300046674 Bacteria 792
456 Ga0495657_0269700 3300046675 Bacteria 1021
457 Ga0495599_0452363 3300046678 Bacteria 760
458 Ga0495599_0720728 3300046678 Bacteria 574
459 Ga0495623_0312962 3300046679 Bacteria 864
460 Ga0495669_0013897 3300046684 Bacteria 3436
461 Ga0495581_0207730 3300047315 Bacteria 1145
462 Ga0495674_0159348 3300047319 Bacteria 1889
463 Ga0495680_0200654 3300047322 Bacteria 1431
464 Ga0495680_0248942 3300047322 Bacteria 1260
465 Ga0495680_0511357 3300047322 Bacteria 814
466 Ga0495602_0099009 3300048088 Bacteria 2398
467 Ga0496100_0018557 3300048903 Bacteria 4128
468 Ga0496100_0251542 3300048903 Bacteria 1307
469 Ga0496100_0549079 3300048903 Bacteria 894
470 Ga0496100_0844164 3300048903 Bacteria 718
471 Ga0496101_0012368 3300048904 Bacteria 5694
472 Ga0496101_0117204 3300048904 Bacteria 2010
473 Ga0496101_0169204 3300048904 Bacteria 1679
474 Ga0496101_0435788 3300048904 Bacteria 1034
475 Ga0496102_0004800 3300048905 Bacteria 11427
476 Ga0496102_0029235 3300048905 Bacteria 4930
477 Ga0496102_0143779 3300048905 Bacteria 2237
478 Ga0496102_0696357 3300048905 Bacteria 939
479 Ga0496102_0772359 3300048905 Bacteria 883
480 Ga0496103_0101985 3300048906 Bacteria 1817
481 Ga0496104_0004980 3300048907 Bacteria 11598
482 Ga0496104_0007104 3300048907 Bacteria 9871
483 Ga0496104_0014964 3300048907 Bacteria 7017
484 Ga0496104_1140043 3300048907 Bacteria 683
485 Ga0496105_0030438 3300048908 Bacteria 4422
486 Ga0496105_0081524 3300048908 Bacteria 2672
487 Ga0496105_0128418 3300048908 Bacteria 2090
488 Ga0496105_0450192 3300048908 Bacteria 1016
489 Ga0496105_0898667 3300048908 Bacteria 668
490 Ga0496105_1172099 3300048908 Bacteria 567
491 Ga0496106_0047896 3300048909 Bacteria 3218
492 Ga0496106_0225240 3300048909 Bacteria 1496
493 Ga0496106_0229917 3300048909 Bacteria 1480
494 Ga0496107_0005184 3300048910 Bacteria 8902
495 Ga0496107_0029110 3300048910 Bacteria 3927
496 Ga0496107_0053184 3300048910 Bacteria 2921
497 Ga0496108_0059468 3300048911 Bacteria 3213
498 Ga0496108_0153641 3300048911 Bacteria 1987
499 Ga0496108_0165804 3300048911 Bacteria 1910
500 Ga0496108_0175437 3300048911 Bacteria 1855
501 Ga0496108_0507250 3300048911 Bacteria 1053
502 Ga0496108_0601034 3300048911 Bacteria 958
503 Ga0496108_0730788 3300048911 Bacteria 857
504 Ga0496109_0017248 3300048912 Bacteria 6327
505 Ga0496109_0036530 3300048912 Bacteria 4435
506 Ga0496109_0040901 3300048912 Bacteria 4199
507 Ga0496109_0051433 3300048912 Bacteria 3752
508 Ga0496109_0087475 3300048912 Bacteria 2878
509 Ga0496109_0101893 3300048912 Bacteria 2665
510 Ga0496109_0355209 3300048912 Bacteria 1385
511 Ga0496109_0360049 3300048912 Bacteria 1374
512 Ga0496109_0436470 3300048912 Bacteria 1237
513 Ga0496110_0006613 3300048913 Bacteria 9208
514 Ga0496110_0154845 3300048913 Bacteria 2076
515 Ga0496110_0154895 3300048913 Bacteria 2076
516 Ga0496110_0291290 3300048913 Bacteria 1487
517 Ga0496110_0574692 3300048913 Bacteria 1023
518 Ga0496110_1457385 3300048913 Bacteria 594
