F465388

General Info

Members Datasets Scaffolds Average Seq Length
575 316 574 176

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10067871|Ga0075365_100678713
Length 206
Sequence MGPRLRGDDSPEATDSKRHSAMSTDSKQLAPAPSGRVASLLWGPLTPFALAIALAAAALDQASKLYLLYVFDLGARGIVPLAPFVDLVLTWNTGISYGLFRQEGALWQWALLALKAIAVILLWIWLSRTVSRLTAASLGLIIGGALGNGIDRFVHGAVADFVLLHLTTASFSFRWYVFNLADVAIVAGVIGLLYETLFDRGAAKAP

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
172 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
194 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
217 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
282 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
289 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
290 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
294 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
295 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
308 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
309 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
310 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
311 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
312 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
313 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
314 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
315 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
316 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.17
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.52
Nodule 0
Rhizoplane 14.09
Rhizosphere 80.7
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1019655 3300001976 Bacteria 881
2 JGI24750J21931_1001978 3300002070 Bacteria 2503
3 JGI24744J21845_10034474 3300002077 Bacteria 960
4 JGI24742J22300_10003043 3300002244 Bacteria 2716
5 JGI25405J52794_10011756 3300003911 Unclassified 1678
6 Ga0070676_10108049 3300005328 Bacteria 1728
7 Ga0070683_100030265 3300005329 Bacteria 4911
8 Ga0070690_100046379 3300005330 Bacteria 2762
9 Ga0070670_100120832 3300005331 Bacteria 2260
10 Ga0070682_100475469 3300005337 Bacteria 962
11 Ga0068868_100061110 3300005338 Bacteria 2984
12 Ga0070689_100031016 3300005340 Bacteria 4061
13 Ga0070689_100114138 3300005340 Bacteria 2152
14 Ga0070691_10008865 3300005341 Bacteria 4605
15 Ga0070661_100120477 3300005344 Bacteria 1965
16 Ga0070661_100408336 3300005344 Bacteria 1075
17 Ga0070692_10087939 3300005345 Bacteria 1684
18 Ga0070668_100076385 3300005347 Bacteria 2616
19 Ga0070669_100045369 3300005353 Bacteria 3203
20 Ga0070675_100094996 3300005354 Bacteria 2502
21 Ga0070675_100375806 3300005354 Bacteria 1264
22 Ga0070671_100008828 3300005355 Bacteria 8089
23 Ga0070671_100023958 3300005355 Bacteria 4994
24 Ga0070671_100272998 3300005355 Bacteria 1437
25 Ga0070674_100058076 3300005356 Bacteria 2688
26 Ga0070674_100978712 3300005356 Bacteria 741
27 Ga0070673_100001201 3300005364 Bacteria 14931
28 Ga0070673_100136315 3300005364 Bacteria 2066
29 Ga0070673_100159417 3300005364 Bacteria 1918
30 Ga0070688_100042693 3300005365 Bacteria 2790
31 Ga0070688_100168370 3300005365 Bacteria 1510
32 Ga0070688_100877494 3300005365 Bacteria 706
33 Ga0070659_100676763 3300005366 Bacteria 891
34 Ga0070667_100348764 3300005367 Bacteria 1340
35 Ga0070667_100792091 3300005367 Bacteria 880
36 Ga0070709_10060095 3300005434 Bacteria 2415
37 Ga0070714_100050724 3300005435 Bacteria 3536
38 Ga0070714_100219268 3300005435 Bacteria 1748
39 Ga0070714_100313601 3300005435 Bacteria 1465
40 Ga0070713_100031727 3300005436 Bacteria 4211
41 Ga0070713_100364117 3300005436 Bacteria 1344
42 Ga0070713_100435279 3300005436 Unclassified 1229
43 Ga0070701_10044646 3300005438 Bacteria 2271
44 Ga0070701_10528622 3300005438 Bacteria 770
45 Ga0070711_100013397 3300005439 Bacteria 5150
46 Ga0070711_100040555 3300005439 Bacteria 3140
47 Ga0070700_100021470 3300005441 Bacteria 3753
48 Ga0070700_100264459 3300005441 Bacteria 1240
49 Ga0070700_100295107 3300005441 Bacteria 1181
50 Ga0070708_101447880 3300005445 Bacteria 640
51 Ga0070678_100162597 3300005456 Bacteria 1810
52 Ga0070662_100130996 3300005457 Bacteria 1933
53 Ga0070681_10563689 3300005458 Bacteria 1053
54 Ga0070681_10917930 3300005458 Bacteria 794
55 Ga0068867_100055798 3300005459 Bacteria 2921
56 Ga0070707_100659487 3300005468 Bacteria 1009
57 Ga0070698_100311306 3300005471 Bacteria 1505
58 Ga0070698_100321261 3300005471 Bacteria 1479
59 Ga0070698_100479724 3300005471 Bacteria 1180
60 Ga0070699_100010912 3300005518 Bacteria 7857
61 Ga0070699_100464878 3300005518 Bacteria 1147
62 Ga0070679_100437527 3300005530 Bacteria 1253
63 Ga0070679_100651291 3300005530 Bacteria 996
64 Ga0070684_100077477 3300005535 Bacteria 2936
65 Ga0068853_100104501 3300005539 Bacteria 2508
66 Ga0070672_100017904 3300005543 Bacteria 5109
67 Ga0070672_100474338 3300005543 Bacteria 1080
68 Ga0070686_100020737 3300005544 Bacteria 3893
69 Ga0070696_100198683 3300005546 Bacteria 1496
70 Ga0070696_100506865 3300005546 Unclassified 961
71 Ga0070665_100022370 3300005548 Bacteria 6363
72 Ga0070665_100118422 3300005548 Bacteria 2650
73 Ga0070704_100048398 3300005549 Bacteria 2976
74 Ga0068855_100260698 3300005563 Bacteria 1931
75 Ga0070664_100066665 3300005564 Bacteria 3074
76 Ga0070664_100158856 3300005564 Bacteria 1999
77 Ga0068854_100359210 3300005578 Bacteria 1195
78 Ga0068854_100641043 3300005578 Bacteria 911
79 Ga0070702_100038949 3300005615 Bacteria 2650
80 Ga0068852_100069202 3300005616 Bacteria 3093
81 Ga0068859_100108026 3300005617 Bacteria 2843
82 Ga0068864_100184046 3300005618 Bacteria 1911
83 Ga0068866_10034411 3300005718 Bacteria 2467
84 Ga0068861_100053204 3300005719 Bacteria 3079
85 Ga0068870_10008986 3300005840 Bacteria 4520
86 Ga0068863_100107060 3300005841 Bacteria 2660
87 Ga0068858_100033133 3300005842 Bacteria 4797
88 Ga0068858_100240948 3300005842 Bacteria 1716
89 Ga0068860_100079778 3300005843 Bacteria 3112
90 Ga0068862_100044328 3300005844 Bacteria 3793
91 Ga0081455_10004266 3300005937 Bacteria 16108
92 Ga0081455_10004590 3300005937 Bacteria 15425
93 Ga0081455_10098018 3300005937 Bacteria 2361
94 Ga0081455_10155489 3300005937 Bacteria 1758
95 Ga0081455_10196255 3300005937 Bacteria 1516
96 Ga0081540_1007964 3300005983 Bacteria 7467
97 Ga0081540_1051353 3300005983 Bacteria 2039
98 Ga0081539_10127693 3300005985 Bacteria 1253
99 Ga0070717_10075127 3300006028 Bacteria 2826
100 Ga0070717_10089423 3300006028 Bacteria 2597
101 Ga0070717_10443878 3300006028 Bacteria 1169
102 Ga0070717_10568292 3300006028 Bacteria 1028
103 Ga0075365_10005277 3300006038 Bacteria 6952
104 Ga0075365_10021240 3300006038 Bacteria 4046
105 Ga0075365_10067871 3300006038 Bacteria 2395
106 Ga0075365_10102285 3300006038 Bacteria 1963
107 Ga0075365_10130672 3300006038 Bacteria 1738
108 Ga0075365_10140488 3300006038 Bacteria 1676
109 Ga0075364_10206526 3300006051 Bacteria 1332
110 Ga0075364_10711855 3300006051 Bacteria 685
111 Ga0075432_10002319 3300006058 Bacteria 6331
112 Ga0070715_10003065 3300006163 Bacteria 5241
113 Ga0070715_10223736 3300006163 Bacteria 969
114 Ga0070716_100229831 3300006173 Bacteria 1251
115 Ga0070712_100136840 3300006175 Bacteria 1864
116 Ga0070712_100216717 3300006175 Bacteria 1513
117 Ga0075362_10013822 3300006177 Bacteria 3241
118 Ga0075367_10166876 3300006178 Bacteria 1370
119 Ga0075367_10247500 3300006178 Bacteria 1118
120 Ga0075427_10004166 3300006194 Bacteria 2019
121 Ga0097621_100090043 3300006237 Bacteria 2566
122 Ga0068871_100174461 3300006358 Bacteria 1845
123 Ga0075428_100005580 3300006844 Bacteria 13980
124 Ga0075428_100079122 3300006844 Bacteria 3588
125 Ga0075428_100208080 3300006844 Bacteria 2114
126 Ga0075428_100293518 3300006844 Bacteria 1748
127 Ga0075428_100365810 3300006844 Bacteria 1547
128 Ga0075428_101073147 3300006844 Bacteria 851
129 Ga0075430_100000128 3300006846 Bacteria 47770
130 Ga0075430_100014469 3300006846 Bacteria 6721
131 Ga0075430_100557919 3300006846 Bacteria 945
132 Ga0075431_100001558 3300006847 Bacteria 21282
133 Ga0075431_100054344 3300006847 Bacteria 4129
134 Ga0075431_100065054 3300006847 Bacteria 3765
135 Ga0075431_100272313 3300006847 Bacteria 1715
136 Ga0075431_100985753 3300006847 Bacteria 810
137 Ga0075433_10000103 3300006852 Bacteria 41320
138 Ga0075433_10941705 3300006852 Bacteria 753
139 Ga0075434_100001533 3300006871 Bacteria 19536
140 Ga0075434_100015883 3300006871 Bacteria 7229
141 Ga0075434_100020416 3300006871 Bacteria 6426
