F465388
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 575 | 316 | 574 | 176 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10067871|Ga0075365_100678713 |
| Length | 206 |
| Sequence | MGPRLRGDDSPEATDSKRHSAMSTDSKQLAPAPSGRVASLLWGPLTPFALAIALAAAALDQASKLYLLYVFDLGARGIVPLAPFVDLVLTWNTGISYGLFRQEGALWQWALLALKAIAVILLWIWLSRTVSRLTAASLGLIIGGALGNGIDRFVHGAVADFVLLHLTTASFSFRWYVFNLADVAIVAGVIGLLYETLFDRGAAKAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 112 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 168 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 171 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 172 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 173 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 180 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 193 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 194 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 195 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 265 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 271 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 295 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 296 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 297 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 298 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 299 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 300 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 314 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.65 |
| Metatranscriptomes | 0.17 |
| Isolates | 0.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.52 |
| Nodule | 0 |
| Rhizoplane | 14.09 |
| Rhizosphere | 80.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1019655 | 3300001976 | Bacteria | 881 |
| 2 | JGI24750J21931_1001978 | 3300002070 | Bacteria | 2503 |
| 3 | JGI24744J21845_10034474 | 3300002077 | Bacteria | 960 |
| 4 | JGI24742J22300_10003043 | 3300002244 | Bacteria | 2716 |
| 5 | JGI25405J52794_10011756 | 3300003911 | Unclassified | 1678 |
| 6 | Ga0070676_10108049 | 3300005328 | Bacteria | 1728 |
| 7 | Ga0070683_100030265 | 3300005329 | Bacteria | 4911 |
| 8 | Ga0070690_100046379 | 3300005330 | Bacteria | 2762 |
| 9 | Ga0070670_100120832 | 3300005331 | Bacteria | 2260 |
| 10 | Ga0070682_100475469 | 3300005337 | Bacteria | 962 |
| 11 | Ga0068868_100061110 | 3300005338 | Bacteria | 2984 |
| 12 | Ga0070689_100031016 | 3300005340 | Bacteria | 4061 |
| 13 | Ga0070689_100114138 | 3300005340 | Bacteria | 2152 |
| 14 | Ga0070691_10008865 | 3300005341 | Bacteria | 4605 |
| 15 | Ga0070661_100120477 | 3300005344 | Bacteria | 1965 |
| 16 | Ga0070661_100408336 | 3300005344 | Bacteria | 1075 |
| 17 | Ga0070692_10087939 | 3300005345 | Bacteria | 1684 |
| 18 | Ga0070668_100076385 | 3300005347 | Bacteria | 2616 |
| 19 | Ga0070669_100045369 | 3300005353 | Bacteria | 3203 |
| 20 | Ga0070675_100094996 | 3300005354 | Bacteria | 2502 |
| 21 | Ga0070675_100375806 | 3300005354 | Bacteria | 1264 |
| 22 | Ga0070671_100008828 | 3300005355 | Bacteria | 8089 |
| 23 | Ga0070671_100023958 | 3300005355 | Bacteria | 4994 |
| 24 | Ga0070671_100272998 | 3300005355 | Bacteria | 1437 |
| 25 | Ga0070674_100058076 | 3300005356 | Bacteria | 2688 |
| 26 | Ga0070674_100978712 | 3300005356 | Bacteria | 741 |
| 27 | Ga0070673_100001201 | 3300005364 | Bacteria | 14931 |
| 28 | Ga0070673_100136315 | 3300005364 | Bacteria | 2066 |
| 29 | Ga0070673_100159417 | 3300005364 | Bacteria | 1918 |
| 30 | Ga0070688_100042693 | 3300005365 | Bacteria | 2790 |
| 31 | Ga0070688_100168370 | 3300005365 | Bacteria | 1510 |
| 32 | Ga0070688_100877494 | 3300005365 | Bacteria | 706 |
| 33 | Ga0070659_100676763 | 3300005366 | Bacteria | 891 |
| 34 | Ga0070667_100348764 | 3300005367 | Bacteria | 1340 |
| 35 | Ga0070667_100792091 | 3300005367 | Bacteria | 880 |
| 36 | Ga0070709_10060095 | 3300005434 | Bacteria | 2415 |
| 37 | Ga0070714_100050724 | 3300005435 | Bacteria | 3536 |
| 38 | Ga0070714_100219268 | 3300005435 | Bacteria | 1748 |
| 39 | Ga0070714_100313601 | 3300005435 | Bacteria | 1465 |
| 40 | Ga0070713_100031727 | 3300005436 | Bacteria | 4211 |
| 41 | Ga0070713_100364117 | 3300005436 | Bacteria | 1344 |
| 42 | Ga0070713_100435279 | 3300005436 | Unclassified | 1229 |
| 43 | Ga0070701_10044646 | 3300005438 | Bacteria | 2271 |
| 44 | Ga0070701_10528622 | 3300005438 | Bacteria | 770 |
| 45 | Ga0070711_100013397 | 3300005439 | Bacteria | 5150 |
| 46 | Ga0070711_100040555 | 3300005439 | Bacteria | 3140 |
| 47 | Ga0070700_100021470 | 3300005441 | Bacteria | 3753 |
| 48 | Ga0070700_100264459 | 3300005441 | Bacteria | 1240 |
| 49 | Ga0070700_100295107 | 3300005441 | Bacteria | 1181 |
| 50 | Ga0070708_101447880 | 3300005445 | Bacteria | 640 |
| 51 | Ga0070678_100162597 | 3300005456 | Bacteria | 1810 |
| 52 | Ga0070662_100130996 | 3300005457 | Bacteria | 1933 |
| 53 | Ga0070681_10563689 | 3300005458 | Bacteria | 1053 |
| 54 | Ga0070681_10917930 | 3300005458 | Bacteria | 794 |
| 55 | Ga0068867_100055798 | 3300005459 | Bacteria | 2921 |
| 56 | Ga0070707_100659487 | 3300005468 | Bacteria | 1009 |
| 57 | Ga0070698_100311306 | 3300005471 | Bacteria | 1505 |
| 58 | Ga0070698_100321261 | 3300005471 | Bacteria | 1479 |
| 59 | Ga0070698_100479724 | 3300005471 | Bacteria | 1180 |
| 60 | Ga0070699_100010912 | 3300005518 | Bacteria | 7857 |
| 61 | Ga0070699_100464878 | 3300005518 | Bacteria | 1147 |
| 62 | Ga0070679_100437527 | 3300005530 | Bacteria | 1253 |
| 63 | Ga0070679_100651291 | 3300005530 | Bacteria | 996 |
| 64 | Ga0070684_100077477 | 3300005535 | Bacteria | 2936 |
| 65 | Ga0068853_100104501 | 3300005539 | Bacteria | 2508 |
| 66 | Ga0070672_100017904 | 3300005543 | Bacteria | 5109 |
| 67 | Ga0070672_100474338 | 3300005543 | Bacteria | 1080 |
| 68 | Ga0070686_100020737 | 3300005544 | Bacteria | 3893 |
| 69 | Ga0070696_100198683 | 3300005546 | Bacteria | 1496 |
| 70 | Ga0070696_100506865 | 3300005546 | Unclassified | 961 |
| 71 | Ga0070665_100022370 | 3300005548 | Bacteria | 6363 |
| 72 | Ga0070665_100118422 | 3300005548 | Bacteria | 2650 |
| 73 | Ga0070704_100048398 | 3300005549 | Bacteria | 2976 |
| 74 | Ga0068855_100260698 | 3300005563 | Bacteria | 1931 |
| 75 | Ga0070664_100066665 | 3300005564 | Bacteria | 3074 |
| 76 | Ga0070664_100158856 | 3300005564 | Bacteria | 1999 |
| 77 | Ga0068854_100359210 | 3300005578 | Bacteria | 1195 |
| 78 | Ga0068854_100641043 | 3300005578 | Bacteria | 911 |
| 79 | Ga0070702_100038949 | 3300005615 | Bacteria | 2650 |
| 80 | Ga0068852_100069202 | 3300005616 | Bacteria | 3093 |
| 81 | Ga0068859_100108026 | 3300005617 | Bacteria | 2843 |
| 82 | Ga0068864_100184046 | 3300005618 | Bacteria | 1911 |
| 83 | Ga0068866_10034411 | 3300005718 | Bacteria | 2467 |
| 84 | Ga0068861_100053204 | 3300005719 | Bacteria | 3079 |
| 85 | Ga0068870_10008986 | 3300005840 | Bacteria | 4520 |
| 86 | Ga0068863_100107060 | 3300005841 | Bacteria | 2660 |
| 87 | Ga0068858_100033133 | 3300005842 | Bacteria | 4797 |
| 88 | Ga0068858_100240948 | 3300005842 | Bacteria | 1716 |
| 89 | Ga0068860_100079778 | 3300005843 | Bacteria | 3112 |
| 90 | Ga0068862_100044328 | 3300005844 | Bacteria | 3793 |
| 91 | Ga0081455_10004266 | 3300005937 | Bacteria | 16108 |
| 92 | Ga0081455_10004590 | 3300005937 | Bacteria | 15425 |
| 93 | Ga0081455_10098018 | 3300005937 | Bacteria | 2361 |
| 94 | Ga0081455_10155489 | 3300005937 | Bacteria | 1758 |
| 95 | Ga0081455_10196255 | 3300005937 | Bacteria | 1516 |
| 96 | Ga0081540_1007964 | 3300005983 | Bacteria | 7467 |
| 97 | Ga0081540_1051353 | 3300005983 | Bacteria | 2039 |
| 98 | Ga0081539_10127693 | 3300005985 | Bacteria | 1253 |
| 99 | Ga0070717_10075127 | 3300006028 | Bacteria | 2826 |
| 100 | Ga0070717_10089423 | 3300006028 | Bacteria | 2597 |
| 101 | Ga0070717_10443878 | 3300006028 | Bacteria | 1169 |
| 102 | Ga0070717_10568292 | 3300006028 | Bacteria | 1028 |
| 103 | Ga0075365_10005277 | 3300006038 | Bacteria | 6952 |
| 104 | Ga0075365_10021240 | 3300006038 | Bacteria | 4046 |
| 105 | Ga0075365_10067871 | 3300006038 | Bacteria | 2395 |
| 106 | Ga0075365_10102285 | 3300006038 | Bacteria | 1963 |
| 107 | Ga0075365_10130672 | 3300006038 | Bacteria | 1738 |
| 108 | Ga0075365_10140488 | 3300006038 | Bacteria | 1676 |
| 109 | Ga0075364_10206526 | 3300006051 | Bacteria | 1332 |
| 110 | Ga0075364_10711855 | 3300006051 | Bacteria | 685 |
| 111 | Ga0075432_10002319 | 3300006058 | Bacteria | 6331 |
| 112 | Ga0070715_10003065 | 3300006163 | Bacteria | 5241 |
| 113 | Ga0070715_10223736 | 3300006163 | Bacteria | 969 |
| 114 | Ga0070716_100229831 | 3300006173 | Bacteria | 1251 |
| 115 | Ga0070712_100136840 | 3300006175 | Bacteria | 1864 |
| 116 | Ga0070712_100216717 | 3300006175 | Bacteria | 1513 |
| 117 | Ga0075362_10013822 | 3300006177 | Bacteria | 3241 |
| 118 | Ga0075367_10166876 | 3300006178 | Bacteria | 1370 |