519 Ga0496111_0007047 3300048914 Bacteria 7343
520 Ga0496111_0300610 3300048914 Bacteria 1190
521 Ga0496111_0587910 3300048914 Bacteria 816
522 Ga0496111_0588022 3300048914 Bacteria 815
523 Ga0496111_0895557 3300048914 Bacteria 639
524 Ga0496112_0060586 3300048915 Bacteria 3730
525 Ga0496112_0130919 3300048915 Bacteria 2479
526 Ga0496112_1098480 3300048915 Bacteria 714
527 Ga0496113_0110551 3300048916 Bacteria 2138
528 Ga0496113_0272086 3300048916 Bacteria 1354
529 Ga0496113_1313151 3300048916 Bacteria 562
530 Ga0496114_0007911 3300048917 Bacteria 8413
531 Ga0496114_0009909 3300048917 Bacteria 7572
532 Ga0496114_0021814 3300048917 Bacteria 5211
533 Ga0496114_0025287 3300048917 Bacteria 4852
534 Ga0496114_0031721 3300048917 Bacteria 4347
535 Ga0496114_0037867 3300048917 Bacteria 3990
536 Ga0496114_0044287 3300048917 Bacteria 3691
537 Ga0496114_0292778 3300048917 Bacteria 1436
538 Ga0496114_0864475 3300048917 Bacteria 785
539 Ga0496114_1452838 3300048917 Bacteria 573
540 Ga0496115_0001227 3300048918 Bacteria 18411
541 Ga0496115_0193750 3300048918 Bacteria 1679
542 Ga0496115_0259038 3300048918 Bacteria 1431
543 Ga0496124_0220211 3300048927 Bacteria 1428
544 Ga0501034_0001276 3300049571 Bacteria 34102
545 Ga0501067_0066160 3300049583 Bacteria 2001
546 Ga0501068_0985411 3300049584 Bacteria 556
547 nmdc:mga00v17_123813_c1 3300050491 Bacteria 1648
548 nmdc:mga00v17_160253_c1 3300050491 Bacteria 1448
549 nmdc:mga00v17_289906_c1 3300050491 Bacteria 1063
550 nmdc:mga00v17_814979_c1 3300050491 Bacteria 594
551 nmdc:mga0yw44_1088948_c1 3300050492 Bacteria 540
552 nmdc:mga0yw44_118154_c1 3300050492 Bacteria 1705
553 nmdc:mga0yw44_207510_c1 3300050492 Bacteria 1295
554 nmdc:mga0yw44_24073_c1 3300050492 Bacteria 3440
555 nmdc:mga0yw44_353025_c1 3300050492 Bacteria 990
556 nmdc:mga0yw44_52070_c1 3300050492 Bacteria 2481
557 nmdc:mga0yw44_56108_c1 3300050492 Bacteria 2398
558 nmdc:mga05p37_300873_c1 3300050507 Bacteria 1906
559 nmdc:mga05p37_340716_c1 3300050507 Bacteria 1768
560 nmdc:mga06r32_1142384_c1 3300050510 Bacteria 727
561 nmdc:mga06r32_159578_c1 3300050510 Bacteria 2237
562 nmdc:mga06r32_229549_c1 3300050510 Bacteria 1844
563 nmdc:mga06r32_951937_c1 3300050510 Bacteria 813
564 nmdc:mga0n895_103438_c1 3300050512 Bacteria 2860
565 nmdc:mga0rr50_3022_c1 3300050513 Bacteria 9618
566 nmdc:mga08x19_1381_c1 3300050514 Bacteria 15021
567 nmdc:mga08x19_139274_c1 3300050514 Bacteria 1638
568 nmdc:mga0a205_2762_c1 3300050515 Bacteria 15503
569 Ga0495601_0503957 3300053077 Bacteria 781
570 Ga0500635_0005960 3300053080 Bacteria 3232
571 Ga0495655_0345398 3300053083 Bacteria 520
572 Ga0495595_0048923 3300053084 Bacteria 1954
573 Ga0495619_0153066 3300053085 Bacteria 1591
574 Ga0500646_0005469 3300053090 Bacteria 3211
575 Ga0466962_0010296 3300061719 Bacteria 4491
576 Ga0157375_12502529
577 Ga0070658_10032520
578 Ga0070683_100323878
579 Ga0070683_100349073
580 Ga0070683_101231713
581 Ga0070683_101800910
582 Ga0070670_100251650
583 Ga0068869_100036929