142 Ga0075434_100284869 3300006871 Bacteria 1672
143 Ga0075429_100000381 3300006880 Bacteria 32664
144 Ga0075429_100075491 3300006880 Bacteria 2936
145 Ga0068865_100050171 3300006881 Bacteria 2881
146 Ga0068865_101230371 3300006881 Bacteria 664
147 Ga0075436_100004204 3300006914 Bacteria 9880
148 Ga0075436_100099569 3300006914 Bacteria 2024
149 Ga0075436_100379075 3300006914 Bacteria 1023
150 Ga0075436_100432692 3300006914 Bacteria 956
151 Ga0097620_100108031 3300006931 Bacteria 2843
152 Ga0075435_100015585 3300007076 Bacteria 5718
153 Ga0075435_100048649 3300007076 Bacteria 3407
154 Ga0075435_100212545 3300007076 Bacteria 1641
155 Ga0075435_100593983 3300007076 Bacteria 960
156 Ga0099794_10075565 3300007265 Bacteria 1656
157 Ga0099794_10137556 3300007265 Bacteria 1236
158 Ga0111539_10000787 3300009094 Bacteria 41244
159 Ga0111539_10072403 3300009094 Bacteria 4064
160 Ga0111539_10173997 3300009094 Bacteria 2515
161 Ga0111539_10198645 3300009094 Bacteria 2339
162 Ga0111539_10258403 3300009094 Bacteria 2028
163 Ga0111539_11028824 3300009094 Bacteria 957
164 Ga0111539_11482029 3300009094 Bacteria 787
165 Ga0105245_10081905 3300009098 Bacteria 2951
166 Ga0105245_11144545 3300009098 Bacteria 825
167 Ga0105247_10065550 3300009101 Bacteria 2260
168 Ga0114129_10003834 3300009147 Bacteria 21189
169 Ga0114129_10017332 3300009147 Bacteria 10253
170 Ga0114129_10021956 3300009147 Bacteria 9057
171 Ga0114129_10057918 3300009147 Bacteria 5421
172 Ga0114129_10085787 3300009147 Bacteria 4368
173 Ga0114129_10268007 3300009147 Bacteria 2286
174 Ga0105243_10161067 3300009148 Bacteria 1934
175 Ga0105241_10256604 3300009174 Bacteria 1484
176 Ga0105242_10049535 3300009176 Bacteria 3419
177 Ga0105248_10139518 3300009177 Bacteria 2734
178 Ga0105248_10572491 3300009177 Bacteria 1274
179 Ga0105237_10243985 3300009545 Bacteria 1798
180 Ga0105238_10727408 3300009551 Bacteria 1005
181 Ga0105238_10886466 3300009551 Bacteria 910
182 Ga0105249_10172755 3300009553 Bacteria 2097
183 Ga0099796_10049027 3300010159 Bacteria 1459
184 Ga0105239_10149726 3300010375 Bacteria 2604
185 Ga0105239_10166891 3300010375 Bacteria 2462
186 Ga0105239_12125316 3300010375 Bacteria 652
187 Ga0157374_10344496 3300013296 Bacteria 1480
188 Ga0157374_10396425 3300013296 Bacteria 1376
189 Ga0157378_10187589 3300013297 Bacteria 1948
190 Ga0157378_10339891 3300013297 Bacteria 1463
191 Ga0163162_10162965 3300013306 Bacteria 2352
192 Ga0163162_10765115 3300013306 Bacteria 1084
193 Ga0163162_10938990 3300013306 Bacteria 977
194 Ga0157375_10187602 3300013308 Bacteria 2222
195 Ga0157375_10486483 3300013308 Bacteria 1399
196 Ga0163163_10269307 3300014325 Bacteria 1754
197 Ga0163163_10797003 3300014325 Bacteria 1008
198 Ga0157380_10919791 3300014326 Bacteria 902
199 Ga0157379_10335397 3300014968 Bacteria 1382
200 Ga0157376_10215211 3300014969 Bacteria 1776
201 Ga0157376_10976052 3300014969 Bacteria 869
202 Ga0163161_10175555 3300017792 Bacteria 1640
203 Ga0213876_10339035 3300021384 Bacteria 799
204 Ga0224572_1004051 3300024225 Bacteria 2522
205 Ga0207697_10052539 3300025315 Bacteria 1686
206 Ga0207656_10035880 3300025321 Bacteria 2079
207 Ga0207688_10002481 3300025901 Bacteria 9928
208 Ga0207680_10034222 3300025903 Bacteria 2905
209 Ga0207680_10202603 3300025903 Bacteria 1353
210 Ga0207680_10207022 3300025903 Bacteria 1339
211 Ga0207647_10010563 3300025904 Bacteria 6516
212 Ga0207645_10009079 3300025907 Bacteria 6900
213 Ga0207643_10010475 3300025908 Bacteria 4994
214 Ga0207654_10201254 3300025911 Bacteria 1311
215 Ga0207707_10767285 3300025912 Bacteria 805
216 Ga0207671_10056891 3300025914 Bacteria 2898
217 Ga0207693_10018047 3300025915 Bacteria 5623
218 Ga0207693_10019443 3300025915 Bacteria 5402
219 Ga0207693_10054732 3300025915 Bacteria 3129
220 Ga0207693_10108189 3300025915 Bacteria 2181
221 Ga0207693_10289271 3300025915 Bacteria 1284
222 Ga0207663_10067641 3300025916 Bacteria 2292
223 Ga0207662_10010556 3300025918 Bacteria 5105
224 Ga0207662_10433713 3300025918 Bacteria 896
225 Ga0207657_10035303 3300025919 Bacteria 4485
226 Ga0207649_10071654 3300025920 Bacteria 2214
227 Ga0207649_10422325 3300025920 Bacteria 1001
228 Ga0207652_10142594 3300025921 Bacteria 2143
229 Ga0207650_10004077 3300025925 Bacteria 9987
230 Ga0207650_10005544 3300025925 Bacteria 8614
231 Ga0207659_10300450 3300025926 Bacteria 1318
232 Ga0207659_10392468 3300025926 Bacteria 1159
233 Ga0207687_10200921 3300025927 Bacteria 1558
234 Ga0207687_10269566 3300025927 Bacteria 1360
235 Ga0207700_10309016 3300025928 Bacteria 1367
236 Ga0207700_10335519 3300025928 Unclassified 1313
237 Ga0207700_10366074 3300025928 Bacteria 1258
238 Ga0207664_10175105 3300025929 Bacteria 1839
239 Ga0207664_10210796 3300025929 Bacteria 1681
240 Ga0207644_10007129 3300025931 Bacteria 7285
241 Ga0207644_10137532 3300025931 Bacteria 1877
242 Ga0207690_10222037 3300025932 Bacteria 1446
243 Ga0207690_10224390 3300025932 Bacteria 1439
244 Ga0207706_10014540 3300025933 Bacteria 7132
245 Ga0207686_10125170 3300025934 Bacteria 1755
246 Ga0207709_10301907 3300025935 Bacteria 1191
247 Ga0207670_10450573 3300025936 Bacteria 1037
248 Ga0207670_10530357 3300025936 Bacteria 960
249 Ga0207670_10715807 3300025936 Bacteria 830
250 Ga0207669_10110399 3300025937 Bacteria 1841
251 Ga0207704_10107147 3300025938 Bacteria 1879
252 Ga0207665_10001380 3300025939 Bacteria 16365
253 Ga0207665_11067924 3300025939 Bacteria 643
254 Ga0207691_10003955 3300025940 Bacteria 14394
255 Ga0207691_10264317 3300025940 Bacteria 1483
256 Ga0207711_10227592 3300025941 Bacteria 1707
257 Ga0207689_10027088 3300025942 Bacteria 4798
258 Ga0207661_10163673 3300025944 Bacteria 1932
259 Ga0207679_10111382 3300025945 Bacteria 2161
260 Ga0207651_10002667 3300025960 Bacteria 8537
261 Ga0207651_10101366 3300025960 Bacteria 2137
262 Ga0207712_10071332 3300025961 Bacteria 2498
263 Ga0207668_10055888 3300025972 Bacteria 2746
264 Ga0207668_10595242 3300025972 Bacteria 963
265 Ga0207640_10050588 3300025981 Bacteria 2697
266 Ga0207640_10603050 3300025981 Bacteria 930
267 Ga0207677_10252401 3300026023 Bacteria 1433
268 Ga0207703_11014702 3300026035 Bacteria 796
269 Ga0207703_11147909 3300026035 Bacteria 747
270 Ga0207678_10021417 3300026067 Bacteria 5668
271 Ga0207678_11462784 3300026067 Bacteria 603
272 Ga0207708_10005365 3300026075 Bacteria 9446
273 Ga0207708_10776531 3300026075 Bacteria 824
274 Ga0207648_10011418 3300026089 Bacteria 8367
275 Ga0207676_10135032 3300026095 Bacteria 2103
276 Ga0207675_100008064 3300026118 Bacteria 9923
277 Ga0207683_10064788 3300026121 Bacteria 3221
278 Ga0207698_10283235 3300026142 Bacteria 1534
279 Ga0209588_1010668 3300027671 Bacteria 2765
280 Ga0207428_10000058 3300027907 Bacteria 158579
281 Ga0207428_10333773 3300027907 Bacteria 1118
282 Ga0268266_10209426 3300028379 Bacteria 1787
283 Ga0268266_11356995 3300028379 Bacteria 686
284 Ga0268265_10216840 3300028380 Bacteria 1671
285 Ga0268264_10154036 3300028381 Bacteria 2063
286 Ga0265338_10229544 3300028800 Bacteria 1381
287 Ga0265760_10206260 3300031090 Bacteria 665
288 Ga0265325_10002612 3300031241 Bacteria 12066
289 Ga0265340_10052072 3300031247 Bacteria 1981
290 Ga0265340_10094517 3300031247 Bacteria 1394
291 Ga0265313_10031287 3300031595 Bacteria 2730
292 Ga0307411_10704088 3300032005 Bacteria 880
293 Ga0373926_0032423 3300035083 Bacteria 1843
294 Ga0373929_0181865 3300035085 Bacteria 580
295 Ga0373944_0017853 3300035089 Bacteria 2019
296 Ga0373923_0000898 3300035111 Bacteria 7929
297 Ga0373936_0009843 3300035113 Bacteria 3608
298 Ga0373945_0007874 3300035116 Bacteria 3457
299 Ga0373953_0002133 3300035117 Bacteria 5918
300 Ga0373954_0005093 3300035118 Bacteria 5671
301 Ga0373957_0010197 3300035120 Bacteria 3099
302 Ga0373943_0057479 3300035170 Bacteria 1933
303 Ga0373943_0092116 3300035170 Bacteria 1571
304 Ga0373943_0337628 3300035170 Bacteria 861
305 Ga0373946_0000519 3300035171 Bacteria 12796
306 Ga0373946_0043184 3300035171 Bacteria 1857
307 Ga0373946_0095663 3300035171 Bacteria 1323
308 Ga0373955_0028356 3300035172 Bacteria 2901
309 Ga0373924_0002836 3300035410 Bacteria 5871
310 Ga0373935_0000305 3300035692 Bacteria 24438
311 Ga0373935_0307150 3300035692 Bacteria 1122
312 Ga0373927_0010850 3300035695 Bacteria 6069
313 Ga0373927_0033896 3300035695 Bacteria 3322
314 Ga0373947_0001375 3300035725 Bacteria 14966
315 Ga0373947_0440960 3300035725 Bacteria 881