| 119 | Ga0075367_10247500 | 3300006178 | Bacteria | 1118 |
| 120 | Ga0075427_10004166 | 3300006194 | Bacteria | 2019 |
| 121 | Ga0097621_100090043 | 3300006237 | Bacteria | 2566 |
| 122 | Ga0068871_100174461 | 3300006358 | Bacteria | 1845 |
| 123 | Ga0075428_100005580 | 3300006844 | Bacteria | 13980 |
| 124 | Ga0075428_100079122 | 3300006844 | Bacteria | 3588 |
| 125 | Ga0075428_100208080 | 3300006844 | Bacteria | 2114 |
| 126 | Ga0075428_100293518 | 3300006844 | Bacteria | 1748 |
| 127 | Ga0075428_100365810 | 3300006844 | Bacteria | 1547 |
| 128 | Ga0075428_101073147 | 3300006844 | Bacteria | 851 |
| 129 | Ga0075430_100000128 | 3300006846 | Bacteria | 47770 |
| 130 | Ga0075430_100014469 | 3300006846 | Bacteria | 6721 |
| 131 | Ga0075430_100557919 | 3300006846 | Bacteria | 945 |
| 132 | Ga0075431_100001558 | 3300006847 | Bacteria | 21282 |
| 133 | Ga0075431_100054344 | 3300006847 | Bacteria | 4129 |
| 134 | Ga0075431_100065054 | 3300006847 | Bacteria | 3765 |
| 135 | Ga0075431_100272313 | 3300006847 | Bacteria | 1715 |
| 136 | Ga0075431_100985753 | 3300006847 | Bacteria | 810 |
| 137 | Ga0075433_10000103 | 3300006852 | Bacteria | 41320 |
| 138 | Ga0075433_10941705 | 3300006852 | Bacteria | 753 |
| 139 | Ga0075434_100001533 | 3300006871 | Bacteria | 19536 |
| 140 | Ga0075434_100015883 | 3300006871 | Bacteria | 7229 |
| 141 | Ga0075434_100020416 | 3300006871 | Bacteria | 6426 |
| 142 | Ga0075434_100284869 | 3300006871 | Bacteria | 1672 |
| 143 | Ga0075429_100000381 | 3300006880 | Bacteria | 32664 |
| 144 | Ga0075429_100075491 | 3300006880 | Bacteria | 2936 |
| 145 | Ga0068865_100050171 | 3300006881 | Bacteria | 2881 |
| 146 | Ga0068865_101230371 | 3300006881 | Bacteria | 664 |
| 147 | Ga0075436_100004204 | 3300006914 | Bacteria | 9880 |
| 148 | Ga0075436_100099569 | 3300006914 | Bacteria | 2024 |
| 149 | Ga0075436_100379075 | 3300006914 | Bacteria | 1023 |
| 150 | Ga0075436_100432692 | 3300006914 | Bacteria | 956 |
| 151 | Ga0097620_100108031 | 3300006931 | Bacteria | 2843 |
| 152 | Ga0075435_100015585 | 3300007076 | Bacteria | 5718 |
| 153 | Ga0075435_100048649 | 3300007076 | Bacteria | 3407 |
| 154 | Ga0075435_100212545 | 3300007076 | Bacteria | 1641 |
| 155 | Ga0075435_100593983 | 3300007076 | Bacteria | 960 |
| 156 | Ga0099794_10075565 | 3300007265 | Bacteria | 1656 |
| 157 | Ga0099794_10137556 | 3300007265 | Bacteria | 1236 |
| 158 | Ga0111539_10000787 | 3300009094 | Bacteria | 41244 |
| 159 | Ga0111539_10072403 | 3300009094 | Bacteria | 4064 |
| 160 | Ga0111539_10173997 | 3300009094 | Bacteria | 2515 |
| 161 | Ga0111539_10198645 | 3300009094 | Bacteria | 2339 |
| 162 | Ga0111539_10258403 | 3300009094 | Bacteria | 2028 |
| 163 | Ga0111539_11028824 | 3300009094 | Bacteria | 957 |
| 164 | Ga0111539_11482029 | 3300009094 | Bacteria | 787 |
| 165 | Ga0105245_10081905 | 3300009098 | Bacteria | 2951 |
| 166 | Ga0105245_11144545 | 3300009098 | Bacteria | 825 |
| 167 | Ga0105247_10065550 | 3300009101 | Bacteria | 2260 |
| 168 | Ga0114129_10003834 | 3300009147 | Bacteria | 21189 |
| 169 | Ga0114129_10017332 | 3300009147 | Bacteria | 10253 |
| 170 | Ga0114129_10021956 | 3300009147 | Bacteria | 9057 |
| 171 | Ga0114129_10057918 | 3300009147 | Bacteria | 5421 |
| 172 | Ga0114129_10085787 | 3300009147 | Bacteria | 4368 |
| 173 | Ga0114129_10268007 | 3300009147 | Bacteria | 2286 |
| 174 | Ga0105243_10161067 | 3300009148 | Bacteria | 1934 |
| 175 | Ga0105241_10256604 | 3300009174 | Bacteria | 1484 |
| 176 | Ga0105242_10049535 | 3300009176 | Bacteria | 3419 |
| 177 | Ga0105248_10139518 | 3300009177 | Bacteria | 2734 |
| 178 | Ga0105248_10572491 | 3300009177 | Bacteria | 1274 |
| 179 | Ga0105237_10243985 | 3300009545 | Bacteria | 1798 |
| 180 | Ga0105238_10727408 | 3300009551 | Bacteria | 1005 |
| 181 | Ga0105238_10886466 | 3300009551 | Bacteria | 910 |
| 182 | Ga0105249_10172755 | 3300009553 | Bacteria | 2097 |
| 183 | Ga0099796_10049027 | 3300010159 | Bacteria | 1459 |
| 184 | Ga0105239_10149726 | 3300010375 | Bacteria | 2604 |
| 185 | Ga0105239_10166891 | 3300010375 | Bacteria | 2462 |
| 186 | Ga0105239_12125316 | 3300010375 | Bacteria | 652 |
| 187 | Ga0157374_10344496 | 3300013296 | Bacteria | 1480 |
| 188 | Ga0157374_10396425 | 3300013296 | Bacteria | 1376 |
| 189 | Ga0157378_10187589 | 3300013297 | Bacteria | 1948 |
| 190 | Ga0157378_10339891 | 3300013297 | Bacteria | 1463 |
| 191 | Ga0163162_10162965 | 3300013306 | Bacteria | 2352 |
| 192 | Ga0163162_10765115 | 3300013306 | Bacteria | 1084 |
| 193 | Ga0163162_10938990 | 3300013306 | Bacteria | 977 |
| 194 | Ga0157375_10187602 | 3300013308 | Bacteria | 2222 |
| 195 | Ga0157375_10486483 | 3300013308 | Bacteria | 1399 |
| 196 | Ga0163163_10269307 | 3300014325 | Bacteria | 1754 |
| 197 | Ga0163163_10797003 | 3300014325 | Bacteria | 1008 |
| 198 | Ga0157380_10919791 | 3300014326 | Bacteria | 902 |
| 199 | Ga0157379_10335397 | 3300014968 | Bacteria | 1382 |
| 200 | Ga0157376_10215211 | 3300014969 | Bacteria | 1776 |
| 201 | Ga0157376_10976052 | 3300014969 | Bacteria | 869 |
| 202 | Ga0163161_10175555 | 3300017792 | Bacteria | 1640 |
| 203 | Ga0213876_10339035 | 3300021384 | Bacteria | 799 |
| 204 | Ga0224572_1004051 | 3300024225 | Bacteria | 2522 |
| 205 | Ga0207697_10052539 | 3300025315 | Bacteria | 1686 |
| 206 | Ga0207656_10035880 | 3300025321 | Bacteria | 2079 |
| 207 | Ga0207688_10002481 | 3300025901 | Bacteria | 9928 |
| 208 | Ga0207680_10034222 | 3300025903 | Bacteria | 2905 |
| 209 | Ga0207680_10202603 | 3300025903 | Bacteria | 1353 |
| 210 | Ga0207680_10207022 | 3300025903 | Bacteria | 1339 |
| 211 | Ga0207647_10010563 | 3300025904 | Bacteria | 6516 |
| 212 | Ga0207645_10009079 | 3300025907 | Bacteria | 6900 |
| 213 | Ga0207643_10010475 | 3300025908 | Bacteria | 4994 |
| 214 | Ga0207654_10201254 | 3300025911 | Bacteria | 1311 |
| 215 | Ga0207707_10767285 | 3300025912 | Bacteria | 805 |
| 216 | Ga0207671_10056891 | 3300025914 | Bacteria | 2898 |
| 217 | Ga0207693_10018047 | 3300025915 | Bacteria | 5623 |
| 218 | Ga0207693_10019443 | 3300025915 | Bacteria | 5402 |
| 219 | Ga0207693_10054732 | 3300025915 | Bacteria | 3129 |
| 220 | Ga0207693_10108189 | 3300025915 | Bacteria | 2181 |
| 221 | Ga0207693_10289271 | 3300025915 | Bacteria | 1284 |
| 222 | Ga0207663_10067641 | 3300025916 | Bacteria | 2292 |
| 223 | Ga0207662_10010556 | 3300025918 | Bacteria | 5105 |
| 224 | Ga0207662_10433713 | 3300025918 | Bacteria | 896 |
| 225 | Ga0207657_10035303 | 3300025919 | Bacteria | 4485 |
| 226 | Ga0207649_10071654 | 3300025920 | Bacteria | 2214 |
| 227 | Ga0207649_10422325 | 3300025920 | Bacteria | 1001 |
| 228 | Ga0207652_10142594 | 3300025921 | Bacteria | 2143 |
| 229 | Ga0207650_10004077 | 3300025925 | Bacteria | 9987 |
| 230 | Ga0207650_10005544 | 3300025925 | Bacteria | 8614 |
| 231 | Ga0207659_10300450 | 3300025926 | Bacteria | 1318 |
| 232 | Ga0207659_10392468 | 3300025926 | Bacteria | 1159 |
| 233 | Ga0207687_10200921 | 3300025927 | Bacteria | 1558 |
| 234 | Ga0207687_10269566 | 3300025927 | Bacteria | 1360 |
| 235 | Ga0207700_10309016 | 3300025928 | Bacteria | 1367 |
| 236 | Ga0207700_10335519 | 3300025928 | Unclassified | 1313 |
| 237 | Ga0207700_10366074 | 3300025928 | Bacteria | 1258 |
| 238 | Ga0207664_10175105 | 3300025929 | Bacteria | 1839 |
| 239 | Ga0207664_10210796 | 3300025929 | Bacteria | 1681 |
| 240 | Ga0207644_10007129 | 3300025931 | Bacteria | 7285 |
| 241 | Ga0207644_10137532 | 3300025931 | Bacteria | 1877 |
| 242 | Ga0207690_10222037 | 3300025932 | Bacteria | 1446 |
| 243 | Ga0207690_10224390 | 3300025932 | Bacteria | 1439 |
| 244 | Ga0207706_10014540 | 3300025933 | Bacteria | 7132 |
| 245 | Ga0207686_10125170 | 3300025934 | Bacteria | 1755 |
| 246 | Ga0207709_10301907 | 3300025935 | Bacteria | 1191 |
| 247 | Ga0207670_10450573 | 3300025936 | Bacteria | 1037 |
| 248 | Ga0207670_10530357 | 3300025936 | Bacteria | 960 |
| 249 | Ga0207670_10715807 | 3300025936 | Bacteria | 830 |
| 250 | Ga0207669_10110399 | 3300025937 | Bacteria | 1841 |
| 251 | Ga0207704_10107147 | 3300025938 | Bacteria | 1879 |
| 252 | Ga0207665_10001380 | 3300025939 | Bacteria | 16365 |
| 253 | Ga0207665_11067924 | 3300025939 | Bacteria | 643 |
| 254 | Ga0207691_10003955 | 3300025940 | Bacteria | 14394 |
| 255 | Ga0207691_10264317 | 3300025940 | Bacteria | 1483 |
| 256 | Ga0207711_10227592 | 3300025941 | Bacteria | 1707 |
| 257 | Ga0207689_10027088 | 3300025942 | Bacteria | 4798 |
| 258 | Ga0207661_10163673 | 3300025944 | Bacteria | 1932 |
| 259 | Ga0207679_10111382 | 3300025945 | Bacteria | 2161 |
| 260 | Ga0207651_10002667 | 3300025960 | Bacteria | 8537 |
| 261 | Ga0207651_10101366 | 3300025960 | Bacteria | 2137 |
| 262 | Ga0207712_10071332 | 3300025961 | Bacteria | 2498 |
| 263 | Ga0207668_10055888 | 3300025972 | Bacteria | 2746 |
| 264 | Ga0207668_10595242 | 3300025972 | Bacteria | 963 |