584 Ga0070680_100015121
585 Ga0070680_100699229
586 Ga0070682_100003716
587 Ga0070682_101588501
588 Ga0068868_100318959
589 Ga0068868_100370320
590 Ga0068868_100642247
591 Ga0070660_100163165
592 Ga0070660_101066290
593 Ga0070687_100380937
594 Ga0070687_101304638
595 Ga0070661_100135735
596 Ga0070692_10307094
597 Ga0070692_10615419
598 Ga0070668_100159052
599 Ga0070669_100214238
600 Ga0070669_101205559
601 Ga0070675_100004857
602 Ga0070675_102144943
603 Ga0070671_100003295
604 Ga0070671_100340655
605 Ga0070671_101769050
606 Ga0070674_100875127
607 Ga0070674_101147294
608 Ga0070673_100422285
609 Ga0070673_101638790
610 Ga0070688_100699257
611 Ga0070659_100486621
612 Ga0070659_100791729
613 Ga0070659_100836458
614 Ga0070667_100072850
615 Ga0070667_101767680
616 Ga0070709_10034595
617 Ga0070714_100042725
618 Ga0070714_100049492
619 Ga0070713_100022114
620 Ga0070713_100026977
621 Ga0070710_11026900
622 Ga0070701_10015317
623 Ga0070711_100366192
624 Ga0070711_101022831
625 Ga0070705_101584762
626 Ga0070700_100425056
627 Ga0070700_100434934
628 Ga0070694_101062764
629 Ga0070708_100114832
630 Ga0070708_100217741
631 Ga0070708_102073270
632 Ga0070663_100002605
633 Ga0070663_100550114
634 Ga0070678_100001309
635 Ga0070678_101967105
636 Ga0070662_100202007
637 Ga0070662_100891393
638 Ga0070681_10111387
639 Ga0070681_10413167
640 Ga0070681_10886424
641 Ga0068867_100978776
642 Ga0070706_100000298
643 Ga0070706_100002210
644 Ga0070706_100010818
645 Ga0070706_100020502
646 Ga0070706_100677583
647 Ga0070707_100027458
648 Ga0070707_100038788
649 Ga0070707_100095423
650 Ga0070707_100104118
651 Ga0070707_100190542
652 Ga0070698_100018862
653 Ga0070698_100024547
654 Ga0070698_101191164
655 Ga0070699_100314252
656 Ga0070699_100367141
657 Ga0070699_100645891
658 Ga0070679_100250759
659 Ga0070684_100818531
660 Ga0070684_101736503
661 Ga0070697_100344082
662 Ga0068853_100070765
663 Ga0068853_100329287
664 Ga0070672_100012961
665 Ga0070672_100196614
666 Ga0070672_100569490
667 Ga0070672_102038055
668 Ga0070693_100000859
669 Ga0070693_100809859
670 Ga0070665_100000310
671 Ga0070665_100047969
672 Ga0068855_100185018
673 Ga0068857_100191714
674 Ga0068854_100281586
675 Ga0068854_100282298
676 Ga0068856_100013323
677 Ga0070702_100004035
678 Ga0068852_100002965
679 Ga0068852_100197353
680 Ga0068852_100208937
681 Ga0068852_100815088
682 Ga0068852_101428773
683 Ga0068852_101460532
684 Ga0068859_100123921
685 Ga0068859_100980510
686 Ga0068859_101747561
687 Ga0068864_100009916
688 Ga0068864_101461945
689 Ga0068866_11157260
690 Ga0068851_10017114
691 Ga0068870_10000140
692 Ga0068870_10441484
693 Ga0068863_100006628
694 Ga0068863_100299476
695 Ga0068858_100153652
696 Ga0068860_100001155
697 Ga0068860_100091611
698 Ga0068860_101105072
699 Ga0068860_101453085
700 Ga0068862_100073790
701 Ga0068862_100842272
702 Ga0070717_10462720
703 Ga0070717_10763287
704 Ga0075365_10003743
705 Ga0075365_10137940
706 Ga0075365_10329928
707 Ga0075365_10490679
708 Ga0075365_10890513