316 Ga0373937_0000385 3300036401 Bacteria 41073
317 Ga0373925_0000038 3300037068 Bacteria 142088
318 Ga0373925_0130108 3300037068 Bacteria 1962
319 Ga0373925_0516135 3300037068 Bacteria 981
320 Ga0395900_0500238 3300037418 Bacteria 1166
321 Ga0395898_0462021 3300037466 Bacteria 1208
322 Ga0395901_1102196 3300038443 Bacteria 764
323 Ga0436365_0861925 3300039437 Bacteria 1957
324 Ga0436360_0447023 3300039438 Bacteria 720
325 Ga0436361_0555100 3300039447 Bacteria 2351
326 Ga0495592_0000090 3300046454 Bacteria 80171
327 Ga0495603_0092382 3300046455 Bacteria 1768
328 Ga0495591_059150 3300046458 Bacteria 1023
329 Ga0495629_0016944 3300046459 Bacteria 5228
330 Ga0495629_0196739 3300046459 Bacteria 1394
331 Ga0495641_0042294 3300046461 Bacteria 2112
332 Ga0495651_0001695 3300046462 Bacteria 17029
333 Ga0495653_0000107 3300046463 Bacteria 69282
334 Ga0495580_0059946 3300046472 Bacteria 2674
335 Ga0495580_0385976 3300046472 Bacteria 946
336 Ga0495582_0455365 3300046473 Bacteria 739
337 Ga0495605_0045283 3300046474 Bacteria 2169
338 Ga0495639_0009262 3300046475 Bacteria 4220
339 Ga0495662_0003097 3300046476 Bacteria 8384
340 Ga0495662_0104819 3300046476 Unclassified 1384
341 Ga0495664_0000009 3300046477 Bacteria 289534
342 Ga0495664_0430933 3300046477 Bacteria 791
343 Ga0495584_0017642 3300046491 Bacteria 3632
344 Ga0495584_0245536 3300046491 Unclassified 910
345 Ga0495594_0104664 3300046499 Bacteria 1593
346 Ga0495594_0127415 3300046499 Bacteria 1441
347 Ga0495596_0038183 3300046500 Bacteria 1899
348 Ga0495608_0000022 3300046511 Bacteria 165111
349 Ga0495616_0044925 3300046513 Bacteria 2239
350 Ga0495618_0000016 3300046514 Bacteria 151770
351 Ga0495628_0000035 3300046516 Bacteria 111560
352 Ga0495630_0000246 3300046517 Bacteria 43555
353 Ga0495630_0960239 3300046517 Unclassified 650
354 Ga0495632_0128250 3300046519 Bacteria 1181
355 Ga0495644_0123833 3300046523 Bacteria 984
356 Ga0495652_0000062 3300046529 Bacteria 111572
357 Ga0495654_0381907 3300046530 Bacteria 562
358 Ga0495640_0000021 3300046533 Bacteria 110511
359 Ga0495640_0152311 3300046533 Bacteria 1485
360 Ga0495587_0000006 3300046536 Bacteria 310070
361 Ga0495645_0000090 3300046543 Bacteria 63443
362 Ga0495633_0082522 3300046558 Bacteria 1496
363 Ga0495633_0183404 3300046558 Bacteria 963
364 Ga0495633_0271611 3300046558 Bacteria 772
365 Ga0495667_0000011 3300046559 Bacteria 222545
366 Ga0495656_0004369 3300046615 Bacteria 4836
367 Ga0495656_0107212 3300046615 Bacteria 1301
368 Ga0495656_0296732 3300046615 Bacteria 827
369 Ga0495668_0101860 3300046616 Bacteria 1571
370 Ga0495634_0000291 3300046642 Bacteria 48026
371 Ga0495611_0019489 3300046648 Bacteria 2915
372 Ga0495635_0000018 3300046663 Bacteria 193591
373 Ga0495661_0038024 3300046665 Bacteria 3002
374 Ga0495657_0000345 3300046675 Bacteria 42909
375 Ga0495599_0000032 3300046678 Bacteria 108178
376 Ga0495599_0028123 3300046678 Bacteria 3523
377 Ga0495623_0000099 3300046679 Bacteria 52531
378 Ga0495646_0000045 3300046680 Bacteria 63367
379 Ga0495647_0010109 3300046681 Bacteria 3209
380 Ga0495669_0077556 3300046684 Bacteria 1521
381 Ga0495613_0017674 3300046689 Bacteria 5313
382 Ga0495624_0235545 3300046690 Bacteria 1108
383 Ga0495624_0262454 3300046690 Bacteria 1043
384 Ga0495670_0394459 3300046691 Unclassified 747
385 Ga0495649_0048336 3300046694 Bacteria 2312
386 Ga0495600_0000022 3300046809 Bacteria 94789
387 Ga0495660_0386766 3300046810 Bacteria 615
388 Ga0495581_0103742 3300047315 Bacteria 1652
389 Ga0495581_0434171 3300047315 Bacteria 765
390 Ga0495604_0000011 3300047317 Bacteria 292024
391 Ga0495674_0000034 3300047319 Bacteria 110674
392 Ga0495674_0119029 3300047319 Bacteria 2233
393 Ga0495676_0250790 3300047321 Bacteria 1207
394 Ga0495680_0004388 3300047322 Bacteria 13502
395 Ga0495683_0248710 3300047323 Bacteria 781
396 Ga0495675_0000546 3300047444 Bacteria 24343
397 Ga0495679_026243 3300047446 Bacteria 1937
398 Ga0495684_0000012 3300047471 Bacteria 187118
399 Ga0495593_0005383 3300047673 Bacteria 7569
400 Ga0495593_0045463 3300047673 Bacteria 2343
401 Ga0495602_0000064 3300048088 Bacteria 104858
402 Ga0496100_0012357 3300048903 Bacteria 4893
403 Ga0496100_0048861 3300048903 Bacteria 2733
404 Ga0496100_0093967 3300048903 Bacteria 2053
405 Ga0496100_0789860 3300048903 Bacteria 743
406 Ga0496100_0916239 3300048903 Bacteria 688
407 Ga0496101_0028408 3300048904 Bacteria 3904
408 Ga0496101_0046395 3300048904 Bacteria 3116
409 Ga0496101_0065397 3300048904 Bacteria 2651
410 Ga0496101_0091551 3300048904 Bacteria 2263
411 Ga0496101_0347486 3300048904 Bacteria 1165
412 Ga0496101_0359003 3300048904 Bacteria 1145
413 Ga0496101_0420550 3300048904 Bacteria 1053
414 Ga0496102_0013783 3300048905 Bacteria 7012
415 Ga0496102_0017127 3300048905 Bacteria 6344
416 Ga0496102_0130634 3300048905 Bacteria 2350
417 Ga0496102_0181998 3300048905 Bacteria 1980
418 Ga0496102_0211968 3300048905 Bacteria 1826
419 Ga0496102_0218287 3300048905 Bacteria 1797
420 Ga0496102_0429647 3300048905 Bacteria 1240
421 Ga0496103_0019182 3300048906 Bacteria 4106
422 Ga0496104_0037743 3300048907 Bacteria 4517
423 Ga0496104_0075910 3300048907 Bacteria 3200
424 Ga0496104_0165830 3300048907 Bacteria 2118
425 Ga0496104_0529918 3300048907 Bacteria 1089
426 Ga0496104_0971736 3300048907 Bacteria 753
427 Ga0496105_0014065 3300048908 Bacteria 6368
428 Ga0496105_0018577 3300048908 Bacteria 5595
429 Ga0496105_0027183 3300048908 Bacteria 4671
430 Ga0496105_0052029 3300048908 Bacteria 3382
431 Ga0496105_0820982 3300048908 Bacteria 706
432 Ga0496106_0013516 3300048909 Bacteria 6028
433 Ga0496106_0029834 3300048909 Bacteria 4066
434 Ga0496106_0088290 3300048909 Bacteria 2390
435 Ga0496106_0118723 3300048909 Bacteria 2065
436 Ga0496107_0022278 3300048910 Bacteria 4478
437 Ga0496107_0066757 3300048910 Bacteria 2608
438 Ga0496107_0120440 3300048910 Bacteria 1933
439 Ga0496107_0364602 3300048910 Bacteria 1075
440 Ga0496107_0378541 3300048910 Bacteria 1053
441 Ga0496108_0002732 3300048911 Bacteria 14107
442 Ga0496108_0029188 3300048911 Bacteria 4566
443 Ga0496108_0062109 3300048911 Bacteria 3146
444 Ga0496108_0073880 3300048911 Bacteria 2878
445 Ga0496108_0079229 3300048911 Bacteria 2781
446 Ga0496108_0155118 3300048911 Bacteria 1977
447 Ga0496109_0013085 3300048912 Bacteria 7177
448 Ga0496109_0018982 3300048912 Bacteria 6055
449 Ga0496109_0020360 3300048912 Bacteria 5859
450 Ga0496109_0041456 3300048912 Bacteria 4170
451 Ga0496109_0154622 3300048912 Bacteria 2148
452 Ga0496110_0031616 3300048913 Bacteria 4567
453 Ga0496110_0074564 3300048913 Bacteria 3013
454 Ga0496110_0103118 3300048913 Bacteria 2558
455 Ga0496110_0749714 3300048913 Bacteria 879
456 Ga0496111_0003120 3300048914 Bacteria 10194
457 Ga0496111_0023245 3300048914 Bacteria 4351
458 Ga0496111_0074498 3300048914 Bacteria 2472
459 Ga0496111_0174392 3300048914 Bacteria 1598
460 Ga0496111_0789668 3300048914 Bacteria 687
461 Ga0496112_0016600 3300048915 Bacteria 6902
462 Ga0496112_0017973 3300048915 Bacteria 6653
463 Ga0496112_0357640 3300048915 Bacteria 1402
464 Ga0496112_0425509 3300048915 Bacteria 1266
465 Ga0496112_0716776 3300048915 Bacteria 928
466 Ga0496112_1037394 3300048915 Bacteria 739
467 Ga0496113_0001270 3300048916 Bacteria 13903
468 Ga0496113_0041133 3300048916 Bacteria 3409
469 Ga0496113_0045597 3300048916 Bacteria 3252
470 Ga0496113_0065211 3300048916 Bacteria 2755
471 Ga0496114_0182049 3300048917 Bacteria 1835
472 Ga0496114_0211910 3300048917 Bacteria 1699
473 Ga0496114_0271790 3300048917 Bacteria 1493
474 Ga0496114_0415028 3300048917 Bacteria 1192
475 Ga0496114_0825316 3300048917 Bacteria 806
476 Ga0496115_0012146 3300048918 Bacteria 6476
477 Ga0496115_0037403 3300048918 Bacteria 3846
478 Ga0496115_0086192 3300048918 Bacteria 2562
479 Ga0496115_0109006 3300048918 Bacteria 2273
480 Ga0496115_0109730 3300048918 Bacteria 2266
481 Ga0496115_0190094 3300048918 Bacteria 1696
482 Ga0496115_0253942 3300048918 Bacteria 1447
483 Ga0496121_0025008 3300048924 Bacteria 5686
484 Ga0501033_0737075 3300049570 Bacteria 669
485 Ga0501036_0373888 3300049572 Bacteria 1190
486 Ga0501036_0395575 3300049572 Bacteria 1153
487 Ga0501039_0421149 3300049575 Bacteria 1049
488 Ga0501040_0139100 3300049576 Bacteria 1710
489 Ga0501041_0088651 3300049577 Bacteria 1910
490 Ga0501041_0666038 3300049577 Bacteria 665
491 Ga0501042_0374877 3300049578 Bacteria 1030
492 Ga0501042_0555637 3300049578 Bacteria 834