| 265 | Ga0207640_10050588 | 3300025981 | Bacteria | 2697 |
| 266 | Ga0207640_10603050 | 3300025981 | Bacteria | 930 |
| 267 | Ga0207677_10252401 | 3300026023 | Bacteria | 1433 |
| 268 | Ga0207703_11014702 | 3300026035 | Bacteria | 796 |
| 269 | Ga0207703_11147909 | 3300026035 | Bacteria | 747 |
| 270 | Ga0207678_10021417 | 3300026067 | Bacteria | 5668 |
| 271 | Ga0207678_11462784 | 3300026067 | Bacteria | 603 |
| 272 | Ga0207708_10005365 | 3300026075 | Bacteria | 9446 |
| 273 | Ga0207708_10776531 | 3300026075 | Bacteria | 824 |
| 274 | Ga0207648_10011418 | 3300026089 | Bacteria | 8367 |
| 275 | Ga0207676_10135032 | 3300026095 | Bacteria | 2103 |
| 276 | Ga0207675_100008064 | 3300026118 | Bacteria | 9923 |
| 277 | Ga0207683_10064788 | 3300026121 | Bacteria | 3221 |
| 278 | Ga0207698_10283235 | 3300026142 | Bacteria | 1534 |
| 279 | Ga0209588_1010668 | 3300027671 | Bacteria | 2765 |
| 280 | Ga0207428_10000058 | 3300027907 | Bacteria | 158579 |
| 281 | Ga0207428_10333773 | 3300027907 | Bacteria | 1118 |
| 282 | Ga0268266_10209426 | 3300028379 | Bacteria | 1787 |
| 283 | Ga0268266_11356995 | 3300028379 | Bacteria | 686 |
| 284 | Ga0268265_10216840 | 3300028380 | Bacteria | 1671 |
| 285 | Ga0268264_10154036 | 3300028381 | Bacteria | 2063 |
| 286 | Ga0265338_10229544 | 3300028800 | Bacteria | 1381 |
| 287 | Ga0265760_10206260 | 3300031090 | Bacteria | 665 |
| 288 | Ga0265325_10002612 | 3300031241 | Bacteria | 12066 |
| 289 | Ga0265340_10052072 | 3300031247 | Bacteria | 1981 |
| 290 | Ga0265340_10094517 | 3300031247 | Bacteria | 1394 |
| 291 | Ga0265313_10031287 | 3300031595 | Bacteria | 2730 |
| 292 | Ga0307411_10704088 | 3300032005 | Bacteria | 880 |
| 293 | Ga0373926_0032423 | 3300035083 | Bacteria | 1843 |
| 294 | Ga0373929_0181865 | 3300035085 | Bacteria | 580 |
| 295 | Ga0373944_0017853 | 3300035089 | Bacteria | 2019 |
| 296 | Ga0373923_0000898 | 3300035111 | Bacteria | 7929 |
| 297 | Ga0373936_0009843 | 3300035113 | Bacteria | 3608 |
| 298 | Ga0373945_0007874 | 3300035116 | Bacteria | 3457 |
| 299 | Ga0373953_0002133 | 3300035117 | Bacteria | 5918 |
| 300 | Ga0373954_0005093 | 3300035118 | Bacteria | 5671 |
| 301 | Ga0373957_0010197 | 3300035120 | Bacteria | 3099 |
| 302 | Ga0373943_0057479 | 3300035170 | Bacteria | 1933 |
| 303 | Ga0373943_0092116 | 3300035170 | Bacteria | 1571 |
| 304 | Ga0373943_0337628 | 3300035170 | Bacteria | 861 |
| 305 | Ga0373946_0000519 | 3300035171 | Bacteria | 12796 |
| 306 | Ga0373946_0043184 | 3300035171 | Bacteria | 1857 |
| 307 | Ga0373946_0095663 | 3300035171 | Bacteria | 1323 |
| 308 | Ga0373955_0028356 | 3300035172 | Bacteria | 2901 |
| 309 | Ga0373924_0002836 | 3300035410 | Bacteria | 5871 |
| 310 | Ga0373935_0000305 | 3300035692 | Bacteria | 24438 |
| 311 | Ga0373935_0307150 | 3300035692 | Bacteria | 1122 |
| 312 | Ga0373927_0010850 | 3300035695 | Bacteria | 6069 |
| 313 | Ga0373927_0033896 | 3300035695 | Bacteria | 3322 |
| 314 | Ga0373947_0001375 | 3300035725 | Bacteria | 14966 |
| 315 | Ga0373947_0440960 | 3300035725 | Bacteria | 881 |
| 316 | Ga0373937_0000385 | 3300036401 | Bacteria | 41073 |
| 317 | Ga0373925_0000038 | 3300037068 | Bacteria | 142088 |
| 318 | Ga0373925_0130108 | 3300037068 | Bacteria | 1962 |
| 319 | Ga0373925_0516135 | 3300037068 | Bacteria | 981 |
| 320 | Ga0395900_0500238 | 3300037418 | Bacteria | 1166 |
| 321 | Ga0395898_0462021 | 3300037466 | Bacteria | 1208 |
| 322 | Ga0395901_1102196 | 3300038443 | Bacteria | 764 |
| 323 | Ga0436365_0861925 | 3300039437 | Bacteria | 1957 |
| 324 | Ga0436360_0447023 | 3300039438 | Bacteria | 720 |
| 325 | Ga0436361_0555100 | 3300039447 | Bacteria | 2351 |
| 326 | Ga0495592_0000090 | 3300046454 | Bacteria | 80171 |
| 327 | Ga0495603_0092382 | 3300046455 | Bacteria | 1768 |
| 328 | Ga0495591_059150 | 3300046458 | Bacteria | 1023 |
| 329 | Ga0495629_0016944 | 3300046459 | Bacteria | 5228 |
| 330 | Ga0495629_0196739 | 3300046459 | Bacteria | 1394 |
| 331 | Ga0495641_0042294 | 3300046461 | Bacteria | 2112 |
| 332 | Ga0495651_0001695 | 3300046462 | Bacteria | 17029 |
| 333 | Ga0495653_0000107 | 3300046463 | Bacteria | 69282 |
| 334 | Ga0495580_0059946 | 3300046472 | Bacteria | 2674 |
| 335 | Ga0495580_0385976 | 3300046472 | Bacteria | 946 |
| 336 | Ga0495582_0455365 | 3300046473 | Bacteria | 739 |
| 337 | Ga0495605_0045283 | 3300046474 | Bacteria | 2169 |
| 338 | Ga0495639_0009262 | 3300046475 | Bacteria | 4220 |
| 339 | Ga0495662_0003097 | 3300046476 | Bacteria | 8384 |
| 340 | Ga0495662_0104819 | 3300046476 | Unclassified | 1384 |
| 341 | Ga0495664_0000009 | 3300046477 | Bacteria | 289534 |
| 342 | Ga0495664_0430933 | 3300046477 | Bacteria | 791 |
| 343 | Ga0495584_0017642 | 3300046491 | Bacteria | 3632 |
| 344 | Ga0495584_0245536 | 3300046491 | Unclassified | 910 |
| 345 | Ga0495594_0104664 | 3300046499 | Bacteria | 1593 |
| 346 | Ga0495594_0127415 | 3300046499 | Bacteria | 1441 |
| 347 | Ga0495596_0038183 | 3300046500 | Bacteria | 1899 |
| 348 | Ga0495608_0000022 | 3300046511 | Bacteria | 165111 |
| 349 | Ga0495616_0044925 | 3300046513 | Bacteria | 2239 |
| 350 | Ga0495618_0000016 | 3300046514 | Bacteria | 151770 |
| 351 | Ga0495628_0000035 | 3300046516 | Bacteria | 111560 |
| 352 | Ga0495630_0000246 | 3300046517 | Bacteria | 43555 |
| 353 | Ga0495630_0960239 | 3300046517 | Unclassified | 650 |
| 354 | Ga0495632_0128250 | 3300046519 | Bacteria | 1181 |
| 355 | Ga0495644_0123833 | 3300046523 | Bacteria | 984 |
| 356 | Ga0495652_0000062 | 3300046529 | Bacteria | 111572 |
| 357 | Ga0495654_0381907 | 3300046530 | Bacteria | 562 |
| 358 | Ga0495640_0000021 | 3300046533 | Bacteria | 110511 |
| 359 | Ga0495640_0152311 | 3300046533 | Bacteria | 1485 |
| 360 | Ga0495587_0000006 | 3300046536 | Bacteria | 310070 |
| 361 | Ga0495645_0000090 | 3300046543 | Bacteria | 63443 |
| 362 | Ga0495633_0082522 | 3300046558 | Bacteria | 1496 |
| 363 | Ga0495633_0183404 | 3300046558 | Bacteria | 963 |
| 364 | Ga0495633_0271611 | 3300046558 | Bacteria | 772 |
| 365 | Ga0495667_0000011 | 3300046559 | Bacteria | 222545 |
| 366 | Ga0495656_0004369 | 3300046615 | Bacteria | 4836 |
| 367 | Ga0495656_0107212 | 3300046615 | Bacteria | 1301 |
| 368 | Ga0495656_0296732 | 3300046615 | Bacteria | 827 |
| 369 | Ga0495668_0101860 | 3300046616 | Bacteria | 1571 |
| 370 | Ga0495634_0000291 | 3300046642 | Bacteria | 48026 |
| 371 | Ga0495611_0019489 | 3300046648 | Bacteria | 2915 |
| 372 | Ga0495635_0000018 | 3300046663 | Bacteria | 193591 |
| 373 | Ga0495661_0038024 | 3300046665 | Bacteria | 3002 |
| 374 | Ga0495657_0000345 | 3300046675 | Bacteria | 42909 |
| 375 | Ga0495599_0000032 | 3300046678 | Bacteria | 108178 |
| 376 | Ga0495599_0028123 | 3300046678 | Bacteria | 3523 |
| 377 | Ga0495623_0000099 | 3300046679 | Bacteria | 52531 |
| 378 | Ga0495646_0000045 | 3300046680 | Bacteria | 63367 |
| 379 | Ga0495647_0010109 | 3300046681 | Bacteria | 3209 |
| 380 | Ga0495669_0077556 | 3300046684 | Bacteria | 1521 |
| 381 | Ga0495613_0017674 | 3300046689 | Bacteria | 5313 |
| 382 | Ga0495624_0235545 | 3300046690 | Bacteria | 1108 |
| 383 | Ga0495624_0262454 | 3300046690 | Bacteria | 1043 |
| 384 | Ga0495670_0394459 | 3300046691 | Unclassified | 747 |
| 385 | Ga0495649_0048336 | 3300046694 | Bacteria | 2312 |
| 386 | Ga0495600_0000022 | 3300046809 | Bacteria | 94789 |
| 387 | Ga0495660_0386766 | 3300046810 | Bacteria | 615 |
| 388 | Ga0495581_0103742 | 3300047315 | Bacteria | 1652 |
| 389 | Ga0495581_0434171 | 3300047315 | Bacteria | 765 |
| 390 | Ga0495604_0000011 | 3300047317 | Bacteria | 292024 |
| 391 | Ga0495674_0000034 | 3300047319 | Bacteria | 110674 |
| 392 | Ga0495674_0119029 | 3300047319 | Bacteria | 2233 |
| 393 | Ga0495676_0250790 | 3300047321 | Bacteria | 1207 |
| 394 | Ga0495680_0004388 | 3300047322 | Bacteria | 13502 |
| 395 | Ga0495683_0248710 | 3300047323 | Bacteria | 781 |
| 396 | Ga0495675_0000546 | 3300047444 | Bacteria | 24343 |
| 397 | Ga0495679_026243 | 3300047446 | Bacteria | 1937 |
| 398 | Ga0495684_0000012 | 3300047471 | Bacteria | 187118 |
| 399 | Ga0495593_0005383 | 3300047673 | Bacteria | 7569 |
| 400 | Ga0495593_0045463 | 3300047673 | Bacteria | 2343 |
| 401 | Ga0495602_0000064 | 3300048088 | Bacteria | 104858 |
| 402 | Ga0496100_0012357 | 3300048903 | Bacteria | 4893 |
| 403 | Ga0496100_0048861 | 3300048903 | Bacteria | 2733 |
| 404 | Ga0496100_0093967 | 3300048903 | Bacteria | 2053 |
| 405 | Ga0496100_0789860 | 3300048903 | Bacteria | 743 |
| 406 | Ga0496100_0916239 | 3300048903 | Bacteria | 688 |
| 407 | Ga0496101_0028408 | 3300048904 | Bacteria | 3904 |
| 408 | Ga0496101_0046395 | 3300048904 | Bacteria | 3116 |
| 409 | Ga0496101_0065397 | 3300048904 | Bacteria | 2651 |
| 410 | Ga0496101_0091551 | 3300048904 | Bacteria | 2263 |
| 411 | Ga0496101_0347486 | 3300048904 | Bacteria | 1165 |
| 412 | Ga0496101_0359003 | 3300048904 | Bacteria | 1145 |