709 Ga0075364_10011296
710 Ga0075432_10032764
711 Ga0070716_100132891
712 Ga0070712_100019133
713 Ga0070712_100679544
714 Ga0097621_100751074
715 Ga0068871_101335073
716 Ga0075428_100000760
717 Ga0075428_100371859
718 Ga0075430_100280469
719 Ga0075431_100849340
720 Ga0075431_101301456
721 Ga0075433_10003677
722 Ga0075434_100032404
723 Ga0068865_101667486
724 Ga0068865_101830320
725 Ga0068865_101832163
726 Ga0075436_100002600
727 Ga0075436_100024214
728 Ga0097620_100123919
729 Ga0097620_100980576
730 Ga0097620_101748207
731 Ga0099826_10286290
732 Ga0075435_100025322
733 Ga0105240_10136515
734 Ga0111539_10017139
735 Ga0105245_10021987
736 Ga0105245_10051710
737 Ga0105245_10065679
738 Ga0105245_10195349
739 Ga0105247_10034676
740 Ga0114129_10039923
741 Ga0114129_10146444
742 Ga0105243_10343876
743 Ga0105243_10361658
744 Ga0105243_10398813
745 Ga0105243_11173836
746 Ga0105243_11353367
747 Ga0105243_12061697
748 Ga0105241_10003380
749 Ga0105241_10454158
750 Ga0105242_10369187
751 Ga0105242_10885320
752 Ga0105242_12806840
753 Ga0105242_13288375
754 Ga0105248_10007742
755 Ga0105248_11396810
756 Ga0105248_11692689
757 Ga0105237_10038516
758 Ga0105237_10334557
759 Ga0105238_10116362
760 Ga0105238_10451552
761 Ga0105238_10495126
762 Ga0105238_10681532
763 Ga0105249_10855794
764 Ga0105249_11411593
765 Ga0105239_10034943
766 Ga0105239_10145840
767 Ga0105239_11075283
768 Ga0105239_11333918
769 Ga0105239_11529078
770 Ga0105239_13539202
771 Ga0105246_10002181
772 Ga0157329_1037437
773 Ga0157323_1006860
774 Ga0157339_1056516
775 Ga0157373_10254487
776 Ga0157371_10029759
777 Ga0157371_10725537
778 Ga0157370_10013697
779 Ga0157370_10390430
780 Ga0157370_10541962
781 Ga0157370_11304701
782 Ga0157370_11911624
783 Ga0157369_10025627
784 Ga0157369_10566788
785 Ga0157369_10855131
786 Ga0157369_11529765
787 Ga0157374_10016287
788 Ga0157374_11239025
789 Ga0157374_12015668
790 Ga0157378_10069791
791 Ga0157378_10181938
792 Ga0157378_11879450
793 Ga0163162_10336454
794 Ga0163162_10652604
795 Ga0163162_10856232
796 Ga0163162_11171264
797 Ga0163162_11796643
798 Ga0163162_12446785
799 Ga0157372_10030708
800 Ga0157372_10470626
801 Ga0157372_10607933
802 Ga0157372_10636540
803 Ga0157372_10700242
804 Ga0157375_10036014
805 Ga0157375_10124659
806 Ga0157375_10367741
807 Ga0157375_10636454
808 Ga0157375_11233123
809 Ga0157375_11268381
810 Ga0163163_10081499
811 Ga0163163_10349443
812 Ga0163163_10371606
813 Ga0163163_10417498
814 Ga0163163_10452938
815 Ga0163163_10576518
816 Ga0157380_10452577
817 Ga0157380_11481827
818 Ga0157380_11497531
819 Ga0157380_12561948
820 Ga0157380_12897092
821 Ga0157377_10001415
822 Ga0157377_10144194
823 Ga0157377_10690876
824 Ga0157377_11255344
825 Ga0157379_10159779
826 Ga0157379_11380306
827 Ga0157379_12234626
828 Ga0157376_10615097
829 Ga0157376_10887969
830 Ga0157376_11762735
831 Ga0163161_10099587
832 Ga0163161_11174638
833 Ga0163161_11420337
834 Ga0206354_10863958
835 Ga0206354_11133445
836 Ga0206353_10483896
837 Ga0206353_11599500