493 Ga0501043_0125129 3300049579 Bacteria 2016
494 Ga0501046_0157648 3300049580 Bacteria 1709
495 Ga0501047_0150604 3300049581 Bacteria 2202
496 Ga0501067_0073891 3300049583 Bacteria 1889
497 Ga0501068_0734910 3300049584 Bacteria 646
498 Ga0501069_0149985 3300049585 Bacteria 1340
499 Ga0501070_0101551 3300049586 Bacteria 2379
500 Ga0501071_0146537 3300049587 Bacteria 1760
501 Ga0501071_0546027 3300049587 Bacteria 890
502 Ga0501072_0525372 3300049588 Bacteria 935
503 Ga0501073_0524207 3300049589 Bacteria 819
504 Ga0501074_0851440 3300049590 Bacteria 642
505 Ga0501077_0338889 3300049593 Bacteria 959
506 Ga0501079_0023418 3300049741 Bacteria 4739
507 Ga0501079_0158013 3300049741 Bacteria 1767
508 Ga0501081_0047809 3300049743 Bacteria 2944
509 Ga0501081_0226729 3300049743 Bacteria 1360
510 Ga0501035_0218916 3300049822 Bacteria 1626
511 Ga0501044_0028570 3300049823 Bacteria 5887
512 Ga0501044_0219405 3300049823 Bacteria 1853
513 Ga0501045_0274955 3300049824 Bacteria 1254
514 Ga0501045_0826934 3300049824 Bacteria 682
515 nmdc:mga03683_4273_c1 3300050489 Bacteria 3562
516 nmdc:mga03n38_358233_c1 3300050490 Bacteria 795
517 nmdc:mga00v17_66138_c1 3300050491 Bacteria 2231
518 nmdc:mga00v17_670582_c1 3300050491 Bacteria 666
519 nmdc:mga0yw44_138296_c1 3300050492 Bacteria 1581
520 nmdc:mga0yw44_2221_c1 3300050492 Bacteria 8181
521 nmdc:mga0yw44_472163_c1 3300050492 Bacteria 851
522 nmdc:mga0yw44_84092_c1 3300050492 Bacteria 2000
523 nmdc:mga06z11_190051_c1 3300050494 Bacteria 1188
524 nmdc:mga06z11_263306_c1 3300050494 Bacteria 1018
525 nmdc:mga06z11_327969_c1 3300050494 Bacteria 914
526 nmdc:mga06z11_562894_c1 3300050494 Bacteria 692
527 nmdc:mga07m45_235966_c1 3300050496 Bacteria 1064
528 nmdc:mga07m45_287092_c1 3300050496 Bacteria 957
529 nmdc:mga05p37_10936_c1 3300050507 Bacteria 10774
530 nmdc:mga05p37_119648_c1 3300050507 Bacteria 3236
531 nmdc:mga05p37_15850_c1 3300050507 Bacteria 9065
532 nmdc:mga05p37_35_c1 3300050507 Bacteria 110751
533 nmdc:mga05p37_490111_c1 3300050507 Bacteria 1413
534 nmdc:mga09592_163_c1 3300050508 Bacteria 46620
535 nmdc:mga0qj67_129176_c1 3300050509 Bacteria 2046
536 nmdc:mga0qj67_143_c1 3300050509 Bacteria 48269
537 nmdc:mga0qj67_535642_c1 3300050509 Bacteria 940
538 nmdc:mga06r32_130898_c1 3300050510 Bacteria 2481
539 nmdc:mga06r32_57410_c1 3300050510 Bacteria 3739
540 nmdc:mga06r32_774_c1 3300050510 Bacteria 28232
541 nmdc:mga06r32_958259_c1 3300050510 Bacteria 810
542 nmdc:mga06r32_96528_c1 3300050510 Bacteria 2895
543 nmdc:mga08y16_1272688_c1 3300050511 Unclassified 703
544 nmdc:mga08y16_206410_c1 3300050511 Bacteria 2035
545 nmdc:mga08y16_293005_c1 3300050511 Bacteria 1678
546 nmdc:mga08y16_356_c1 3300050511 Bacteria 41239
547 nmdc:mga08y16_974489_c1 3300050511 Bacteria 829
548 nmdc:mga08y16_98122_c1 3300050511 Bacteria 3051
549 nmdc:mga0n895_152970_c1 3300050512 Bacteria 2337
550 nmdc:mga0n895_33053_c1 3300050512 Bacteria 4969
551 nmdc:mga0n895_3734_c1 3300050512 Bacteria 12320
552 nmdc:mga0n895_37529_c1 3300050512 Bacteria 4688
553 nmdc:mga0n895_427962_c1 3300050512 Bacteria 1338
554 nmdc:mga0rr50_2803_c1 3300050513 Bacteria 9900
555 nmdc:mga0rr50_6925_c1 3300050513 Bacteria 6950
556 nmdc:mga0rr50_72238_c1 3300050513 Bacteria 2634
557 nmdc:mga08x19_69980_c1 3300050514 Bacteria 2286
558 nmdc:mga0a205_319649_c1 3300050515 Bacteria 1423
559 nmdc:mga0a205_344168_c1 3300050515 Bacteria 1359
560 nmdc:mga0a205_400_c1 3300050515 Bacteria 33140
561 Ga0495601_0000015 3300053077 Bacteria 213851
562 Ga0495601_0007860 3300053077 Bacteria 6278
563 Ga0495612_0000016 3300053078 Bacteria 158947
564 Ga0495612_0023236 3300053078 Bacteria 2487
565 Ga0495655_0012017 3300053083 Bacteria 1754
566 Ga0495655_0104813 3300053083 Bacteria 842
567 Ga0495619_0000044 3300053085 Bacteria 108581
568 Ga0500616_0000048 3300053153 Bacteria 313108
569 Ga0501084_0128065 3300054114 Bacteria 2137
570 Ga0501082_0054144 3300060353 Bacteria 3459
571 Ga0501082_0371585 3300060353 Bacteria 1247
572 Ga0501082_1414054 3300060353 Bacteria 607
573 Ga0501082_1500598 3300060353 Unclassified 589
574 Ga0530510_0145834 3300061734 Bacteria 1746

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_0155118 Ga0496108_0155118_1198_1701 153
2 3300048912 Ga0496109_0018982 Ga0496109_0018982_1165_1668 153
3 3300048913 Ga0496110_0074564 Ga0496110_0074564_393_896 153
4 3300048915 Ga0496112_0425509 Ga0496112_0425509_664_1167 153
5 3300025912 Ga0207707_10767285 Ga0207707_107672852 156
6 3300005438 Ga0070701_10528622 Ga0070701_105286221 158
7 3300006038 Ga0075365_10102285 Ga0075365_101022853 159
8 3300009094 Ga0111539_10173997 Ga0111539_101739972 160
9 3300050511 nmdc:mga08y16_206410_c1 nmdc:mga08y16_206410_c1_358_894 160
10 3300049741 Ga0501079_0023418 Ga0501079_0023418_821_1381 161
11 3300049743 Ga0501081_0047809 Ga0501081_0047809_423_983 161
12 3300039438 Ga0436360_0447023 Ga0436360_0447023_30_608 162
13 3300005842 Ga0068858_100240948 Ga0068858_1002409482 165
14 3300006881 Ga0068865_101230371 Ga0068865_1012303712 165
15 3300013297 Ga0157378_10339891 Ga0157378_103398913 165
16 3300025903 Ga0207680_10207022 Ga0207680_102070222 165
17 3300009101 Ga0105247_10065550 Ga0105247_100655503 166
18 3300049570 Ga0501033_0737075 Ga0501033_0737075_99_617 166
19 iso_pu_bacteria 2643221547 2643755108 166
20 3300005355 Ga0070671_100272998 Ga0070671_1002729982 167
21 3300005356 Ga0070674_100978712 Ga0070674_1009787121 167
22 3300005367 Ga0070667_100792091 Ga0070667_1007920911 167
23 3300005436 Ga0070713_100435279 Ga0070713_1004352792 167
24 3300005441 Ga0070700_100264459 Ga0070700_1002644592 167
25 3300005458 Ga0070681_10917930 Ga0070681_109179302 167
26 3300005546 Ga0070696_100506865 Ga0070696_1005068651 167
27 3300005549 Ga0070704_100048398 Ga0070704_1000483983 167
28 3300007265 Ga0099794_10137556 Ga0099794_101375562 167
29 3300009094 Ga0111539_10258403 Ga0111539_102584032 167
30 3300009147 Ga0114129_10021956 Ga0114129_100219562 167
31 3300010375 Ga0105239_10149726 Ga0105239_101497262 167
32 3300013306 Ga0163162_10938990 Ga0163162_109389901 167
33 3300025918 Ga0207662_10433713 Ga0207662_104337132 167
34 3300025928 Ga0207700_10335519 Ga0207700_103355192 167
35 3300026067 Ga0207678_11462784 Ga0207678_114627841 167
36 3300035083 Ga0373926_0032423 Ga0373926_0032423_468_971 167
37 3300035085 Ga0373929_0181865 Ga0373929_0181865_41_544 167
38 3300035089 Ga0373944_0017853 Ga0373944_0017853_1391_1894 167
39 3300035170 Ga0373943_0092116 Ga0373943_0092116_312_815 167
40 3300035170 Ga0373943_0337628 Ga0373943_0337628_263_766 167
41 3300035171 Ga0373946_0043184 Ga0373946_0043184_1256_1759 167
42 3300035171 Ga0373946_0095663 Ga0373946_0095663_134_637 167
43 3300035692 Ga0373935_0307150 Ga0373935_0307150_13_516 167
44 3300035695 Ga0373927_0033896 Ga0373927_0033896_2167_2670 167
45 3300035725 Ga0373947_0440960 Ga0373947_0440960_103_606 167
46 3300037068 Ga0373925_0130108 Ga0373925_0130108_707_1210 167
47 3300037068 Ga0373925_0516135 Ga0373925_0516135_55_558 167
48 3300046455 Ga0495603_0092382 Ga0495603_0092382_159_662 167
49 3300046458 Ga0495591_059150 Ga0495591_059150_112_615 167
50 3300046459 Ga0495629_0196739 Ga0495629_0196739_629_1132 167
51 3300046461 Ga0495641_0042294 Ga0495641_0042294_224_727 167
52 3300046472 Ga0495580_0059946 Ga0495580_0059946_1791_2294 167
53 3300046473 Ga0495582_0455365 Ga0495582_0455365_224_727 167
54 3300046475 Ga0495639_0009262 Ga0495639_0009262_3548_4051 167
55 3300046476 Ga0495662_0104819 Ga0495662_0104819_444_947 167
56 3300046491 Ga0495584_0017642 Ga0495584_0017642_2953_3456 167
57 3300046499 Ga0495594_0104664 Ga0495594_0104664_548_1051 167
58 3300046499 Ga0495594_0127415 Ga0495594_0127415_46_549 167
59 3300046517 Ga0495630_0960239 Ga0495630_0960239_32_535 167
60 3300046523 Ga0495644_0123833 Ga0495644_0123833_193_696 167
61 3300046530 Ga0495654_0381907 Ga0495654_0381907_37_540 167
62 3300046533 Ga0495640_0152311 Ga0495640_0152311_698_1201 167
63 3300046558 Ga0495633_0183404 Ga0495633_0183404_112_615 167
64 3300046558 Ga0495633_0271611 Ga0495633_0271611_246_749 167
65 3300046615 Ga0495656_0004369 Ga0495656_0004369_3759_4262 167
66 3300046665 Ga0495661_0038024 Ga0495661_0038024_1115_1618 167
67 3300046681 Ga0495647_0010109 Ga0495647_0010109_1019_1522 167
68 3300046689 Ga0495613_0017674 Ga0495613_0017674_4787_5290 167
69 3300046690 Ga0495624_0235545 Ga0495624_0235545_369_872 167