| 413 | Ga0496101_0420550 | 3300048904 | Bacteria | 1053 |
| 414 | Ga0496102_0013783 | 3300048905 | Bacteria | 7012 |
| 415 | Ga0496102_0017127 | 3300048905 | Bacteria | 6344 |
| 416 | Ga0496102_0130634 | 3300048905 | Bacteria | 2350 |
| 417 | Ga0496102_0181998 | 3300048905 | Bacteria | 1980 |
| 418 | Ga0496102_0211968 | 3300048905 | Bacteria | 1826 |
| 419 | Ga0496102_0218287 | 3300048905 | Bacteria | 1797 |
| 420 | Ga0496102_0429647 | 3300048905 | Bacteria | 1240 |
| 421 | Ga0496103_0019182 | 3300048906 | Bacteria | 4106 |
| 422 | Ga0496104_0037743 | 3300048907 | Bacteria | 4517 |
| 423 | Ga0496104_0075910 | 3300048907 | Bacteria | 3200 |
| 424 | Ga0496104_0165830 | 3300048907 | Bacteria | 2118 |
| 425 | Ga0496104_0529918 | 3300048907 | Bacteria | 1089 |
| 426 | Ga0496104_0971736 | 3300048907 | Bacteria | 753 |
| 427 | Ga0496105_0014065 | 3300048908 | Bacteria | 6368 |
| 428 | Ga0496105_0018577 | 3300048908 | Bacteria | 5595 |
| 429 | Ga0496105_0027183 | 3300048908 | Bacteria | 4671 |
| 430 | Ga0496105_0052029 | 3300048908 | Bacteria | 3382 |
| 431 | Ga0496105_0820982 | 3300048908 | Bacteria | 706 |
| 432 | Ga0496106_0013516 | 3300048909 | Bacteria | 6028 |
| 433 | Ga0496106_0029834 | 3300048909 | Bacteria | 4066 |
| 434 | Ga0496106_0088290 | 3300048909 | Bacteria | 2390 |
| 435 | Ga0496106_0118723 | 3300048909 | Bacteria | 2065 |
| 436 | Ga0496107_0022278 | 3300048910 | Bacteria | 4478 |
| 437 | Ga0496107_0066757 | 3300048910 | Bacteria | 2608 |
| 438 | Ga0496107_0120440 | 3300048910 | Bacteria | 1933 |
| 439 | Ga0496107_0364602 | 3300048910 | Bacteria | 1075 |
| 440 | Ga0496107_0378541 | 3300048910 | Bacteria | 1053 |
| 441 | Ga0496108_0002732 | 3300048911 | Bacteria | 14107 |
| 442 | Ga0496108_0029188 | 3300048911 | Bacteria | 4566 |
| 443 | Ga0496108_0062109 | 3300048911 | Bacteria | 3146 |
| 444 | Ga0496108_0073880 | 3300048911 | Bacteria | 2878 |
| 445 | Ga0496108_0079229 | 3300048911 | Bacteria | 2781 |
| 446 | Ga0496108_0155118 | 3300048911 | Bacteria | 1977 |
| 447 | Ga0496109_0013085 | 3300048912 | Bacteria | 7177 |
| 448 | Ga0496109_0018982 | 3300048912 | Bacteria | 6055 |
| 449 | Ga0496109_0020360 | 3300048912 | Bacteria | 5859 |
| 450 | Ga0496109_0041456 | 3300048912 | Bacteria | 4170 |
| 451 | Ga0496109_0154622 | 3300048912 | Bacteria | 2148 |
| 452 | Ga0496110_0031616 | 3300048913 | Bacteria | 4567 |
| 453 | Ga0496110_0074564 | 3300048913 | Bacteria | 3013 |
| 454 | Ga0496110_0103118 | 3300048913 | Bacteria | 2558 |
| 455 | Ga0496110_0749714 | 3300048913 | Bacteria | 879 |
| 456 | Ga0496111_0003120 | 3300048914 | Bacteria | 10194 |
| 457 | Ga0496111_0023245 | 3300048914 | Bacteria | 4351 |
| 458 | Ga0496111_0074498 | 3300048914 | Bacteria | 2472 |
| 459 | Ga0496111_0174392 | 3300048914 | Bacteria | 1598 |
| 460 | Ga0496111_0789668 | 3300048914 | Bacteria | 687 |
| 461 | Ga0496112_0016600 | 3300048915 | Bacteria | 6902 |
| 462 | Ga0496112_0017973 | 3300048915 | Bacteria | 6653 |
| 463 | Ga0496112_0357640 | 3300048915 | Bacteria | 1402 |
| 464 | Ga0496112_0425509 | 3300048915 | Bacteria | 1266 |
| 465 | Ga0496112_0716776 | 3300048915 | Bacteria | 928 |
| 466 | Ga0496112_1037394 | 3300048915 | Bacteria | 739 |
| 467 | Ga0496113_0001270 | 3300048916 | Bacteria | 13903 |
| 468 | Ga0496113_0041133 | 3300048916 | Bacteria | 3409 |
| 469 | Ga0496113_0045597 | 3300048916 | Bacteria | 3252 |
| 470 | Ga0496113_0065211 | 3300048916 | Bacteria | 2755 |
| 471 | Ga0496114_0182049 | 3300048917 | Bacteria | 1835 |
| 472 | Ga0496114_0211910 | 3300048917 | Bacteria | 1699 |
| 473 | Ga0496114_0271790 | 3300048917 | Bacteria | 1493 |
| 474 | Ga0496114_0415028 | 3300048917 | Bacteria | 1192 |
| 475 | Ga0496114_0825316 | 3300048917 | Bacteria | 806 |
| 476 | Ga0496115_0012146 | 3300048918 | Bacteria | 6476 |
| 477 | Ga0496115_0037403 | 3300048918 | Bacteria | 3846 |
| 478 | Ga0496115_0086192 | 3300048918 | Bacteria | 2562 |
| 479 | Ga0496115_0109006 | 3300048918 | Bacteria | 2273 |
| 480 | Ga0496115_0109730 | 3300048918 | Bacteria | 2266 |
| 481 | Ga0496115_0190094 | 3300048918 | Bacteria | 1696 |
| 482 | Ga0496115_0253942 | 3300048918 | Bacteria | 1447 |
| 483 | Ga0496121_0025008 | 3300048924 | Bacteria | 5686 |
| 484 | Ga0501033_0737075 | 3300049570 | Bacteria | 669 |
| 485 | Ga0501036_0373888 | 3300049572 | Bacteria | 1190 |
| 486 | Ga0501036_0395575 | 3300049572 | Bacteria | 1153 |
| 487 | Ga0501039_0421149 | 3300049575 | Bacteria | 1049 |
| 488 | Ga0501040_0139100 | 3300049576 | Bacteria | 1710 |
| 489 | Ga0501041_0088651 | 3300049577 | Bacteria | 1910 |
| 490 | Ga0501041_0666038 | 3300049577 | Bacteria | 665 |
| 491 | Ga0501042_0374877 | 3300049578 | Bacteria | 1030 |
| 492 | Ga0501042_0555637 | 3300049578 | Bacteria | 834 |
| 493 | Ga0501043_0125129 | 3300049579 | Bacteria | 2016 |
| 494 | Ga0501046_0157648 | 3300049580 | Bacteria | 1709 |
| 495 | Ga0501047_0150604 | 3300049581 | Bacteria | 2202 |
| 496 | Ga0501067_0073891 | 3300049583 | Bacteria | 1889 |
| 497 | Ga0501068_0734910 | 3300049584 | Bacteria | 646 |
| 498 | Ga0501069_0149985 | 3300049585 | Bacteria | 1340 |
| 499 | Ga0501070_0101551 | 3300049586 | Bacteria | 2379 |
| 500 | Ga0501071_0146537 | 3300049587 | Bacteria | 1760 |
| 501 | Ga0501071_0546027 | 3300049587 | Bacteria | 890 |
| 502 | Ga0501072_0525372 | 3300049588 | Bacteria | 935 |
| 503 | Ga0501073_0524207 | 3300049589 | Bacteria | 819 |
| 504 | Ga0501074_0851440 | 3300049590 | Bacteria | 642 |
| 505 | Ga0501077_0338889 | 3300049593 | Bacteria | 959 |
| 506 | Ga0501079_0023418 | 3300049741 | Bacteria | 4739 |
| 507 | Ga0501079_0158013 | 3300049741 | Bacteria | 1767 |
| 508 | Ga0501081_0047809 | 3300049743 | Bacteria | 2944 |
| 509 | Ga0501081_0226729 | 3300049743 | Bacteria | 1360 |
| 510 | Ga0501035_0218916 | 3300049822 | Bacteria | 1626 |
| 511 | Ga0501044_0028570 | 3300049823 | Bacteria | 5887 |
| 512 | Ga0501044_0219405 | 3300049823 | Bacteria | 1853 |
| 513 | Ga0501045_0274955 | 3300049824 | Bacteria | 1254 |
| 514 | Ga0501045_0826934 | 3300049824 | Bacteria | 682 |
| 515 | nmdc:mga03683_4273_c1 | 3300050489 | Bacteria | 3562 |
| 516 | nmdc:mga03n38_358233_c1 | 3300050490 | Bacteria | 795 |
| 517 | nmdc:mga00v17_66138_c1 | 3300050491 | Bacteria | 2231 |
| 518 | nmdc:mga00v17_670582_c1 | 3300050491 | Bacteria | 666 |
| 519 | nmdc:mga0yw44_138296_c1 | 3300050492 | Bacteria | 1581 |
| 520 | nmdc:mga0yw44_2221_c1 | 3300050492 | Bacteria | 8181 |
| 521 | nmdc:mga0yw44_472163_c1 | 3300050492 | Bacteria | 851 |
| 522 | nmdc:mga0yw44_84092_c1 | 3300050492 | Bacteria | 2000 |
| 523 | nmdc:mga06z11_190051_c1 | 3300050494 | Bacteria | 1188 |
| 524 | nmdc:mga06z11_263306_c1 | 3300050494 | Bacteria | 1018 |
| 525 | nmdc:mga06z11_327969_c1 | 3300050494 | Bacteria | 914 |
| 526 | nmdc:mga06z11_562894_c1 | 3300050494 | Bacteria | 692 |
| 527 | nmdc:mga07m45_235966_c1 | 3300050496 | Bacteria | 1064 |
| 528 | nmdc:mga07m45_287092_c1 | 3300050496 | Bacteria | 957 |
| 529 | nmdc:mga05p37_10936_c1 | 3300050507 | Bacteria | 10774 |
| 530 | nmdc:mga05p37_119648_c1 | 3300050507 | Bacteria | 3236 |
| 531 | nmdc:mga05p37_15850_c1 | 3300050507 | Bacteria | 9065 |
| 532 | nmdc:mga05p37_35_c1 | 3300050507 | Bacteria | 110751 |
| 533 | nmdc:mga05p37_490111_c1 | 3300050507 | Bacteria | 1413 |
| 534 | nmdc:mga09592_163_c1 | 3300050508 | Bacteria | 46620 |
| 535 | nmdc:mga0qj67_129176_c1 | 3300050509 | Bacteria | 2046 |
| 536 | nmdc:mga0qj67_143_c1 | 3300050509 | Bacteria | 48269 |
| 537 | nmdc:mga0qj67_535642_c1 | 3300050509 | Bacteria | 940 |
| 538 | nmdc:mga06r32_130898_c1 | 3300050510 | Bacteria | 2481 |
| 539 | nmdc:mga06r32_57410_c1 | 3300050510 | Bacteria | 3739 |
| 540 | nmdc:mga06r32_774_c1 | 3300050510 | Bacteria | 28232 |
| 541 | nmdc:mga06r32_958259_c1 | 3300050510 | Bacteria | 810 |
| 542 | nmdc:mga06r32_96528_c1 | 3300050510 | Bacteria | 2895 |
| 543 | nmdc:mga08y16_1272688_c1 | 3300050511 | Unclassified | 703 |
| 544 | nmdc:mga08y16_206410_c1 | 3300050511 | Bacteria | 2035 |
| 545 | nmdc:mga08y16_293005_c1 | 3300050511 | Bacteria | 1678 |
| 546 | nmdc:mga08y16_356_c1 | 3300050511 | Bacteria | 41239 |
| 547 | nmdc:mga08y16_974489_c1 | 3300050511 | Bacteria | 829 |
| 548 | nmdc:mga08y16_98122_c1 | 3300050511 | Bacteria | 3051 |
| 549 | nmdc:mga0n895_152970_c1 | 3300050512 | Bacteria | 2337 |
| 550 | nmdc:mga0n895_33053_c1 | 3300050512 | Bacteria | 4969 |
| 551 | nmdc:mga0n895_3734_c1 | 3300050512 | Bacteria | 12320 |
| 552 | nmdc:mga0n895_37529_c1 | 3300050512 | Bacteria | 4688 |
| 553 | nmdc:mga0n895_427962_c1 | 3300050512 | Bacteria | 1338 |
| 554 | nmdc:mga0rr50_2803_c1 | 3300050513 | Bacteria | 9900 |
| 555 | nmdc:mga0rr50_6925_c1 | 3300050513 | Bacteria | 6950 |
| 556 | nmdc:mga0rr50_72238_c1 | 3300050513 | Bacteria | 2634 |
| 557 | nmdc:mga08x19_69980_c1 | 3300050514 | Bacteria | 2286 |
| 558 | nmdc:mga0a205_319649_c1 | 3300050515 | Bacteria | 1423 |