838 Ga0224712_10554813
839 Ga0224572_1006896
840 Ga0207656_10014061
841 Ga0207713_1114658
842 Ga0207692_10390253
843 Ga0207692_10806703
844 Ga0207642_10314560
845 Ga0207710_10028187
846 Ga0207688_10000944
847 Ga0207688_10074838
848 Ga0207699_10045206
849 Ga0207645_10226875
850 Ga0207643_10000139
851 Ga0207705_10020411
852 Ga0207684_10000539
853 Ga0207684_10000643
854 Ga0207684_10029763
855 Ga0207684_10050611
856 Ga0207684_11038139
857 Ga0207654_10003320
858 Ga0207707_10233343
859 Ga0207707_10326144
860 Ga0207707_10807004
861 Ga0207695_10124753
862 Ga0207671_10029265
863 Ga0207671_10034166
864 Ga0207693_10047650
865 Ga0207693_10824385
866 Ga0207663_10006311
867 Ga0207663_10112202
868 Ga0207663_10649874
869 Ga0207660_10058141
870 Ga0207660_10378905
871 Ga0207662_10994288
872 Ga0207662_11264311
873 Ga0207657_10061827
874 Ga0207657_10603140
875 Ga0207649_10003882
876 Ga0207652_10005015
877 Ga0207646_10017356
878 Ga0207646_10024480
879 Ga0207646_10067681
880 Ga0207681_10224853
881 Ga0207681_10815524
882 Ga0207694_10199109
883 Ga0207694_10286072
884 Ga0207650_10002194
885 Ga0207650_10847024
886 Ga0207659_10005917
887 Ga0207687_10019448
888 Ga0207687_10067381
889 Ga0207687_10134855
890 Ga0207687_10882900
891 Ga0207700_10016928
892 Ga0207700_10029023
893 Ga0207664_10048484
894 Ga0207664_10567638
895 Ga0207644_10020527
896 Ga0207644_10607917
897 Ga0207644_11624691
898 Ga0207690_10476945
899 Ga0207706_10306703
900 Ga0207706_10718387
901 Ga0207686_10201778
902 Ga0207686_10624627
903 Ga0207709_10327115
904 Ga0207709_10469577
905 Ga0207709_10484094
906 Ga0207670_10841851
907 Ga0207669_10849783
908 Ga0207704_10514220
909 Ga0207704_10736874
910 Ga0207665_10097196
911 Ga0207691_10314576
912 Ga0207691_10767031
913 Ga0207691_11265012
914 Ga0207711_10598032
915 Ga0207689_10003859
916 Ga0207661_10002645
917 Ga0207661_10210445
918 Ga0207661_10302918
919 Ga0207661_10970481
920 Ga0207661_11175701
921 Ga0207661_12025650
922 Ga0207679_10001767
923 Ga0207667_10293268
924 Ga0207651_11931795
925 Ga0207668_10551705
926 Ga0207668_10915184
927 Ga0207668_11675191
928 Ga0207640_10023190
929 Ga0207640_12106596
930 Ga0207658_10166484
931 Ga0207658_10514423
932 Ga0207677_10143134
933 Ga0207677_10195236
934 Ga0207677_10849835
935 Ga0207677_11053327
936 Ga0207639_10571432
937 Ga0207639_10613890
938 Ga0207639_11368542
939 Ga0207678_10000358
940 Ga0207678_10885946
941 Ga0207678_11422333
942 Ga0207708_10189132
943 Ga0207708_10316952
944 Ga0207702_10001590
945 Ga0207702_10008632
946 Ga0207702_10513260
947 Ga0207641_10007769
948 Ga0207641_10949394
949 Ga0207641_11933330
950 Ga0207676_10007530
951 Ga0207676_10172502
952 Ga0207676_10547958
953 Ga0207674_10011708
954 Ga0207675_100947182
955 Ga0207683_10002974
956 Ga0207698_10002013
957 Ga0207698_10053468
958 Ga0207698_10420223
959 Ga0207698_11238907
960 Ga0207698_12200821
961 Ga0207428_10002303
962 Ga0268266_10004222
963 Ga0268266_10736174
964 Ga0268265_10075967
965 Ga0268265_10082250
966 Ga0268264_10000703
967 Ga0268264_10011308