70 3300046691 Ga0495670_0394459 Ga0495670_0394459_129_632 167
71 3300047315 Ga0495581_0434171 Ga0495581_0434171_177_680 167
72 3300047321 Ga0495676_0250790 Ga0495676_0250790_281_784 167
73 3300047446 Ga0495679_026243 Ga0495679_026243_453_956 167
74 3300047673 Ga0495593_0045463 Ga0495593_0045463_937_1440 167
75 3300048903 Ga0496100_0012357 Ga0496100_0012357_3008_3559 167
76 3300048904 Ga0496101_0028408 Ga0496101_0028408_2681_3184 167
77 3300048904 Ga0496101_0046395 Ga0496101_0046395_1344_1895 167
78 3300048905 Ga0496102_0013783 Ga0496102_0013783_5304_5855 167
79 3300048905 Ga0496102_0130634 Ga0496102_0130634_27_530 167
80 3300048907 Ga0496104_0037743 Ga0496104_0037743_2943_3494 167
81 3300048908 Ga0496105_0018577 Ga0496105_0018577_853_1356 167
82 3300048908 Ga0496105_0052029 Ga0496105_0052029_630_1181 167
83 3300048909 Ga0496106_0029834 Ga0496106_0029834_2545_3096 167
84 3300048910 Ga0496107_0066757 Ga0496107_0066757_1089_1640 167
85 3300048910 Ga0496107_0378541 Ga0496107_0378541_177_680 167
86 3300048911 Ga0496108_0073880 Ga0496108_0073880_1036_1587 167
87 3300048912 Ga0496109_0013085 Ga0496109_0013085_3948_4499 167
88 3300048913 Ga0496110_0749714 Ga0496110_0749714_137_688 167
89 3300048914 Ga0496111_0023245 Ga0496111_0023245_386_937 167
90 3300048915 Ga0496112_0357640 Ga0496112_0357640_580_1131 167
91 3300048916 Ga0496113_0041133 Ga0496113_0041133_869_1372 167
92 3300048916 Ga0496113_0045597 Ga0496113_0045597_575_1126 167
93 3300048917 Ga0496114_0182049 Ga0496114_0182049_1023_1526 167
94 3300048917 Ga0496114_0415028 Ga0496114_0415028_289_840 167
95 3300048918 Ga0496115_0037403 Ga0496115_0037403_1414_1917 167
96 3300048918 Ga0496115_0086192 Ga0496115_0086192_744_1247 167
97 3300048918 Ga0496115_0253942 Ga0496115_0253942_241_792 167
98 3300049577 Ga0501041_0088651 Ga0501041_0088651_936_1487 167
99 3300049578 Ga0501042_0374877 Ga0501042_0374877_432_983 167
100 3300049583 Ga0501067_0073891 Ga0501067_0073891_838_1458 167
101 3300049824 Ga0501045_0826934 Ga0501045_0826934_25_576 167
102 3300050507 nmdc:mga05p37_10936_c1 nmdc:mga05p37_10936_c1_4901_5404 167
103 3300053083 Ga0495655_0104813 Ga0495655_0104813_267_770 167
104 3300053153 Ga0500616_0000048 Ga0500616_0000048_292909_293427 167
105 3300060353 Ga0501082_0054144 Ga0501082_0054144_1056_1616 167
106 3300005365 Ga0070688_100168370 Ga0070688_1001683701 168
107 3300026035 Ga0207703_11147909 Ga0207703_111479092 168
108 3300046678 Ga0495599_0028123 Ga0495599_0028123_1533_2054 168
109 3300047319 Ga0495674_0119029 Ga0495674_0119029_1205_1726 168
110 3300048924 Ga0496121_0025008 Ga0496121_0025008_2016_2528 168
111 3300053077 Ga0495601_0007860 Ga0495601_0007860_4237_4758 168
112 3300053078 Ga0495612_0023236 Ga0495612_0023236_1302_1823 168
113 3300006051 Ga0075364_10711855 Ga0075364_107118552 169
114 3300006846 Ga0075430_100557919 Ga0075430_1005579192 169
115 3300021384 Ga0213876_10339035 Ga0213876_103390352 169
116 3300049572 Ga0501036_0395575 Ga0501036_0395575_184_696 169
117 3300049824 Ga0501045_0274955 Ga0501045_0274955_271_783 169
118 3300050494 nmdc:mga06z11_562894_c1 nmdc:mga06z11_562894_c1_87_596 169
119 3300050511 nmdc:mga08y16_1272688_c1 nmdc:mga08y16_1272688_c1_47_562 169
120 3300003911 JGI25405J52794_10011756 JGI25405J52794_100117562 170
121 3300005435 Ga0070714_100313601 Ga0070714_1003136011 170
122 3300005937 Ga0081455_10004590 Ga0081455_100045907 170
123 3300005937 Ga0081455_10098018 Ga0081455_100980182 170
124 3300006028 Ga0070717_10443878 Ga0070717_104438782 170
125 3300006058 Ga0075432_10002319 Ga0075432_100023192 170
126 3300006194 Ga0075427_10004166 Ga0075427_100041662 170
127 3300006844 Ga0075428_101073147 Ga0075428_1010731472 170
128 3300006846 Ga0075430_100000128 Ga0075430_10000012828 170
129 3300006847 Ga0075431_100001558 Ga0075431_10000155815 170
130 3300006852 Ga0075433_10000103 Ga0075433_1000010318 170
131 3300006852 Ga0075433_10941705 Ga0075433_109417052 170
132 3300006871 Ga0075434_100001533 Ga0075434_10000153315 170
133 3300006871 Ga0075434_100020416 Ga0075434_1000204162 170
134 3300006871 Ga0075434_100284869 Ga0075434_1002848692 170
135 3300006880 Ga0075429_100000381 Ga0075429_10000038127 170
136 3300006914 Ga0075436_100004204 Ga0075436_1000042045 170
137 3300007076 Ga0075435_100015585 Ga0075435_1000155853 170
138 3300007076 Ga0075435_100048649 Ga0075435_1000486492 170
139 3300009094 Ga0111539_10000787 Ga0111539_100007878 170
140 3300009147 Ga0114129_10003834 Ga0114129_1000383422 170
141 3300009147 Ga0114129_10017332 Ga0114129_100173326 170
142 3300025929 Ga0207664_10175105 Ga0207664_101751052 170
143 3300027671 Ga0209588_1010668 Ga0209588_10106683 170
144 3300027907 Ga0207428_10000058 Ga0207428_1000005831 170
145 3300028379 Ga0268266_10209426 Ga0268266_102094261 170
146 3300028800 Ga0265338_10229544 Ga0265338_102295442 170
147 3300031247 Ga0265340_10094517 Ga0265340_100945171 170
148 3300037418 Ga0395900_0500238 Ga0395900_0500238_563_1075 170
149 3300050507 nmdc:mga05p37_15850_c1 nmdc:mga05p37_15850_c1_6650_7162 170
150 3300050507 nmdc:mga05p37_35_c1 nmdc:mga05p37_35_c1_87593_88105 170
151 3300050508 nmdc:mga09592_163_c1 nmdc:mga09592_163_c1_35282_35794 170
152 3300050509 nmdc:mga0qj67_143_c1 nmdc:mga0qj67_143_c1_35281_35793 170
153 3300050510 nmdc:mga06r32_774_c1 nmdc:mga06r32_774_c1_19989_20501 170
154 3300050511 nmdc:mga08y16_356_c1 nmdc:mga08y16_356_c1_16065_16577 170
155 3300050512 nmdc:mga0n895_3734_c1 nmdc:mga0n895_3734_c1_719_1231 170
156 3300050512 nmdc:mga0n895_37529_c1 nmdc:mga0n895_37529_c1_2168_2680 170
157 3300050513 nmdc:mga0rr50_2803_c1 nmdc:mga0rr50_2803_c1_2935_3447 170
158 3300050513 nmdc:mga0rr50_6925_c1 nmdc:mga0rr50_6925_c1_2262_2774 170
159 3300050513 nmdc:mga0rr50_72238_c1 nmdc:mga0rr50_72238_c1_732_1250 170
160 3300050514 nmdc:mga08x19_69980_c1 nmdc:mga08x19_69980_c1_993_1511 170
161 3300050515 nmdc:mga0a205_344168_c1 nmdc:mga0a205_344168_c1_56_568 170
162 3300050515 nmdc:mga0a205_400_c1 nmdc:mga0a205_400_c1_2117_2629 170
163 3300031241 Ga0265325_10002612 Ga0265325_1000261213 171
164 3300031595 Ga0265313_10031287 Ga0265313_100312872 171
165 3300005530 Ga0070679_100651291 Ga0070679_1006512911 172
166 3300005578 Ga0068854_100641043 Ga0068854_1006410431 172
167 3300006038 Ga0075365_10140488 Ga0075365_101404882 172
168 3300009094 Ga0111539_11028824 Ga0111539_110288242 172
169 3300025921 Ga0207652_10142594 Ga0207652_101425943 172
170 3300025981 Ga0207640_10603050 Ga0207640_106030501 172
171 3300031247 Ga0265340_10052072 Ga0265340_100520722 172
172 3300035111 Ga0373923_0000898 Ga0373923_0000898_7037_7561 172
173 3300035113 Ga0373936_0009843 Ga0373936_0009843_3023_3547 172
174 3300035116 Ga0373945_0007874 Ga0373945_0007874_2895_3419 172
175 3300035117 Ga0373953_0002133 Ga0373953_0002133_2272_2796 172
176 3300035118 Ga0373954_0005093 Ga0373954_0005093_2020_2544 172
177 3300035120 Ga0373957_0010197 Ga0373957_0010197_194_718 172
178 3300035170 Ga0373943_0057479 Ga0373943_0057479_1174_1698 172
179 3300035171 Ga0373946_0000519 Ga0373946_0000519_8572_9096 172
180 3300035172 Ga0373955_0028356 Ga0373955_0028356_1831_2355 172
181 3300035410 Ga0373924_0002836 Ga0373924_0002836_2619_3143 172
182 3300035692 Ga0373935_0000305 Ga0373935_0000305_17995_18519 172
183 3300035695 Ga0373927_0010850 Ga0373927_0010850_3342_3866 172
184 3300035725 Ga0373947_0001375 Ga0373947_0001375_14275_14799 172
185 3300036401 Ga0373937_0000385 Ga0373937_0000385_39475_39999 172
186 3300037068 Ga0373925_0000038 Ga0373925_0000038_106298_106822 172
187 3300046454 Ga0495592_0000090 Ga0495592_0000090_79466_79990 172
188 3300046459 Ga0495629_0016944 Ga0495629_0016944_1123_1647 172
189 3300046462 Ga0495651_0001695 Ga0495651_0001695_2480_3004 172
190 3300046463 Ga0495653_0000107 Ga0495653_0000107_28255_28779 172
191 3300046476 Ga0495662_0003097 Ga0495662_0003097_2361_2885 172
192 3300046477 Ga0495664_0000009 Ga0495664_0000009_34394_34918 172
193 3300046511 Ga0495608_0000022 Ga0495608_0000022_82830_83354 172
194 3300046514 Ga0495618_0000016 Ga0495618_0000016_112658_113182 172
195 3300046516 Ga0495628_0000035 Ga0495628_0000035_30654_31178 172
196 3300046517 Ga0495630_0000246 Ga0495630_0000246_35801_36325 172
197 3300046529 Ga0495652_0000062 Ga0495652_0000062_30666_31190 172
198 3300046533 Ga0495640_0000021 Ga0495640_0000021_81758_82282 172
199 3300046536 Ga0495587_0000006 Ga0495587_0000006_30666_31190 172
200 3300046543 Ga0495645_0000090 Ga0495645_0000090_28271_28795 172