| 559 | nmdc:mga0a205_344168_c1 | 3300050515 | Bacteria | 1359 |
| 560 | nmdc:mga0a205_400_c1 | 3300050515 | Bacteria | 33140 |
| 561 | Ga0495601_0000015 | 3300053077 | Bacteria | 213851 |
| 562 | Ga0495601_0007860 | 3300053077 | Bacteria | 6278 |
| 563 | Ga0495612_0000016 | 3300053078 | Bacteria | 158947 |
| 564 | Ga0495612_0023236 | 3300053078 | Bacteria | 2487 |
| 565 | Ga0495655_0012017 | 3300053083 | Bacteria | 1754 |
| 566 | Ga0495655_0104813 | 3300053083 | Bacteria | 842 |
| 567 | Ga0495619_0000044 | 3300053085 | Bacteria | 108581 |
| 568 | Ga0500616_0000048 | 3300053153 | Bacteria | 313108 |
| 569 | Ga0501084_0128065 | 3300054114 | Bacteria | 2137 |
| 570 | Ga0501082_0054144 | 3300060353 | Bacteria | 3459 |
| 571 | Ga0501082_0371585 | 3300060353 | Bacteria | 1247 |
| 572 | Ga0501082_1414054 | 3300060353 | Bacteria | 607 |
| 573 | Ga0501082_1500598 | 3300060353 | Unclassified | 589 |
| 574 | Ga0530510_0145834 | 3300061734 | Bacteria | 1746 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048911 | Ga0496108_0155118 | Ga0496108_0155118_1198_1701 | 153 |
| 2 | 3300048912 | Ga0496109_0018982 | Ga0496109_0018982_1165_1668 | 153 |
| 3 | 3300048913 | Ga0496110_0074564 | Ga0496110_0074564_393_896 | 153 |
| 4 | 3300048915 | Ga0496112_0425509 | Ga0496112_0425509_664_1167 | 153 |
| 5 | 3300025912 | Ga0207707_10767285 | Ga0207707_107672852 | 156 |
| 6 | 3300005438 | Ga0070701_10528622 | Ga0070701_105286221 | 158 |
| 7 | 3300006038 | Ga0075365_10102285 | Ga0075365_101022853 | 159 |
| 8 | 3300009094 | Ga0111539_10173997 | Ga0111539_101739972 | 160 |
| 9 | 3300050511 | nmdc:mga08y16_206410_c1 | nmdc:mga08y16_206410_c1_358_894 | 160 |
| 10 | 3300049741 | Ga0501079_0023418 | Ga0501079_0023418_821_1381 | 161 |
| 11 | 3300049743 | Ga0501081_0047809 | Ga0501081_0047809_423_983 | 161 |
| 12 | 3300039438 | Ga0436360_0447023 | Ga0436360_0447023_30_608 | 162 |
| 13 | 3300005842 | Ga0068858_100240948 | Ga0068858_1002409482 | 165 |
| 14 | 3300006881 | Ga0068865_101230371 | Ga0068865_1012303712 | 165 |
| 15 | 3300013297 | Ga0157378_10339891 | Ga0157378_103398913 | 165 |
| 16 | 3300025903 | Ga0207680_10207022 | Ga0207680_102070222 | 165 |
| 17 | 3300009101 | Ga0105247_10065550 | Ga0105247_100655503 | 166 |
| 18 | 3300049570 | Ga0501033_0737075 | Ga0501033_0737075_99_617 | 166 |
| 19 | iso_pu_bacteria | 2643221547 | 2643755108 | 166 |
| 20 | 3300005355 | Ga0070671_100272998 | Ga0070671_1002729982 | 167 |
| 21 | 3300005356 | Ga0070674_100978712 | Ga0070674_1009787121 | 167 |
| 22 | 3300005367 | Ga0070667_100792091 | Ga0070667_1007920911 | 167 |
| 23 | 3300005436 | Ga0070713_100435279 | Ga0070713_1004352792 | 167 |
| 24 | 3300005441 | Ga0070700_100264459 | Ga0070700_1002644592 | 167 |
| 25 | 3300005458 | Ga0070681_10917930 | Ga0070681_109179302 | 167 |
| 26 | 3300005546 | Ga0070696_100506865 | Ga0070696_1005068651 | 167 |
| 27 | 3300005549 | Ga0070704_100048398 | Ga0070704_1000483983 | 167 |
| 28 | 3300007265 | Ga0099794_10137556 | Ga0099794_101375562 | 167 |
| 29 | 3300009094 | Ga0111539_10258403 | Ga0111539_102584032 | 167 |
| 30 | 3300009147 | Ga0114129_10021956 | Ga0114129_100219562 | 167 |
| 31 | 3300010375 | Ga0105239_10149726 | Ga0105239_101497262 | 167 |
| 32 | 3300013306 | Ga0163162_10938990 | Ga0163162_109389901 | 167 |
| 33 | 3300025918 | Ga0207662_10433713 | Ga0207662_104337132 | 167 |
| 34 | 3300025928 | Ga0207700_10335519 | Ga0207700_103355192 | 167 |
| 35 | 3300026067 | Ga0207678_11462784 | Ga0207678_114627841 | 167 |
| 36 | 3300035083 | Ga0373926_0032423 | Ga0373926_0032423_468_971 | 167 |
| 37 | 3300035085 | Ga0373929_0181865 | Ga0373929_0181865_41_544 | 167 |
| 38 | 3300035089 | Ga0373944_0017853 | Ga0373944_0017853_1391_1894 | 167 |
| 39 | 3300035170 | Ga0373943_0092116 | Ga0373943_0092116_312_815 | 167 |
| 40 | 3300035170 | Ga0373943_0337628 | Ga0373943_0337628_263_766 | 167 |
| 41 | 3300035171 | Ga0373946_0043184 | Ga0373946_0043184_1256_1759 | 167 |
| 42 | 3300035171 | Ga0373946_0095663 | Ga0373946_0095663_134_637 | 167 |
| 43 | 3300035692 | Ga0373935_0307150 | Ga0373935_0307150_13_516 | 167 |
| 44 | 3300035695 | Ga0373927_0033896 | Ga0373927_0033896_2167_2670 | 167 |
| 45 | 3300035725 | Ga0373947_0440960 | Ga0373947_0440960_103_606 | 167 |
| 46 | 3300037068 | Ga0373925_0130108 | Ga0373925_0130108_707_1210 | 167 |
| 47 | 3300037068 | Ga0373925_0516135 | Ga0373925_0516135_55_558 | 167 |
| 48 | 3300046455 | Ga0495603_0092382 | Ga0495603_0092382_159_662 | 167 |
| 49 | 3300046458 | Ga0495591_059150 | Ga0495591_059150_112_615 | 167 |
| 50 | 3300046459 | Ga0495629_0196739 | Ga0495629_0196739_629_1132 | 167 |
| 51 | 3300046461 | Ga0495641_0042294 | Ga0495641_0042294_224_727 | 167 |
| 52 | 3300046472 | Ga0495580_0059946 | Ga0495580_0059946_1791_2294 | 167 |
| 53 | 3300046473 | Ga0495582_0455365 | Ga0495582_0455365_224_727 | 167 |
| 54 | 3300046475 | Ga0495639_0009262 | Ga0495639_0009262_3548_4051 | 167 |
| 55 | 3300046476 | Ga0495662_0104819 | Ga0495662_0104819_444_947 | 167 |
| 56 | 3300046491 | Ga0495584_0017642 | Ga0495584_0017642_2953_3456 | 167 |
| 57 | 3300046499 | Ga0495594_0104664 | Ga0495594_0104664_548_1051 | 167 |
| 58 | 3300046499 | Ga0495594_0127415 | Ga0495594_0127415_46_549 | 167 |
| 59 | 3300046517 | Ga0495630_0960239 | Ga0495630_0960239_32_535 | 167 |
| 60 | 3300046523 | Ga0495644_0123833 | Ga0495644_0123833_193_696 | 167 |
| 61 | 3300046530 | Ga0495654_0381907 | Ga0495654_0381907_37_540 | 167 |
| 62 | 3300046533 | Ga0495640_0152311 | Ga0495640_0152311_698_1201 | 167 |
| 63 | 3300046558 | Ga0495633_0183404 | Ga0495633_0183404_112_615 | 167 |
| 64 | 3300046558 | Ga0495633_0271611 | Ga0495633_0271611_246_749 | 167 |
| 65 | 3300046615 | Ga0495656_0004369 | Ga0495656_0004369_3759_4262 | 167 |
| 66 | 3300046665 | Ga0495661_0038024 | Ga0495661_0038024_1115_1618 | 167 |
| 67 | 3300046681 | Ga0495647_0010109 | Ga0495647_0010109_1019_1522 | 167 |
| 68 | 3300046689 | Ga0495613_0017674 | Ga0495613_0017674_4787_5290 | 167 |
| 69 | 3300046690 | Ga0495624_0235545 | Ga0495624_0235545_369_872 | 167 |
| 70 | 3300046691 | Ga0495670_0394459 | Ga0495670_0394459_129_632 | 167 |
| 71 | 3300047315 | Ga0495581_0434171 | Ga0495581_0434171_177_680 | 167 |
| 72 | 3300047321 | Ga0495676_0250790 | Ga0495676_0250790_281_784 | 167 |
| 73 | 3300047446 | Ga0495679_026243 | Ga0495679_026243_453_956 | 167 |
| 74 | 3300047673 | Ga0495593_0045463 | Ga0495593_0045463_937_1440 | 167 |
| 75 | 3300048903 | Ga0496100_0012357 | Ga0496100_0012357_3008_3559 | 167 |
| 76 | 3300048904 | Ga0496101_0028408 | Ga0496101_0028408_2681_3184 | 167 |
| 77 | 3300048904 | Ga0496101_0046395 | Ga0496101_0046395_1344_1895 | 167 |
| 78 | 3300048905 | Ga0496102_0013783 | Ga0496102_0013783_5304_5855 | 167 |
| 79 | 3300048905 | Ga0496102_0130634 | Ga0496102_0130634_27_530 | 167 |
| 80 | 3300048907 | Ga0496104_0037743 | Ga0496104_0037743_2943_3494 | 167 |
| 81 | 3300048908 | Ga0496105_0018577 | Ga0496105_0018577_853_1356 | 167 |
| 82 | 3300048908 | Ga0496105_0052029 | Ga0496105_0052029_630_1181 | 167 |
| 83 | 3300048909 | Ga0496106_0029834 | Ga0496106_0029834_2545_3096 | 167 |
| 84 | 3300048910 | Ga0496107_0066757 | Ga0496107_0066757_1089_1640 | 167 |
| 85 | 3300048910 | Ga0496107_0378541 | Ga0496107_0378541_177_680 | 167 |
| 86 | 3300048911 | Ga0496108_0073880 | Ga0496108_0073880_1036_1587 | 167 |
| 87 | 3300048912 | Ga0496109_0013085 | Ga0496109_0013085_3948_4499 | 167 |
| 88 | 3300048913 | Ga0496110_0749714 | Ga0496110_0749714_137_688 | 167 |
| 89 | 3300048914 | Ga0496111_0023245 | Ga0496111_0023245_386_937 | 167 |
| 90 | 3300048915 | Ga0496112_0357640 | Ga0496112_0357640_580_1131 | 167 |
| 91 | 3300048916 | Ga0496113_0041133 | Ga0496113_0041133_869_1372 | 167 |
| 92 | 3300048916 | Ga0496113_0045597 | Ga0496113_0045597_575_1126 | 167 |
| 93 | 3300048917 | Ga0496114_0182049 | Ga0496114_0182049_1023_1526 | 167 |
| 94 | 3300048917 | Ga0496114_0415028 | Ga0496114_0415028_289_840 | 167 |
| 95 | 3300048918 | Ga0496115_0037403 | Ga0496115_0037403_1414_1917 | 167 |
| 96 | 3300048918 | Ga0496115_0086192 | Ga0496115_0086192_744_1247 | 167 |
| 97 | 3300048918 | Ga0496115_0253942 | Ga0496115_0253942_241_792 | 167 |
| 98 | 3300049577 | Ga0501041_0088651 | Ga0501041_0088651_936_1487 | 167 |
| 99 | 3300049578 | Ga0501042_0374877 | Ga0501042_0374877_432_983 | 167 |
| 100 | 3300049583 | Ga0501067_0073891 | Ga0501067_0073891_838_1458 | 167 |
| 101 | 3300049824 | Ga0501045_0826934 | Ga0501045_0826934_25_576 | 167 |
| 102 | 3300050507 | nmdc:mga05p37_10936_c1 | nmdc:mga05p37_10936_c1_4901_5404 | 167 |
| 103 | 3300053083 | Ga0495655_0104813 | Ga0495655_0104813_267_770 | 167 |
| 104 | 3300053153 | Ga0500616_0000048 | Ga0500616_0000048_292909_293427 | 167 |
| 105 | 3300060353 | Ga0501082_0054144 | Ga0501082_0054144_1056_1616 | 167 |
| 106 | 3300005365 | Ga0070688_100168370 | Ga0070688_1001683701 | 168 |