968 Ga0268264_11365427
969 Ga0307515_10094590
970 Ga0307515_10118307
971 Ga0307515_10170104
972 Ga0265762_1097367
973 Ga0265327_10303004
974 Ga0307513_10041702
975 Ga0307513_10089531
976 Ga0307408_101047141
977 Ga0307514_10036163
978 Ga0307514_10069000
979 Ga0307413_10155837
980 Ga0307410_10021241
981 Ga0307406_10109093
982 Ga0307407_10344411
983 Ga0307412_11475109
984 Ga0307409_100118755
985 Ga0307416_100049273
986 Ga0307414_10321042
987 Ga0307411_10316739
988 Ga0307415_100032385
989 Ga0373938_0080148
990 Ga0373952_0089674
991 Ga0373937_0672983
992 Ga0436364_1074918
993 Ga0395901_1081576
994 Ga0395901_1423218
995 Ga0451793_0034132
996 Ga0451793_1105032
997 Ga0451797_1340853
998 Ga0451795_0937696
999 Ga0451795_1714623
1000 Ga0451804_0569249
1001 Ga0451835_0382443
1002 Ga0451843_0261434
1003 Ga0451843_1437509
1004 Ga0451853_0422966
1005 Ga0451853_3059178
1006 Ga0466969_0402479
1007 Ga0466966_0207075
1008 Ga0466961_0464898
1009 Ga0466961_0845384
1010 Ga0466963_0058366
1011 Ga0466964_0013907
1012 Ga0466964_0620361
1013 Ga0466970_0334876
1014 Ga0466957_0002668
1015 Ga0466957_0632559
1016 Ga0466959_0468047
1017 Ga0466959_0910999
1018 Ga0466958_0027433
1019 Ga0466967_0293223
1020 Ga0466967_0790221
1021 Ga0495603_0227492
1022 Ga0495641_0063636
1023 Ga0495653_0595891
1024 Ga0495596_0214882
1025 Ga0495596_0388413
1026 Ga0495608_0531700
1027 Ga0495652_0230451
1028 Ga0495587_0384389
1029 Ga0495635_0262835
1030 Ga0495588_0337858
1031 Ga0495657_0269700
1032 Ga0495599_0452363
1033 Ga0495599_0720728
1034 Ga0495623_0312962
1035 Ga0495669_0013897
1036 Ga0495581_0207730
1037 Ga0495674_0159348
1038 Ga0495680_0200654
1039 Ga0495680_0248942
1040 Ga0495680_0511357
1041 Ga0495602_0099009
1042 Ga0496100_0018557
1043 Ga0496100_0251542
1044 Ga0496100_0549079
1045 Ga0496100_0844164
1046 Ga0496101_0012368
1047 Ga0496101_0117204
1048 Ga0496101_0169204
1049 Ga0496101_0435788
1050 Ga0496102_0004800
1051 Ga0496102_0029235
1052 Ga0496102_0143779
1053 Ga0496102_0696357
1054 Ga0496102_0772359
1055 Ga0496103_0101985
1056 Ga0496104_0004980
1057 Ga0496104_0007104
1058 Ga0496104_0014964
1059 Ga0496104_1140043
1060 Ga0496105_0030438
1061 Ga0496105_0081524
1062 Ga0496105_0128418
1063 Ga0496105_0450192
1064 Ga0496105_0898667
1065 Ga0496105_1172099
1066 Ga0496106_0047896
1067 Ga0496106_0225240
1068 Ga0496106_0229917
1069 Ga0496107_0005184
1070 Ga0496107_0029110
1071 Ga0496107_0053184
1072 Ga0496108_0059468
1073 Ga0496108_0153641
1074 Ga0496108_0165804
1075 Ga0496108_0175437
1076 Ga0496108_0507250
1077 Ga0496108_0601034
1078 Ga0496108_0730788
1079 Ga0496109_0017248
1080 Ga0496109_0036530
1081 Ga0496109_0040901
1082 Ga0496109_0051433
1083 Ga0496109_0087475
1084 Ga0496109_0101893
1085 Ga0496109_0355209
1086 Ga0496109_0360049
1087 Ga0496109_0436470
1088 Ga0496110_0006613
1089 Ga0496110_0154845
1090 Ga0496110_0154895
1091 Ga0496110_0291290
1092 Ga0496110_0574692
1093 Ga0496110_1457385
1094 Ga0496111_0007047
1095 Ga0496111_0300610
1096 Ga0496111_0587910
1097 Ga0496111_0588022