201 3300046559 Ga0495667_0000011 Ga0495667_0000011_187418_187942 172
202 3300046642 Ga0495634_0000291 Ga0495634_0000291_35099_35623 172
203 3300046663 Ga0495635_0000018 Ga0495635_0000018_113583_114107 172
204 3300046675 Ga0495657_0000345 Ga0495657_0000345_28239_28763 172
205 3300046678 Ga0495599_0000032 Ga0495599_0000032_28266_28790 172
206 3300046679 Ga0495623_0000099 Ga0495623_0000099_40341_40865 172
207 3300046680 Ga0495646_0000045 Ga0495646_0000045_34587_35111 172
208 3300046690 Ga0495624_0262454 Ga0495624_0262454_189_713 172
209 3300046809 Ga0495600_0000022 Ga0495600_0000022_12508_13032 172
210 3300047315 Ga0495581_0103742 Ga0495581_0103742_649_1173 172
211 3300047317 Ga0495604_0000011 Ga0495604_0000011_79485_80009 172
212 3300047319 Ga0495674_0000034 Ga0495674_0000034_30666_31190 172
213 3300047322 Ga0495680_0004388 Ga0495680_0004388_5840_6364 172
214 3300047444 Ga0495675_0000546 Ga0495675_0000546_23045_23569 172
215 3300047471 Ga0495684_0000012 Ga0495684_0000012_104952_105476 172
216 3300047673 Ga0495593_0005383 Ga0495593_0005383_5962_6486 172
217 3300048088 Ga0495602_0000064 Ga0495602_0000064_79485_80009 172
218 3300049579 Ga0501043_0125129 Ga0501043_0125129_1418_1936 172
219 3300049580 Ga0501046_0157648 Ga0501046_0157648_1104_1622 172
220 3300049581 Ga0501047_0150604 Ga0501047_0150604_200_718 172
221 3300049586 Ga0501070_0101551 Ga0501070_0101551_1348_1866 172
222 3300049587 Ga0501071_0146537 Ga0501071_0146537_1008_1526 172
223 3300049590 Ga0501074_0851440 Ga0501074_0851440_64_582 172
224 3300049741 Ga0501079_0158013 Ga0501079_0158013_1170_1694 172
225 3300049822 Ga0501035_0218916 Ga0501035_0218916_1015_1533 172
226 3300049823 Ga0501044_0028570 Ga0501044_0028570_5048_5566 172
227 3300049823 Ga0501044_0219405 Ga0501044_0219405_71_592 172
228 3300053077 Ga0495601_0000015 Ga0495601_0000015_79485_80009 172
229 3300053078 Ga0495612_0000016 Ga0495612_0000016_41719_42243 172
230 3300053085 Ga0495619_0000044 Ga0495619_0000044_79785_80309 172
231 3300060353 Ga0501082_0371585 Ga0501082_0371585_377_895 172
232 3300060353 Ga0501082_1500598 Ga0501082_1500598_27_545 172
233 3300009094 Ga0111539_10072403 Ga0111539_100724032 173
234 3300009551 Ga0105238_10886466 Ga0105238_108864662 173
235 3300025936 Ga0207670_10715807 Ga0207670_107158072 173
236 3300005341 Ga0070691_10008865 Ga0070691_100088652 174
237 3300005438 Ga0070701_10044646 Ga0070701_100446463 174
238 3300005530 Ga0070679_100437527 Ga0070679_1004375271 174
239 3300005983 Ga0081540_1051353 Ga0081540_10513532 174
240 3300006051 Ga0075364_10206526 Ga0075364_102065262 174
241 3300009094 Ga0111539_10198645 Ga0111539_101986453 174
242 3300009098 Ga0105245_11144545 Ga0105245_111445451 174
243 3300009148 Ga0105243_10161067 Ga0105243_101610672 174
244 3300009174 Ga0105241_10256604 Ga0105241_102566042 174
245 3300009176 Ga0105242_10049535 Ga0105242_100495353 174
246 3300009177 Ga0105248_10139518 Ga0105248_101395183 174
247 3300009545 Ga0105237_10243985 Ga0105237_102439852 174
248 3300009551 Ga0105238_10727408 Ga0105238_107274082 174
249 3300009553 Ga0105249_10172755 Ga0105249_101727553 174
250 3300010375 Ga0105239_10166891 Ga0105239_101668912 174
251 3300013297 Ga0157378_10187589 Ga0157378_101875893 174
252 3300013306 Ga0163162_10162965 Ga0163162_101629652 174
253 3300013308 Ga0157375_10187602 Ga0157375_101876022 174
254 3300013308 Ga0157375_10486483 Ga0157375_104864832 174
255 3300014325 Ga0163163_10269307 Ga0163163_102693072 174
256 3300014325 Ga0163163_10797003 Ga0163163_107970031 174
257 3300014326 Ga0157380_10919791 Ga0157380_109197912 174
258 3300014968 Ga0157379_10335397 Ga0157379_103353972 174
259 3300014969 Ga0157376_10976052 Ga0157376_109760522 174
260 3300025904 Ga0207647_10010563 Ga0207647_100105632 174
261 3300025926 Ga0207659_10392468 Ga0207659_103924681 174
262 3300046474 Ga0495605_0045283 Ga0495605_0045283_990_1514 174
263 3300046477 Ga0495664_0430933 Ga0495664_0430933_113_637 174
264 3300046491 Ga0495584_0245536 Ga0495584_0245536_143_667 174
265 3300046500 Ga0495596_0038183 Ga0495596_0038183_843_1367 174
266 3300046513 Ga0495616_0044925 Ga0495616_0044925_398_922 174
267 3300046519 Ga0495632_0128250 Ga0495632_0128250_418_942 174
268 3300046558 Ga0495633_0082522 Ga0495633_0082522_367_891 174
269 3300046615 Ga0495656_0107212 Ga0495656_0107212_524_1048 174
270 3300046616 Ga0495668_0101860 Ga0495668_0101860_190_714 174
271 3300046648 Ga0495611_0019489 Ga0495611_0019489_2159_2683 174
272 3300046684 Ga0495669_0077556 Ga0495669_0077556_519_1043 174
273 3300046694 Ga0495649_0048336 Ga0495649_0048336_676_1200 174
274 3300046810 Ga0495660_0386766 Ga0495660_0386766_37_561 174
275 3300047323 Ga0495683_0248710 Ga0495683_0248710_51_575 174
276 3300048903 Ga0496100_0916239 Ga0496100_0916239_35_559 174
277 3300048904 Ga0496101_0359003 Ga0496101_0359003_246_770 174
278 3300048904 Ga0496101_0420550 Ga0496101_0420550_369_893 174
279 3300048905 Ga0496102_0017127 Ga0496102_0017127_5593_6117 174
280 3300048905 Ga0496102_0429647 Ga0496102_0429647_424_948 174
281 3300048906 Ga0496103_0019182 Ga0496103_0019182_2207_2731 174
282 3300048907 Ga0496104_0971736 Ga0496104_0971736_100_624 174
283 3300048909 Ga0496106_0013516 Ga0496106_0013516_4389_4913 174
284 3300048910 Ga0496107_0364602 Ga0496107_0364602_448_972 174
285 3300048911 Ga0496108_0002732 Ga0496108_0002732_1864_2388 174
286 3300048914 Ga0496111_0074498 Ga0496111_0074498_682_1206 174
287 3300048916 Ga0496113_0065211 Ga0496113_0065211_709_1233 174
288 3300048917 Ga0496114_0271790 Ga0496114_0271790_271_795 174
289 3300048917 Ga0496114_0825316 Ga0496114_0825316_221_745 174
290 3300048918 Ga0496115_0012146 Ga0496115_0012146_373_897 174
291 3300050489 nmdc:mga03683_4273_c1 nmdc:mga03683_4273_c1_1306_1833 174
292 3300050490 nmdc:mga03n38_358233_c1 nmdc:mga03n38_358233_c1_253_777 174
293 3300050491 nmdc:mga00v17_66138_c1 nmdc:mga00v17_66138_c1_950_1477 174
294 3300050491 nmdc:mga00v17_670582_c1 nmdc:mga00v17_670582_c1_26_550 174
295 3300050492 nmdc:mga0yw44_2221_c1 nmdc:mga0yw44_2221_c1_3050_3577 174
296 3300050492 nmdc:mga0yw44_472163_c1 nmdc:mga0yw44_472163_c1_16_540 174
297 3300050494 nmdc:mga06z11_263306_c1 nmdc:mga06z11_263306_c1_387_911 174
298 3300050496 nmdc:mga07m45_235966_c1 nmdc:mga07m45_235966_c1_244_768 174
299 3300050509 nmdc:mga0qj67_535642_c1 nmdc:mga0qj67_535642_c1_70_597 174
300 3300050510 nmdc:mga06r32_130898_c1 nmdc:mga06r32_130898_c1_939_1466 174
301 3300050511 nmdc:mga08y16_974489_c1 nmdc:mga08y16_974489_c1_212_739 174
302 3300005518 Ga0070699_100010912 Ga0070699_1000109128 175
303 3300049572 Ga0501036_0373888 Ga0501036_0373888_418_954 175
304 3300049576 Ga0501040_0139100 Ga0501040_0139100_388_924 175
305 3300049577 Ga0501041_0666038 Ga0501041_0666038_68_604 175
306 3300049578 Ga0501042_0555637 Ga0501042_0555637_205_741 175
307 3300049584 Ga0501068_0734910 Ga0501068_0734910_27_563 175
308 3300049587 Ga0501071_0546027 Ga0501071_0546027_262_798 175
309 3300049588 Ga0501072_0525372 Ga0501072_0525372_166_699 175
310 3300049589 Ga0501073_0524207 Ga0501073_0524207_146_682 175
311 3300049593 Ga0501077_0338889 Ga0501077_0338889_281_817 175
312 3300049743 Ga0501081_0226729 Ga0501081_0226729_316_849 175
313 3300050507 nmdc:mga05p37_490111_c1 nmdc:mga05p37_490111_c1_41_568 175
314 3300050512 nmdc:mga0n895_152970_c1 nmdc:mga0n895_152970_c1_200_727 175
315 3300054114 Ga0501084_0128065 Ga0501084_0128065_1072_1605 175
316 3300061734 Ga0530510_0145834 Ga0530510_0145834_917_1450 175
317 3300005340 Ga0070689_100031016 Ga0070689_1000310162 176
318 3300005344 Ga0070661_100408336 Ga0070661_1004083362 176
319 3300005355 Ga0070671_100008828 Ga0070671_1000088283 176
320 3300005364 Ga0070673_100001201 Ga0070673_1000012016 176
321 3300005365 Ga0070688_100877494 Ga0070688_1008774941 176
322 3300005366 Ga0070659_100676763 Ga0070659_1006767631 176
323 3300005434 Ga0070709_10060095 Ga0070709_100600952 176
324 3300005435 Ga0070714_100219268 Ga0070714_1002192682 176
325 3300005439 Ga0070711_100013397 Ga0070711_1000133972 176
326 3300005441 Ga0070700_100295107 Ga0070700_1002951071 176
327 3300005543 Ga0070672_100474338 Ga0070672_1004743382 176
328 3300005548 Ga0070665_100022370 Ga0070665_1000223705 176
329 3300005564 Ga0070664_100066665 Ga0070664_1000666652 176
330 3300005937 Ga0081455_10004266 Ga0081455_100042664 176
331 3300006028 Ga0070717_10089423 Ga0070717_100894233 176