| 107 | 3300026035 | Ga0207703_11147909 | Ga0207703_111479092 | 168 |
| 108 | 3300046678 | Ga0495599_0028123 | Ga0495599_0028123_1533_2054 | 168 |
| 109 | 3300047319 | Ga0495674_0119029 | Ga0495674_0119029_1205_1726 | 168 |
| 110 | 3300048924 | Ga0496121_0025008 | Ga0496121_0025008_2016_2528 | 168 |
| 111 | 3300053077 | Ga0495601_0007860 | Ga0495601_0007860_4237_4758 | 168 |
| 112 | 3300053078 | Ga0495612_0023236 | Ga0495612_0023236_1302_1823 | 168 |
| 113 | 3300006051 | Ga0075364_10711855 | Ga0075364_107118552 | 169 |
| 114 | 3300006846 | Ga0075430_100557919 | Ga0075430_1005579192 | 169 |
| 115 | 3300021384 | Ga0213876_10339035 | Ga0213876_103390352 | 169 |
| 116 | 3300049572 | Ga0501036_0395575 | Ga0501036_0395575_184_696 | 169 |
| 117 | 3300049824 | Ga0501045_0274955 | Ga0501045_0274955_271_783 | 169 |
| 118 | 3300050494 | nmdc:mga06z11_562894_c1 | nmdc:mga06z11_562894_c1_87_596 | 169 |
| 119 | 3300050511 | nmdc:mga08y16_1272688_c1 | nmdc:mga08y16_1272688_c1_47_562 | 169 |
| 120 | 3300003911 | JGI25405J52794_10011756 | JGI25405J52794_100117562 | 170 |
| 121 | 3300005435 | Ga0070714_100313601 | Ga0070714_1003136011 | 170 |
| 122 | 3300005937 | Ga0081455_10004590 | Ga0081455_100045907 | 170 |
| 123 | 3300005937 | Ga0081455_10098018 | Ga0081455_100980182 | 170 |
| 124 | 3300006028 | Ga0070717_10443878 | Ga0070717_104438782 | 170 |
| 125 | 3300006058 | Ga0075432_10002319 | Ga0075432_100023192 | 170 |
| 126 | 3300006194 | Ga0075427_10004166 | Ga0075427_100041662 | 170 |
| 127 | 3300006844 | Ga0075428_101073147 | Ga0075428_1010731472 | 170 |
| 128 | 3300006846 | Ga0075430_100000128 | Ga0075430_10000012828 | 170 |
| 129 | 3300006847 | Ga0075431_100001558 | Ga0075431_10000155815 | 170 |
| 130 | 3300006852 | Ga0075433_10000103 | Ga0075433_1000010318 | 170 |
| 131 | 3300006852 | Ga0075433_10941705 | Ga0075433_109417052 | 170 |
| 132 | 3300006871 | Ga0075434_100001533 | Ga0075434_10000153315 | 170 |
| 133 | 3300006871 | Ga0075434_100020416 | Ga0075434_1000204162 | 170 |
| 134 | 3300006871 | Ga0075434_100284869 | Ga0075434_1002848692 | 170 |
| 135 | 3300006880 | Ga0075429_100000381 | Ga0075429_10000038127 | 170 |
| 136 | 3300006914 | Ga0075436_100004204 | Ga0075436_1000042045 | 170 |
| 137 | 3300007076 | Ga0075435_100015585 | Ga0075435_1000155853 | 170 |
| 138 | 3300007076 | Ga0075435_100048649 | Ga0075435_1000486492 | 170 |
| 139 | 3300009094 | Ga0111539_10000787 | Ga0111539_100007878 | 170 |
| 140 | 3300009147 | Ga0114129_10003834 | Ga0114129_1000383422 | 170 |
| 141 | 3300009147 | Ga0114129_10017332 | Ga0114129_100173326 | 170 |
| 142 | 3300025929 | Ga0207664_10175105 | Ga0207664_101751052 | 170 |
| 143 | 3300027671 | Ga0209588_1010668 | Ga0209588_10106683 | 170 |
| 144 | 3300027907 | Ga0207428_10000058 | Ga0207428_1000005831 | 170 |
| 145 | 3300028379 | Ga0268266_10209426 | Ga0268266_102094261 | 170 |
| 146 | 3300028800 | Ga0265338_10229544 | Ga0265338_102295442 | 170 |
| 147 | 3300031247 | Ga0265340_10094517 | Ga0265340_100945171 | 170 |
| 148 | 3300037418 | Ga0395900_0500238 | Ga0395900_0500238_563_1075 | 170 |
| 149 | 3300050507 | nmdc:mga05p37_15850_c1 | nmdc:mga05p37_15850_c1_6650_7162 | 170 |
| 150 | 3300050507 | nmdc:mga05p37_35_c1 | nmdc:mga05p37_35_c1_87593_88105 | 170 |
| 151 | 3300050508 | nmdc:mga09592_163_c1 | nmdc:mga09592_163_c1_35282_35794 | 170 |
| 152 | 3300050509 | nmdc:mga0qj67_143_c1 | nmdc:mga0qj67_143_c1_35281_35793 | 170 |
| 153 | 3300050510 | nmdc:mga06r32_774_c1 | nmdc:mga06r32_774_c1_19989_20501 | 170 |
| 154 | 3300050511 | nmdc:mga08y16_356_c1 | nmdc:mga08y16_356_c1_16065_16577 | 170 |
| 155 | 3300050512 | nmdc:mga0n895_3734_c1 | nmdc:mga0n895_3734_c1_719_1231 | 170 |
| 156 | 3300050512 | nmdc:mga0n895_37529_c1 | nmdc:mga0n895_37529_c1_2168_2680 | 170 |
| 157 | 3300050513 | nmdc:mga0rr50_2803_c1 | nmdc:mga0rr50_2803_c1_2935_3447 | 170 |
| 158 | 3300050513 | nmdc:mga0rr50_6925_c1 | nmdc:mga0rr50_6925_c1_2262_2774 | 170 |
| 159 | 3300050513 | nmdc:mga0rr50_72238_c1 | nmdc:mga0rr50_72238_c1_732_1250 | 170 |
| 160 | 3300050514 | nmdc:mga08x19_69980_c1 | nmdc:mga08x19_69980_c1_993_1511 | 170 |
| 161 | 3300050515 | nmdc:mga0a205_344168_c1 | nmdc:mga0a205_344168_c1_56_568 | 170 |
| 162 | 3300050515 | nmdc:mga0a205_400_c1 | nmdc:mga0a205_400_c1_2117_2629 | 170 |
| 163 | 3300031241 | Ga0265325_10002612 | Ga0265325_1000261213 | 171 |
| 164 | 3300031595 | Ga0265313_10031287 | Ga0265313_100312872 | 171 |
| 165 | 3300005530 | Ga0070679_100651291 | Ga0070679_1006512911 | 172 |
| 166 | 3300005578 | Ga0068854_100641043 | Ga0068854_1006410431 | 172 |
| 167 | 3300006038 | Ga0075365_10140488 | Ga0075365_101404882 | 172 |
| 168 | 3300009094 | Ga0111539_11028824 | Ga0111539_110288242 | 172 |
| 169 | 3300025921 | Ga0207652_10142594 | Ga0207652_101425943 | 172 |
| 170 | 3300025981 | Ga0207640_10603050 | Ga0207640_106030501 | 172 |
| 171 | 3300031247 | Ga0265340_10052072 | Ga0265340_100520722 | 172 |
| 172 | 3300035111 | Ga0373923_0000898 | Ga0373923_0000898_7037_7561 | 172 |
| 173 | 3300035113 | Ga0373936_0009843 | Ga0373936_0009843_3023_3547 | 172 |
| 174 | 3300035116 | Ga0373945_0007874 | Ga0373945_0007874_2895_3419 | 172 |
| 175 | 3300035117 | Ga0373953_0002133 | Ga0373953_0002133_2272_2796 | 172 |
| 176 | 3300035118 | Ga0373954_0005093 | Ga0373954_0005093_2020_2544 | 172 |
| 177 | 3300035120 | Ga0373957_0010197 | Ga0373957_0010197_194_718 | 172 |
| 178 | 3300035170 | Ga0373943_0057479 | Ga0373943_0057479_1174_1698 | 172 |
| 179 | 3300035171 | Ga0373946_0000519 | Ga0373946_0000519_8572_9096 | 172 |
| 180 | 3300035172 | Ga0373955_0028356 | Ga0373955_0028356_1831_2355 | 172 |
| 181 | 3300035410 | Ga0373924_0002836 | Ga0373924_0002836_2619_3143 | 172 |
| 182 | 3300035692 | Ga0373935_0000305 | Ga0373935_0000305_17995_18519 | 172 |
| 183 | 3300035695 | Ga0373927_0010850 | Ga0373927_0010850_3342_3866 | 172 |
| 184 | 3300035725 | Ga0373947_0001375 | Ga0373947_0001375_14275_14799 | 172 |
| 185 | 3300036401 | Ga0373937_0000385 | Ga0373937_0000385_39475_39999 | 172 |
| 186 | 3300037068 | Ga0373925_0000038 | Ga0373925_0000038_106298_106822 | 172 |
| 187 | 3300046454 | Ga0495592_0000090 | Ga0495592_0000090_79466_79990 | 172 |
| 188 | 3300046459 | Ga0495629_0016944 | Ga0495629_0016944_1123_1647 | 172 |
| 189 | 3300046462 | Ga0495651_0001695 | Ga0495651_0001695_2480_3004 | 172 |
| 190 | 3300046463 | Ga0495653_0000107 | Ga0495653_0000107_28255_28779 | 172 |
| 191 | 3300046476 | Ga0495662_0003097 | Ga0495662_0003097_2361_2885 | 172 |
| 192 | 3300046477 | Ga0495664_0000009 | Ga0495664_0000009_34394_34918 | 172 |
| 193 | 3300046511 | Ga0495608_0000022 | Ga0495608_0000022_82830_83354 | 172 |
| 194 | 3300046514 | Ga0495618_0000016 | Ga0495618_0000016_112658_113182 | 172 |
| 195 | 3300046516 | Ga0495628_0000035 | Ga0495628_0000035_30654_31178 | 172 |
| 196 | 3300046517 | Ga0495630_0000246 | Ga0495630_0000246_35801_36325 | 172 |
| 197 | 3300046529 | Ga0495652_0000062 | Ga0495652_0000062_30666_31190 | 172 |
| 198 | 3300046533 | Ga0495640_0000021 | Ga0495640_0000021_81758_82282 | 172 |
| 199 | 3300046536 | Ga0495587_0000006 | Ga0495587_0000006_30666_31190 | 172 |
| 200 | 3300046543 | Ga0495645_0000090 | Ga0495645_0000090_28271_28795 | 172 |
| 201 | 3300046559 | Ga0495667_0000011 | Ga0495667_0000011_187418_187942 | 172 |
| 202 | 3300046642 | Ga0495634_0000291 | Ga0495634_0000291_35099_35623 | 172 |
| 203 | 3300046663 | Ga0495635_0000018 | Ga0495635_0000018_113583_114107 | 172 |
| 204 | 3300046675 | Ga0495657_0000345 | Ga0495657_0000345_28239_28763 | 172 |
| 205 | 3300046678 | Ga0495599_0000032 | Ga0495599_0000032_28266_28790 | 172 |
| 206 | 3300046679 | Ga0495623_0000099 | Ga0495623_0000099_40341_40865 | 172 |
| 207 | 3300046680 | Ga0495646_0000045 | Ga0495646_0000045_34587_35111 | 172 |
| 208 | 3300046690 | Ga0495624_0262454 | Ga0495624_0262454_189_713 | 172 |
| 209 | 3300046809 | Ga0495600_0000022 | Ga0495600_0000022_12508_13032 | 172 |
| 210 | 3300047315 | Ga0495581_0103742 | Ga0495581_0103742_649_1173 | 172 |
| 211 | 3300047317 | Ga0495604_0000011 | Ga0495604_0000011_79485_80009 | 172 |
| 212 | 3300047319 | Ga0495674_0000034 | Ga0495674_0000034_30666_31190 | 172 |
| 213 | 3300047322 | Ga0495680_0004388 | Ga0495680_0004388_5840_6364 | 172 |
| 214 | 3300047444 | Ga0495675_0000546 | Ga0495675_0000546_23045_23569 | 172 |
| 215 | 3300047471 | Ga0495684_0000012 | Ga0495684_0000012_104952_105476 | 172 |
| 216 | 3300047673 | Ga0495593_0005383 | Ga0495593_0005383_5962_6486 | 172 |
| 217 | 3300048088 | Ga0495602_0000064 | Ga0495602_0000064_79485_80009 | 172 |
| 218 | 3300049579 | Ga0501043_0125129 | Ga0501043_0125129_1418_1936 | 172 |
| 219 | 3300049580 | Ga0501046_0157648 | Ga0501046_0157648_1104_1622 | 172 |
| 220 | 3300049581 | Ga0501047_0150604 | Ga0501047_0150604_200_718 | 172 |
| 221 | 3300049586 | Ga0501070_0101551 | Ga0501070_0101551_1348_1866 | 172 |