1098 Ga0496111_0895557
1099 Ga0496112_0060586
1100 Ga0496112_0130919
1101 Ga0496112_1098480
1102 Ga0496113_0110551
1103 Ga0496113_0272086
1104 Ga0496113_1313151
1105 Ga0496114_0007911
1106 Ga0496114_0009909
1107 Ga0496114_0021814
1108 Ga0496114_0025287
1109 Ga0496114_0031721
1110 Ga0496114_0037867
1111 Ga0496114_0044287
1112 Ga0496114_0292778
1113 Ga0496114_0864475
1114 Ga0496114_1452838
1115 Ga0496115_0001227
1116 Ga0496115_0193750
1117 Ga0496115_0259038
1118 Ga0496124_0220211
1119 Ga0501034_0001276
1120 Ga0501067_0066160
1121 Ga0501068_0985411
1122 nmdc:mga00v17_123813_c1
1123 nmdc:mga00v17_160253_c1
1124 nmdc:mga00v17_289906_c1
1125 nmdc:mga00v17_814979_c1
1126 nmdc:mga0yw44_1088948_c1
1127 nmdc:mga0yw44_118154_c1
1128 nmdc:mga0yw44_207510_c1
1129 nmdc:mga0yw44_24073_c1
1130 nmdc:mga0yw44_353025_c1
1131 nmdc:mga0yw44_52070_c1
1132 nmdc:mga0yw44_56108_c1
1133 nmdc:mga05p37_300873_c1
1134 nmdc:mga05p37_340716_c1
1135 nmdc:mga06r32_1142384_c1
1136 nmdc:mga06r32_159578_c1
1137 nmdc:mga06r32_229549_c1
1138 nmdc:mga06r32_951937_c1
1139 nmdc:mga0n895_103438_c1
1140 nmdc:mga0rr50_3022_c1
1141 nmdc:mga08x19_1381_c1
1142 nmdc:mga08x19_139274_c1
1143 nmdc:mga0a205_2762_c1
1144 Ga0495601_0503957
1145 Ga0500635_0005960
1146 Ga0495655_0345398
1147 Ga0495595_0048923
1148 Ga0495619_0153066
1149 Ga0500646_0005469
1150 Ga0466962_0010296

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

18

81

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u0y-assembly1.cif.gz_A crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna 0.9367 4 78
4u0y-assembly1.cif.gz_A crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna 0.9249 4 78
2wv0-assembly5.cif.gz_I crystal structure of the gntr-hutc family member yvoa from bacillus subtilis 0.9218 4 78
4wwc-assembly1.cif.gz_B crystal structure of full length yvoa in complex with palindromic operator dna 0.9207 3 79
4h0e-assembly1.cif.gz_A crystal structure of mutant orr3 in complex with ntd of arar 0.9161 9 78
ID Description Score Start End Superfamily
2wv0D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9523 12 79 1.10.10.10
2wv0I01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9376 12 79 1.10.10.10
af_P0ACM5_16_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9348 6 78 1.10.10.10
af_Q2G0T8_1_76_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9298 15 81 1.10.10.10
4u0vA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9278 3 79 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1C5CIU2-F1-model_v4 GntR family transcriptional regulator 0.9936 1 81 GO:0003677
GO:0003700
AF-A0A7K3S837-F1-model_v4 GntR family transcriptional regulator 0.9915 2 81 GO:0003677
GO:0003700
AF-A0A399D0V7-F1-model_v4 GntR family transcriptional regulator 0.9853 4 80 GO:0003677
GO:0003700
GO:0005737
AF-A0A1C5CIU2-F1-model_v4 GntR family transcriptional regulator 0.9815 1 81 GO:0003677
GO:0003700
AF-A0A7Y3EMW7-F1-model_v4 GntR family transcriptional regulator 0.9767 1 78 GO:0003677
GO:0003700

Map