332 3300006163 Ga0070715_10223736 Ga0070715_102237361 176
333 3300006175 Ga0070712_100136840 Ga0070712_1001368402 176
334 3300006844 Ga0075428_100293518 Ga0075428_1002935182 176
335 3300006914 Ga0075436_100432692 Ga0075436_1004326922 176
336 3300009098 Ga0105245_10081905 Ga0105245_100819052 176
337 3300009147 Ga0114129_10085787 Ga0114129_100857872 176
338 3300009177 Ga0105248_10572491 Ga0105248_105724912 176
339 3300010375 Ga0105239_12125316 Ga0105239_121253161 176
340 3300013296 Ga0157374_10396425 Ga0157374_103964252 176
341 3300014969 Ga0157376_10215211 Ga0157376_102152112 176
342 3300024225 Ga0224572_1004051 Ga0224572_10040513 176
343 3300025903 Ga0207680_10034222 Ga0207680_100342222 176
344 3300025915 Ga0207693_10108189 Ga0207693_101081893 176
345 3300025920 Ga0207649_10422325 Ga0207649_104223252 176
346 3300025925 Ga0207650_10005544 Ga0207650_100055442 176
347 3300025927 Ga0207687_10269566 Ga0207687_102695662 176
348 3300025929 Ga0207664_10210796 Ga0207664_102107962 176
349 3300025931 Ga0207644_10007129 Ga0207644_100071292 176
350 3300025939 Ga0207665_11067924 Ga0207665_110679241 176
351 3300025940 Ga0207691_10264317 Ga0207691_102643172 176
352 3300025960 Ga0207651_10002667 Ga0207651_100026676 176
353 3300026075 Ga0207708_10776531 Ga0207708_107765312 176
354 3300031090 Ga0265760_10206260 Ga0265760_102062601 176
355 3300032005 Ga0307411_10704088 Ga0307411_107040882 176
356 3300037466 Ga0395898_0462021 Ga0395898_0462021_258_806 176
357 3300046472 Ga0495580_0385976 Ga0495580_0385976_244_792 176
358 3300046615 Ga0495656_0296732 Ga0495656_0296732_199_729 176
359 3300048903 Ga0496100_0093967 Ga0496100_0093967_678_1217 176
360 3300048904 Ga0496101_0347486 Ga0496101_0347486_202_741 176
361 3300048905 Ga0496102_0211968 Ga0496102_0211968_1063_1602 176
362 3300048907 Ga0496104_0529918 Ga0496104_0529918_523_1062 176
363 3300048911 Ga0496108_0062109 Ga0496108_0062109_1812_2351 176
364 3300048912 Ga0496109_0154622 Ga0496109_0154622_1411_1950 176
365 3300048915 Ga0496112_0017973 Ga0496112_0017973_2585_3124 176
366 3300048918 Ga0496115_0109730 Ga0496115_0109730_443_982 176
367 3300049585 Ga0501069_0149985 Ga0501069_0149985_243_794 176
368 3300050507 nmdc:mga05p37_119648_c1 nmdc:mga05p37_119648_c1_620_1162 176
369 3300050510 nmdc:mga06r32_96528_c1 nmdc:mga06r32_96528_c1_430_1005 176
370 3300050511 nmdc:mga08y16_98122_c1 nmdc:mga08y16_98122_c1_1687_2235 176
371 3300006844 Ga0075428_100079122 Ga0075428_1000791222 177
372 3300006846 Ga0075430_100014469 Ga0075430_1000144695 177
373 3300006847 Ga0075431_100065054 Ga0075431_1000650543 177
374 3300006880 Ga0075429_100075491 Ga0075429_1000754912 177
375 3300009147 Ga0114129_10057918 Ga0114129_100579184 177
376 3300039437 Ga0436365_0861925 Ga0436365_0861925_945_1481 177
377 3300050509 nmdc:mga0qj67_129176_c1 nmdc:mga0qj67_129176_c1_34_606 177
378 3300050510 nmdc:mga06r32_57410_c1 nmdc:mga06r32_57410_c1_1218_1790 177
379 3300005937 Ga0081455_10155489 Ga0081455_101554892 178
380 3300060353 Ga0501082_1414054 Ga0501082_1414054_10_552 178
381 3300005985 Ga0081539_10127693 Ga0081539_101276932 179
382 3300006844 Ga0075428_100365810 Ga0075428_1003658102 179
383 3300048904 Ga0496101_0065397 Ga0496101_0065397_1828_2370 179
384 3300048905 Ga0496102_0218287 Ga0496102_0218287_361_903 179
385 3300048907 Ga0496104_0165830 Ga0496104_0165830_498_1040 179
386 3300048908 Ga0496105_0014065 Ga0496105_0014065_2004_2546 179
387 3300048909 Ga0496106_0088290 Ga0496106_0088290_1216_1758 179
388 3300048911 Ga0496108_0079229 Ga0496108_0079229_2180_2722 179
389 3300048912 Ga0496109_0041456 Ga0496109_0041456_3437_3979 179
390 3300048917 Ga0496114_0211910 Ga0496114_0211910_851_1393 179
391 3300048918 Ga0496115_0109006 Ga0496115_0109006_447_989 179
392 3300005468 Ga0070707_100659487 Ga0070707_1006594872 180
393 3300005471 Ga0070698_100311306 Ga0070698_1003113062 180
394 3300005471 Ga0070698_100321261 Ga0070698_1003212611 180
395 3300006028 Ga0070717_10568292 Ga0070717_105682922 180
396 3300006038 Ga0075365_10005277 Ga0075365_100052773 180
397 3300006038 Ga0075365_10021240 Ga0075365_100212403 180
398 3300006038 Ga0075365_10067871 Ga0075365_100678713 180
399 3300006177 Ga0075362_10013822 Ga0075362_100138222 180
400 3300006178 Ga0075367_10166876 Ga0075367_101668763 180
401 3300006178 Ga0075367_10247500 Ga0075367_102475002 180
402 3300006844 Ga0075428_100208080 Ga0075428_1002080802 180
403 3300006847 Ga0075431_100054344 Ga0075431_1000543442 180
404 3300010159 Ga0099796_10049027 Ga0099796_100490272 180
405 3300013296 Ga0157374_10344496 Ga0157374_103444963 180
406 3300048913 Ga0496110_0103118 Ga0496110_0103118_921_1496 180
407 3300048914 Ga0496111_0789668 Ga0496111_0789668_98_673 180
408 3300049575 Ga0501039_0421149 Ga0501039_0421149_98_643 180
409 3300050492 nmdc:mga0yw44_138296_c1 nmdc:mga0yw44_138296_c1_473_1030 180
410 3300050492 nmdc:mga0yw44_84092_c1 nmdc:mga0yw44_84092_c1_79_621 180
411 3300050494 nmdc:mga06z11_190051_c1 nmdc:mga06z11_190051_c1_316_858 180
412 3300050494 nmdc:mga06z11_327969_c1 nmdc:mga06z11_327969_c1_96_638 180
413 3300050496 nmdc:mga07m45_287092_c1 nmdc:mga07m45_287092_c1_45_587 180
414 3300006175 Ga0070712_100216717 Ga0070712_1002167172 181
415 3300025915 Ga0207693_10289271 Ga0207693_102892712 181
416 3300001976 JGI24752J21851_1019655 JGI24752J21851_10196552 182
417 3300002070 JGI24750J21931_1001978 JGI24750J21931_10019783 182
418 3300002077 JGI24744J21845_10034474 JGI24744J21845_100344742 182
419 3300002244 JGI24742J22300_10003043 JGI24742J22300_100030433 182
420 3300005328 Ga0070676_10108049 Ga0070676_101080492 182
421 3300005329 Ga0070683_100030265 Ga0070683_1000302654 182
422 3300005330 Ga0070690_100046379 Ga0070690_1000463792 182
423 3300005331 Ga0070670_100120832 Ga0070670_1001208322 182
424 3300005337 Ga0070682_100475469 Ga0070682_1004754692 182
425 3300005338 Ga0068868_100061110 Ga0068868_1000611103 182
426 3300005340 Ga0070689_100114138 Ga0070689_1001141382 182
427 3300005344 Ga0070661_100120477 Ga0070661_1001204773 182
428 3300005345 Ga0070692_10087939 Ga0070692_100879392 182
429 3300005347 Ga0070668_100076385 Ga0070668_1000763852 182
430 3300005353 Ga0070669_100045369 Ga0070669_1000453692 182
431 3300005354 Ga0070675_100094996 Ga0070675_1000949963 182
432 3300005354 Ga0070675_100375806 Ga0070675_1003758062 182
433 3300005355 Ga0070671_100023958 Ga0070671_1000239584 182
434 3300005356 Ga0070674_100058076 Ga0070674_1000580762 182
435 3300005364 Ga0070673_100136315 Ga0070673_1001363153 182
436 3300005364 Ga0070673_100159417 Ga0070673_1001594172 182
437 3300005365 Ga0070688_100042693 Ga0070688_1000426932 182
438 3300005367 Ga0070667_100348764 Ga0070667_1003487642 182
439 3300005435 Ga0070714_100050724 Ga0070714_1000507243 182
440 3300005436 Ga0070713_100031727 Ga0070713_1000317272 182
441 3300005436 Ga0070713_100364117 Ga0070713_1003641172 182
442 3300005439 Ga0070711_100040555 Ga0070711_1000405553 182
443 3300005441 Ga0070700_100021470 Ga0070700_1000214703 182
444 3300005445 Ga0070708_101447880 Ga0070708_1014478801 182
445 3300005456 Ga0070678_100162597 Ga0070678_1001625972 182
446 3300005457 Ga0070662_100130996 Ga0070662_1001309961 182
447 3300005458 Ga0070681_10563689 Ga0070681_105636891 182
448 3300005459 Ga0068867_100055798 Ga0068867_1000557981 182
449 3300005471 Ga0070698_100479724 Ga0070698_1004797241 182
450 3300005518 Ga0070699_100464878 Ga0070699_1004648781 182
451 3300005535 Ga0070684_100077477 Ga0070684_1000774773 182
452 3300005539 Ga0068853_100104501 Ga0068853_1001045012 182
453 3300005543 Ga0070672_100017904 Ga0070672_1000179044 182
454 3300005544 Ga0070686_100020737 Ga0070686_1000207374 182
455 3300005546 Ga0070696_100198683 Ga0070696_1001986832 182
456 3300005548 Ga0070665_100118422 Ga0070665_1001184222 182
457 3300005563 Ga0068855_100260698 Ga0068855_1002606982 182
458 3300005564 Ga0070664_100158856 Ga0070664_1001588562 182
459 3300005578 Ga0068854_100359210 Ga0068854_1003592102 182
460 3300005615 Ga0070702_100038949 Ga0070702_1000389492 182
461 3300005616 Ga0068852_100069202 Ga0068852_1000692023 182
462 3300005617 Ga0068859_100108026 Ga0068859_1001080263 182
463 3300005618 Ga0068864_100184046 Ga0068864_1001840462 182
464 3300005718 Ga0068866_10034411 Ga0068866_100344113 182
465 3300005719 Ga0068861_100053204 Ga0068861_1000532043 182
466 3300005840 Ga0068870_10008986 Ga0068870_100089862 182
467 3300005841 Ga0068863_100107060 Ga0068863_1001070602 182