| 222 | 3300049587 | Ga0501071_0146537 | Ga0501071_0146537_1008_1526 | 172 |
| 223 | 3300049590 | Ga0501074_0851440 | Ga0501074_0851440_64_582 | 172 |
| 224 | 3300049741 | Ga0501079_0158013 | Ga0501079_0158013_1170_1694 | 172 |
| 225 | 3300049822 | Ga0501035_0218916 | Ga0501035_0218916_1015_1533 | 172 |
| 226 | 3300049823 | Ga0501044_0028570 | Ga0501044_0028570_5048_5566 | 172 |
| 227 | 3300049823 | Ga0501044_0219405 | Ga0501044_0219405_71_592 | 172 |
| 228 | 3300053077 | Ga0495601_0000015 | Ga0495601_0000015_79485_80009 | 172 |
| 229 | 3300053078 | Ga0495612_0000016 | Ga0495612_0000016_41719_42243 | 172 |
| 230 | 3300053085 | Ga0495619_0000044 | Ga0495619_0000044_79785_80309 | 172 |
| 231 | 3300060353 | Ga0501082_0371585 | Ga0501082_0371585_377_895 | 172 |
| 232 | 3300060353 | Ga0501082_1500598 | Ga0501082_1500598_27_545 | 172 |
| 233 | 3300009094 | Ga0111539_10072403 | Ga0111539_100724032 | 173 |
| 234 | 3300009551 | Ga0105238_10886466 | Ga0105238_108864662 | 173 |
| 235 | 3300025936 | Ga0207670_10715807 | Ga0207670_107158072 | 173 |
| 236 | 3300005341 | Ga0070691_10008865 | Ga0070691_100088652 | 174 |
| 237 | 3300005438 | Ga0070701_10044646 | Ga0070701_100446463 | 174 |
| 238 | 3300005530 | Ga0070679_100437527 | Ga0070679_1004375271 | 174 |
| 239 | 3300005983 | Ga0081540_1051353 | Ga0081540_10513532 | 174 |
| 240 | 3300006051 | Ga0075364_10206526 | Ga0075364_102065262 | 174 |
| 241 | 3300009094 | Ga0111539_10198645 | Ga0111539_101986453 | 174 |
| 242 | 3300009098 | Ga0105245_11144545 | Ga0105245_111445451 | 174 |
| 243 | 3300009148 | Ga0105243_10161067 | Ga0105243_101610672 | 174 |
| 244 | 3300009174 | Ga0105241_10256604 | Ga0105241_102566042 | 174 |
| 245 | 3300009176 | Ga0105242_10049535 | Ga0105242_100495353 | 174 |
| 246 | 3300009177 | Ga0105248_10139518 | Ga0105248_101395183 | 174 |
| 247 | 3300009545 | Ga0105237_10243985 | Ga0105237_102439852 | 174 |
| 248 | 3300009551 | Ga0105238_10727408 | Ga0105238_107274082 | 174 |
| 249 | 3300009553 | Ga0105249_10172755 | Ga0105249_101727553 | 174 |
| 250 | 3300010375 | Ga0105239_10166891 | Ga0105239_101668912 | 174 |
| 251 | 3300013297 | Ga0157378_10187589 | Ga0157378_101875893 | 174 |
| 252 | 3300013306 | Ga0163162_10162965 | Ga0163162_101629652 | 174 |
| 253 | 3300013308 | Ga0157375_10187602 | Ga0157375_101876022 | 174 |
| 254 | 3300013308 | Ga0157375_10486483 | Ga0157375_104864832 | 174 |
| 255 | 3300014325 | Ga0163163_10269307 | Ga0163163_102693072 | 174 |
| 256 | 3300014325 | Ga0163163_10797003 | Ga0163163_107970031 | 174 |
| 257 | 3300014326 | Ga0157380_10919791 | Ga0157380_109197912 | 174 |
| 258 | 3300014968 | Ga0157379_10335397 | Ga0157379_103353972 | 174 |
| 259 | 3300014969 | Ga0157376_10976052 | Ga0157376_109760522 | 174 |
| 260 | 3300025904 | Ga0207647_10010563 | Ga0207647_100105632 | 174 |
| 261 | 3300025926 | Ga0207659_10392468 | Ga0207659_103924681 | 174 |
| 262 | 3300046474 | Ga0495605_0045283 | Ga0495605_0045283_990_1514 | 174 |
| 263 | 3300046477 | Ga0495664_0430933 | Ga0495664_0430933_113_637 | 174 |
| 264 | 3300046491 | Ga0495584_0245536 | Ga0495584_0245536_143_667 | 174 |
| 265 | 3300046500 | Ga0495596_0038183 | Ga0495596_0038183_843_1367 | 174 |
| 266 | 3300046513 | Ga0495616_0044925 | Ga0495616_0044925_398_922 | 174 |
| 267 | 3300046519 | Ga0495632_0128250 | Ga0495632_0128250_418_942 | 174 |
| 268 | 3300046558 | Ga0495633_0082522 | Ga0495633_0082522_367_891 | 174 |
| 269 | 3300046615 | Ga0495656_0107212 | Ga0495656_0107212_524_1048 | 174 |
| 270 | 3300046616 | Ga0495668_0101860 | Ga0495668_0101860_190_714 | 174 |
| 271 | 3300046648 | Ga0495611_0019489 | Ga0495611_0019489_2159_2683 | 174 |
| 272 | 3300046684 | Ga0495669_0077556 | Ga0495669_0077556_519_1043 | 174 |
| 273 | 3300046694 | Ga0495649_0048336 | Ga0495649_0048336_676_1200 | 174 |
| 274 | 3300046810 | Ga0495660_0386766 | Ga0495660_0386766_37_561 | 174 |
| 275 | 3300047323 | Ga0495683_0248710 | Ga0495683_0248710_51_575 | 174 |
| 276 | 3300048903 | Ga0496100_0916239 | Ga0496100_0916239_35_559 | 174 |
| 277 | 3300048904 | Ga0496101_0359003 | Ga0496101_0359003_246_770 | 174 |
| 278 | 3300048904 | Ga0496101_0420550 | Ga0496101_0420550_369_893 | 174 |
| 279 | 3300048905 | Ga0496102_0017127 | Ga0496102_0017127_5593_6117 | 174 |
| 280 | 3300048905 | Ga0496102_0429647 | Ga0496102_0429647_424_948 | 174 |
| 281 | 3300048906 | Ga0496103_0019182 | Ga0496103_0019182_2207_2731 | 174 |
| 282 | 3300048907 | Ga0496104_0971736 | Ga0496104_0971736_100_624 | 174 |
| 283 | 3300048909 | Ga0496106_0013516 | Ga0496106_0013516_4389_4913 | 174 |
| 284 | 3300048910 | Ga0496107_0364602 | Ga0496107_0364602_448_972 | 174 |
| 285 | 3300048911 | Ga0496108_0002732 | Ga0496108_0002732_1864_2388 | 174 |
| 286 | 3300048914 | Ga0496111_0074498 | Ga0496111_0074498_682_1206 | 174 |
| 287 | 3300048916 | Ga0496113_0065211 | Ga0496113_0065211_709_1233 | 174 |
| 288 | 3300048917 | Ga0496114_0271790 | Ga0496114_0271790_271_795 | 174 |
| 289 | 3300048917 | Ga0496114_0825316 | Ga0496114_0825316_221_745 | 174 |
| 290 | 3300048918 | Ga0496115_0012146 | Ga0496115_0012146_373_897 | 174 |
| 291 | 3300050489 | nmdc:mga03683_4273_c1 | nmdc:mga03683_4273_c1_1306_1833 | 174 |
| 292 | 3300050490 | nmdc:mga03n38_358233_c1 | nmdc:mga03n38_358233_c1_253_777 | 174 |
| 293 | 3300050491 | nmdc:mga00v17_66138_c1 | nmdc:mga00v17_66138_c1_950_1477 | 174 |
| 294 | 3300050491 | nmdc:mga00v17_670582_c1 | nmdc:mga00v17_670582_c1_26_550 | 174 |
| 295 | 3300050492 | nmdc:mga0yw44_2221_c1 | nmdc:mga0yw44_2221_c1_3050_3577 | 174 |
| 296 | 3300050492 | nmdc:mga0yw44_472163_c1 | nmdc:mga0yw44_472163_c1_16_540 | 174 |
| 297 | 3300050494 | nmdc:mga06z11_263306_c1 | nmdc:mga06z11_263306_c1_387_911 | 174 |
| 298 | 3300050496 | nmdc:mga07m45_235966_c1 | nmdc:mga07m45_235966_c1_244_768 | 174 |
| 299 | 3300050509 | nmdc:mga0qj67_535642_c1 | nmdc:mga0qj67_535642_c1_70_597 | 174 |
| 300 | 3300050510 | nmdc:mga06r32_130898_c1 | nmdc:mga06r32_130898_c1_939_1466 | 174 |
| 301 | 3300050511 | nmdc:mga08y16_974489_c1 | nmdc:mga08y16_974489_c1_212_739 | 174 |
| 302 | 3300005518 | Ga0070699_100010912 | Ga0070699_1000109128 | 175 |
| 303 | 3300049572 | Ga0501036_0373888 | Ga0501036_0373888_418_954 | 175 |
| 304 | 3300049576 | Ga0501040_0139100 | Ga0501040_0139100_388_924 | 175 |
| 305 | 3300049577 | Ga0501041_0666038 | Ga0501041_0666038_68_604 | 175 |
| 306 | 3300049578 | Ga0501042_0555637 | Ga0501042_0555637_205_741 | 175 |
| 307 | 3300049584 | Ga0501068_0734910 | Ga0501068_0734910_27_563 | 175 |
| 308 | 3300049587 | Ga0501071_0546027 | Ga0501071_0546027_262_798 | 175 |
| 309 | 3300049588 | Ga0501072_0525372 | Ga0501072_0525372_166_699 | 175 |
| 310 | 3300049589 | Ga0501073_0524207 | Ga0501073_0524207_146_682 | 175 |
| 311 | 3300049593 | Ga0501077_0338889 | Ga0501077_0338889_281_817 | 175 |
| 312 | 3300049743 | Ga0501081_0226729 | Ga0501081_0226729_316_849 | 175 |
| 313 | 3300050507 | nmdc:mga05p37_490111_c1 | nmdc:mga05p37_490111_c1_41_568 | 175 |
| 314 | 3300050512 | nmdc:mga0n895_152970_c1 | nmdc:mga0n895_152970_c1_200_727 | 175 |
| 315 | 3300054114 | Ga0501084_0128065 | Ga0501084_0128065_1072_1605 | 175 |
| 316 | 3300061734 | Ga0530510_0145834 | Ga0530510_0145834_917_1450 | 175 |
| 317 | 3300005340 | Ga0070689_100031016 | Ga0070689_1000310162 | 176 |
| 318 | 3300005344 | Ga0070661_100408336 | Ga0070661_1004083362 | 176 |
| 319 | 3300005355 | Ga0070671_100008828 | Ga0070671_1000088283 | 176 |
| 320 | 3300005364 | Ga0070673_100001201 | Ga0070673_1000012016 | 176 |
| 321 | 3300005365 | Ga0070688_100877494 | Ga0070688_1008774941 | 176 |
| 322 | 3300005366 | Ga0070659_100676763 | Ga0070659_1006767631 | 176 |
| 323 | 3300005434 | Ga0070709_10060095 | Ga0070709_100600952 | 176 |
| 324 | 3300005435 | Ga0070714_100219268 | Ga0070714_1002192682 | 176 |
| 325 | 3300005439 | Ga0070711_100013397 | Ga0070711_1000133972 | 176 |
| 326 | 3300005441 | Ga0070700_100295107 | Ga0070700_1002951071 | 176 |
| 327 | 3300005543 | Ga0070672_100474338 | Ga0070672_1004743382 | 176 |
| 328 | 3300005548 | Ga0070665_100022370 | Ga0070665_1000223705 | 176 |
| 329 | 3300005564 | Ga0070664_100066665 | Ga0070664_1000666652 | 176 |
| 330 | 3300005937 | Ga0081455_10004266 | Ga0081455_100042664 | 176 |
| 331 | 3300006028 | Ga0070717_10089423 | Ga0070717_100894233 | 176 |
| 332 | 3300006163 | Ga0070715_10223736 | Ga0070715_102237361 | 176 |
| 333 | 3300006175 | Ga0070712_100136840 | Ga0070712_1001368402 | 176 |
| 334 | 3300006844 | Ga0075428_100293518 | Ga0075428_1002935182 | 176 |
| 335 | 3300006914 | Ga0075436_100432692 | Ga0075436_1004326922 | 176 |
| 336 | 3300009098 | Ga0105245_10081905 | Ga0105245_100819052 | 176 |
| 337 | 3300009147 | Ga0114129_10085787 | Ga0114129_100857872 | 176 |
| 338 | 3300009177 | Ga0105248_10572491 | Ga0105248_105724912 | 176 |