468 3300005842 Ga0068858_100033133 Ga0068858_1000331335 182
469 3300005843 Ga0068860_100079778 Ga0068860_1000797782 182
470 3300005844 Ga0068862_100044328 Ga0068862_1000443284 182
471 3300005937 Ga0081455_10196255 Ga0081455_101962551 182
472 3300005983 Ga0081540_1007964 Ga0081540_10079644 182
473 3300006028 Ga0070717_10075127 Ga0070717_100751271 182
474 3300006038 Ga0075365_10130672 Ga0075365_101306722 182
475 3300006163 Ga0070715_10003065 Ga0070715_100030654 182
476 3300006173 Ga0070716_100229831 Ga0070716_1002298312 182
477 3300006237 Ga0097621_100090043 Ga0097621_1000900433 182
478 3300006358 Ga0068871_100174461 Ga0068871_1001744613 182
479 3300006844 Ga0075428_100005580 Ga0075428_1000055807 182
480 3300006847 Ga0075431_100272313 Ga0075431_1002723133 182
481 3300006847 Ga0075431_100985753 Ga0075431_1009857532 182
482 3300006871 Ga0075434_100015883 Ga0075434_1000158837 182
483 3300006881 Ga0068865_100050171 Ga0068865_1000501712 182
484 3300006914 Ga0075436_100099569 Ga0075436_1000995692 182
485 3300006914 Ga0075436_100379075 Ga0075436_1003790752 182
486 3300006931 Ga0097620_100108031 Ga0097620_1001080313 182
487 3300007076 Ga0075435_100212545 Ga0075435_1002125452 182
488 3300007076 Ga0075435_100593983 Ga0075435_1005939832 182
489 3300007265 Ga0099794_10075565 Ga0099794_100755652 182
490 3300009094 Ga0111539_11482029 Ga0111539_114820292 182
491 3300009147 Ga0114129_10268007 Ga0114129_102680072 182
492 3300013306 Ga0163162_10765115 Ga0163162_107651152 182
493 3300017792 Ga0163161_10175555 Ga0163161_101755552 182
494 3300025315 Ga0207697_10052539 Ga0207697_100525393 182
495 3300025321 Ga0207656_10035880 Ga0207656_100358803 182
496 3300025901 Ga0207688_10002481 Ga0207688_100024815 182
497 3300025903 Ga0207680_10202603 Ga0207680_102026032 182
498 3300025907 Ga0207645_10009079 Ga0207645_100090792 182
499 3300025908 Ga0207643_10010475 Ga0207643_100104754 182
500 3300025911 Ga0207654_10201254 Ga0207654_102012542 182
501 3300025914 Ga0207671_10056891 Ga0207671_100568912 182
502 3300025915 Ga0207693_10018047 Ga0207693_100180472 182
503 3300025915 Ga0207693_10019443 Ga0207693_100194433 182
504 3300025915 Ga0207693_10054732 Ga0207693_100547323 182
505 3300025916 Ga0207663_10067641 Ga0207663_100676413 182
506 3300025918 Ga0207662_10010556 Ga0207662_100105562 182
507 3300025919 Ga0207657_10035303 Ga0207657_100353034 182
508 3300025920 Ga0207649_10071654 Ga0207649_100716543 182
509 3300025925 Ga0207650_10004077 Ga0207650_100040778 182
510 3300025926 Ga0207659_10300450 Ga0207659_103004502 182
511 3300025927 Ga0207687_10200921 Ga0207687_102009212 182
512 3300025928 Ga0207700_10309016 Ga0207700_103090162 182
513 3300025928 Ga0207700_10366074 Ga0207700_103660741 182
514 3300025931 Ga0207644_10137532 Ga0207644_101375323 182
515 3300025932 Ga0207690_10222037 Ga0207690_102220372 182
516 3300025932 Ga0207690_10224390 Ga0207690_102243902 182
517 3300025933 Ga0207706_10014540 Ga0207706_100145402 182
518 3300025934 Ga0207686_10125170 Ga0207686_101251702 182
519 3300025935 Ga0207709_10301907 Ga0207709_103019072 182
520 3300025936 Ga0207670_10450573 Ga0207670_104505731 182
521 3300025936 Ga0207670_10530357 Ga0207670_105303572 182
522 3300025937 Ga0207669_10110399 Ga0207669_101103992 182
523 3300025938 Ga0207704_10107147 Ga0207704_101071472 182
524 3300025939 Ga0207665_10001380 Ga0207665_100013805 182
525 3300025940 Ga0207691_10003955 Ga0207691_100039559 182
526 3300025941 Ga0207711_10227592 Ga0207711_102275922 182
527 3300025942 Ga0207689_10027088 Ga0207689_100270882 182
528 3300025944 Ga0207661_10163673 Ga0207661_101636732 182
529 3300025945 Ga0207679_10111382 Ga0207679_101113822 182
530 3300025960 Ga0207651_10101366 Ga0207651_101013662 182
531 3300025961 Ga0207712_10071332 Ga0207712_100713323 182
532 3300025972 Ga0207668_10055888 Ga0207668_100558882 182
533 3300025972 Ga0207668_10595242 Ga0207668_105952422 182
534 3300025981 Ga0207640_10050588 Ga0207640_100505882 182
535 3300026023 Ga0207677_10252401 Ga0207677_102524012 182
536 3300026035 Ga0207703_11014702 Ga0207703_110147022 182
537 3300026067 Ga0207678_10021417 Ga0207678_100214172 182
538 3300026075 Ga0207708_10005365 Ga0207708_100053655 182
539 3300026089 Ga0207648_10011418 Ga0207648_100114184 182
540 3300026095 Ga0207676_10135032 Ga0207676_101350323 182
541 3300026118 Ga0207675_100008064 Ga0207675_1000080645 182
542 3300026121 Ga0207683_10064788 Ga0207683_100647883 182
543 3300026142 Ga0207698_10283235 Ga0207698_102832352 182
544 3300027907 Ga0207428_10333773 Ga0207428_103337732 182
545 3300028379 Ga0268266_11356995 Ga0268266_113569952 182
546 3300028380 Ga0268265_10216840 Ga0268265_102168403 182
547 3300028381 Ga0268264_10154036 Ga0268264_101540363 182
548 3300038443 Ga0395901_1102196 Ga0395901_1102196_22_585 182
549 3300039447 Ga0436361_0555100 Ga0436361_0555100_1248_1802 182
550 3300048903 Ga0496100_0048861 Ga0496100_0048861_2145_2696 182
551 3300048903 Ga0496100_0789860 Ga0496100_0789860_77_628 182
552 3300048904 Ga0496101_0091551 Ga0496101_0091551_1230_1781 182
553 3300048905 Ga0496102_0181998 Ga0496102_0181998_860_1411 182
554 3300048907 Ga0496104_0075910 Ga0496104_0075910_1270_1821 182
555 3300048908 Ga0496105_0027183 Ga0496105_0027183_905_1456 182
556 3300048908 Ga0496105_0820982 Ga0496105_0820982_107_658 182
557 3300048909 Ga0496106_0118723 Ga0496106_0118723_1445_1996 182
558 3300048910 Ga0496107_0022278 Ga0496107_0022278_2169_2720 182
559 3300048910 Ga0496107_0120440 Ga0496107_0120440_1059_1610 182
560 3300048911 Ga0496108_0029188 Ga0496108_0029188_2727_3278 182
561 3300048912 Ga0496109_0020360 Ga0496109_0020360_3801_4352 182
562 3300048913 Ga0496110_0031616 Ga0496110_0031616_2727_3278 182
563 3300048914 Ga0496111_0003120 Ga0496111_0003120_7340_7891 182
564 3300048914 Ga0496111_0174392 Ga0496111_0174392_454_1008 182
565 3300048915 Ga0496112_0016600 Ga0496112_0016600_2551_3102 182
566 3300048915 Ga0496112_0716776 Ga0496112_0716776_87_638 182
567 3300048915 Ga0496112_1037394 Ga0496112_1037394_95_649 182
568 3300048916 Ga0496113_0001270 Ga0496113_0001270_2486_3037 182
569 3300048918 Ga0496115_0190094 Ga0496115_0190094_408_959 182
570 3300050510 nmdc:mga06r32_958259_c1 nmdc:mga06r32_958259_c1_96_647 182
571 3300050511 nmdc:mga08y16_293005_c1 nmdc:mga08y16_293005_c1_1054_1605 182
572 3300050512 nmdc:mga0n895_33053_c1 nmdc:mga0n895_33053_c1_3473_4024 182
573 3300050512 nmdc:mga0n895_427962_c1 nmdc:mga0n895_427962_c1_103_654 182
574 3300050515 nmdc:mga0a205_319649_c1 nmdc:mga0a205_319649_c1_159_713 182
575 3300053083 Ga0495655_0012017 Ga0495655_0012017_412_960 182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01252

Peptidase_A8

Signal peptidase (SPase) II

52

198

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zx8-assembly1.cif.gz_c structure of snapc containing pol ii pre-initiation complex bound to u1 snrna promoter (oc) 0.9285 84 131
6ryp-assembly1.cif.gz_A bacterial membrane enzyme structure by the in meso method at 2.3 a resolution 0.8632 23 173
6ryo-assembly1.cif.gz_A bacterial membrane enzyme structure by the in meso method at 1.9 a resolution 0.8376 23 175
6fms-assembly2.cif.gz_B imisx-ep of se-lspa 0.8328 22 169
5dir-assembly4.cif.gz_D membrane protein at 2.8 angstroms 0.831 25 171
ID Description Score Start End Superfamily
af_P00804_15_157_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.9139 29 174 3.90.1420.10
af_P00804_15_157_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.9018 29 174 3.90.1420.10
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8378 29 173 3.90.1420.10
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8215 29 173 3.90.1420.10
af_P9WK99_39_178_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8097 29 173 3.90.1420.10
ID Description Score Start End GO Terms
AF-A0A1H2E9T9-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9843 16 172 GO:0004190
GO:0005886
GO:0006508
AF-A0A2D8RYR1-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9815 16 174 GO:0004190
GO:0005886
GO:0006508
AF-B8IB41-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9679 22 173 GO:0004190
GO:0005886
GO:0006508
AF-A0A5E4NZU5-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.967 22 176 GO:0004190
GO:0005886
GO:0006508
AF-A0A2E5BNL6-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9655 11 178 GO:0004190
GO:0005886
GO:0006508

Feature Viewer

pLDDT pTM Quality
87.13 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map