| 339 | 3300010375 | Ga0105239_12125316 | Ga0105239_121253161 | 176 |
| 340 | 3300013296 | Ga0157374_10396425 | Ga0157374_103964252 | 176 |
| 341 | 3300014969 | Ga0157376_10215211 | Ga0157376_102152112 | 176 |
| 342 | 3300024225 | Ga0224572_1004051 | Ga0224572_10040513 | 176 |
| 343 | 3300025903 | Ga0207680_10034222 | Ga0207680_100342222 | 176 |
| 344 | 3300025915 | Ga0207693_10108189 | Ga0207693_101081893 | 176 |
| 345 | 3300025920 | Ga0207649_10422325 | Ga0207649_104223252 | 176 |
| 346 | 3300025925 | Ga0207650_10005544 | Ga0207650_100055442 | 176 |
| 347 | 3300025927 | Ga0207687_10269566 | Ga0207687_102695662 | 176 |
| 348 | 3300025929 | Ga0207664_10210796 | Ga0207664_102107962 | 176 |
| 349 | 3300025931 | Ga0207644_10007129 | Ga0207644_100071292 | 176 |
| 350 | 3300025939 | Ga0207665_11067924 | Ga0207665_110679241 | 176 |
| 351 | 3300025940 | Ga0207691_10264317 | Ga0207691_102643172 | 176 |
| 352 | 3300025960 | Ga0207651_10002667 | Ga0207651_100026676 | 176 |
| 353 | 3300026075 | Ga0207708_10776531 | Ga0207708_107765312 | 176 |
| 354 | 3300031090 | Ga0265760_10206260 | Ga0265760_102062601 | 176 |
| 355 | 3300032005 | Ga0307411_10704088 | Ga0307411_107040882 | 176 |
| 356 | 3300037466 | Ga0395898_0462021 | Ga0395898_0462021_258_806 | 176 |
| 357 | 3300046472 | Ga0495580_0385976 | Ga0495580_0385976_244_792 | 176 |
| 358 | 3300046615 | Ga0495656_0296732 | Ga0495656_0296732_199_729 | 176 |
| 359 | 3300048903 | Ga0496100_0093967 | Ga0496100_0093967_678_1217 | 176 |
| 360 | 3300048904 | Ga0496101_0347486 | Ga0496101_0347486_202_741 | 176 |
| 361 | 3300048905 | Ga0496102_0211968 | Ga0496102_0211968_1063_1602 | 176 |
| 362 | 3300048907 | Ga0496104_0529918 | Ga0496104_0529918_523_1062 | 176 |
| 363 | 3300048911 | Ga0496108_0062109 | Ga0496108_0062109_1812_2351 | 176 |
| 364 | 3300048912 | Ga0496109_0154622 | Ga0496109_0154622_1411_1950 | 176 |
| 365 | 3300048915 | Ga0496112_0017973 | Ga0496112_0017973_2585_3124 | 176 |
| 366 | 3300048918 | Ga0496115_0109730 | Ga0496115_0109730_443_982 | 176 |
| 367 | 3300049585 | Ga0501069_0149985 | Ga0501069_0149985_243_794 | 176 |
| 368 | 3300050507 | nmdc:mga05p37_119648_c1 | nmdc:mga05p37_119648_c1_620_1162 | 176 |
| 369 | 3300050510 | nmdc:mga06r32_96528_c1 | nmdc:mga06r32_96528_c1_430_1005 | 176 |
| 370 | 3300050511 | nmdc:mga08y16_98122_c1 | nmdc:mga08y16_98122_c1_1687_2235 | 176 |
| 371 | 3300006844 | Ga0075428_100079122 | Ga0075428_1000791222 | 177 |
| 372 | 3300006846 | Ga0075430_100014469 | Ga0075430_1000144695 | 177 |
| 373 | 3300006847 | Ga0075431_100065054 | Ga0075431_1000650543 | 177 |
| 374 | 3300006880 | Ga0075429_100075491 | Ga0075429_1000754912 | 177 |
| 375 | 3300009147 | Ga0114129_10057918 | Ga0114129_100579184 | 177 |
| 376 | 3300039437 | Ga0436365_0861925 | Ga0436365_0861925_945_1481 | 177 |
| 377 | 3300050509 | nmdc:mga0qj67_129176_c1 | nmdc:mga0qj67_129176_c1_34_606 | 177 |
| 378 | 3300050510 | nmdc:mga06r32_57410_c1 | nmdc:mga06r32_57410_c1_1218_1790 | 177 |
| 379 | 3300005937 | Ga0081455_10155489 | Ga0081455_101554892 | 178 |
| 380 | 3300060353 | Ga0501082_1414054 | Ga0501082_1414054_10_552 | 178 |
| 381 | 3300005985 | Ga0081539_10127693 | Ga0081539_101276932 | 179 |
| 382 | 3300006844 | Ga0075428_100365810 | Ga0075428_1003658102 | 179 |
| 383 | 3300048904 | Ga0496101_0065397 | Ga0496101_0065397_1828_2370 | 179 |
| 384 | 3300048905 | Ga0496102_0218287 | Ga0496102_0218287_361_903 | 179 |
| 385 | 3300048907 | Ga0496104_0165830 | Ga0496104_0165830_498_1040 | 179 |
| 386 | 3300048908 | Ga0496105_0014065 | Ga0496105_0014065_2004_2546 | 179 |
| 387 | 3300048909 | Ga0496106_0088290 | Ga0496106_0088290_1216_1758 | 179 |
| 388 | 3300048911 | Ga0496108_0079229 | Ga0496108_0079229_2180_2722 | 179 |
| 389 | 3300048912 | Ga0496109_0041456 | Ga0496109_0041456_3437_3979 | 179 |
| 390 | 3300048917 | Ga0496114_0211910 | Ga0496114_0211910_851_1393 | 179 |
| 391 | 3300048918 | Ga0496115_0109006 | Ga0496115_0109006_447_989 | 179 |
| 392 | 3300005468 | Ga0070707_100659487 | Ga0070707_1006594872 | 180 |
| 393 | 3300005471 | Ga0070698_100311306 | Ga0070698_1003113062 | 180 |
| 394 | 3300005471 | Ga0070698_100321261 | Ga0070698_1003212611 | 180 |
| 395 | 3300006028 | Ga0070717_10568292 | Ga0070717_105682922 | 180 |
| 396 | 3300006038 | Ga0075365_10005277 | Ga0075365_100052773 | 180 |
| 397 | 3300006038 | Ga0075365_10021240 | Ga0075365_100212403 | 180 |
| 398 | 3300006038 | Ga0075365_10067871 | Ga0075365_100678713 | 180 |
| 399 | 3300006177 | Ga0075362_10013822 | Ga0075362_100138222 | 180 |
| 400 | 3300006178 | Ga0075367_10166876 | Ga0075367_101668763 | 180 |
| 401 | 3300006178 | Ga0075367_10247500 | Ga0075367_102475002 | 180 |
| 402 | 3300006844 | Ga0075428_100208080 | Ga0075428_1002080802 | 180 |
| 403 | 3300006847 | Ga0075431_100054344 | Ga0075431_1000543442 | 180 |
| 404 | 3300010159 | Ga0099796_10049027 | Ga0099796_100490272 | 180 |
| 405 | 3300013296 | Ga0157374_10344496 | Ga0157374_103444963 | 180 |
| 406 | 3300048913 | Ga0496110_0103118 | Ga0496110_0103118_921_1496 | 180 |
| 407 | 3300048914 | Ga0496111_0789668 | Ga0496111_0789668_98_673 | 180 |
| 408 | 3300049575 | Ga0501039_0421149 | Ga0501039_0421149_98_643 | 180 |
| 409 | 3300050492 | nmdc:mga0yw44_138296_c1 | nmdc:mga0yw44_138296_c1_473_1030 | 180 |
| 410 | 3300050492 | nmdc:mga0yw44_84092_c1 | nmdc:mga0yw44_84092_c1_79_621 | 180 |
| 411 | 3300050494 | nmdc:mga06z11_190051_c1 | nmdc:mga06z11_190051_c1_316_858 | 180 |
| 412 | 3300050494 | nmdc:mga06z11_327969_c1 | nmdc:mga06z11_327969_c1_96_638 | 180 |
| 413 | 3300050496 | nmdc:mga07m45_287092_c1 | nmdc:mga07m45_287092_c1_45_587 | 180 |
| 414 | 3300006175 | Ga0070712_100216717 | Ga0070712_1002167172 | 181 |
| 415 | 3300025915 | Ga0207693_10289271 | Ga0207693_102892712 | 181 |
| 416 | 3300001976 | JGI24752J21851_1019655 | JGI24752J21851_10196552 | 182 |
| 417 | 3300002070 | JGI24750J21931_1001978 | JGI24750J21931_10019783 | 182 |
| 418 | 3300002077 | JGI24744J21845_10034474 | JGI24744J21845_100344742 | 182 |
| 419 | 3300002244 | JGI24742J22300_10003043 | JGI24742J22300_100030433 | 182 |
| 420 | 3300005328 | Ga0070676_10108049 | Ga0070676_101080492 | 182 |
| 421 | 3300005329 | Ga0070683_100030265 | Ga0070683_1000302654 | 182 |
| 422 | 3300005330 | Ga0070690_100046379 | Ga0070690_1000463792 | 182 |
| 423 | 3300005331 | Ga0070670_100120832 | Ga0070670_1001208322 | 182 |
| 424 | 3300005337 | Ga0070682_100475469 | Ga0070682_1004754692 | 182 |
| 425 | 3300005338 | Ga0068868_100061110 | Ga0068868_1000611103 | 182 |
| 426 | 3300005340 | Ga0070689_100114138 | Ga0070689_1001141382 | 182 |
| 427 | 3300005344 | Ga0070661_100120477 | Ga0070661_1001204773 | 182 |
| 428 | 3300005345 | Ga0070692_10087939 | Ga0070692_100879392 | 182 |
| 429 | 3300005347 | Ga0070668_100076385 | Ga0070668_1000763852 | 182 |
| 430 | 3300005353 | Ga0070669_100045369 | Ga0070669_1000453692 | 182 |
| 431 | 3300005354 | Ga0070675_100094996 | Ga0070675_1000949963 | 182 |
| 432 | 3300005354 | Ga0070675_100375806 | Ga0070675_1003758062 | 182 |
| 433 | 3300005355 | Ga0070671_100023958 | Ga0070671_1000239584 | 182 |
| 434 | 3300005356 | Ga0070674_100058076 | Ga0070674_1000580762 | 182 |
| 435 | 3300005364 | Ga0070673_100136315 | Ga0070673_1001363153 | 182 |
| 436 | 3300005364 | Ga0070673_100159417 | Ga0070673_1001594172 | 182 |
| 437 | 3300005365 | Ga0070688_100042693 | Ga0070688_1000426932 | 182 |
| 438 | 3300005367 | Ga0070667_100348764 | Ga0070667_1003487642 | 182 |
| 439 | 3300005435 | Ga0070714_100050724 | Ga0070714_1000507243 | 182 |
| 440 | 3300005436 | Ga0070713_100031727 | Ga0070713_1000317272 | 182 |
| 441 | 3300005436 | Ga0070713_100364117 | Ga0070713_1003641172 | 182 |
| 442 | 3300005439 | Ga0070711_100040555 | Ga0070711_1000405553 | 182 |
| 443 | 3300005441 | Ga0070700_100021470 | Ga0070700_1000214703 | 182 |
| 444 | 3300005445 | Ga0070708_101447880 | Ga0070708_1014478801 | 182 |
| 445 | 3300005456 | Ga0070678_100162597 | Ga0070678_1001625972 | 182 |
| 446 | 3300005457 | Ga0070662_100130996 | Ga0070662_1001309961 | 182 |
| 447 | 3300005458 | Ga0070681_10563689 | Ga0070681_105636891 | 182 |
| 448 | 3300005459 | Ga0068867_100055798 | Ga0068867_1000557981 | 182 |
| 449 | 3300005471 | Ga0070698_100479724 | Ga0070698_1004797241 | 182 |
| 450 | 3300005518 | Ga0070699_100464878 | Ga0070699_1004648781 | 182 |
| 451 | 3300005535 | Ga0070684_100077477 | Ga0070684_1000774773 | 182 |
| 452 | 3300005539 | Ga0068853_100104501 | Ga0068853_1001045012 | 182 |
| 453 | 3300005543 | Ga0070672_100017904 | Ga0070672_1000179044 | 182 |
| 454 | 3300005544 | Ga0070686_100020737 | Ga0070686_1000207374 | 182 |
| 455 | 3300005546 | Ga0070696_100198683 | Ga0070696_1001986832 | 182 |
| 456 | 3300005548 | Ga0070665_100118422 | Ga0070665_1001184222 | 182 |
| 457 | 3300005563 | Ga0068855_100260698 | Ga0068855_1002606982 | 182 |
| 458 | 3300005564 | Ga0070664_100158856 | Ga0070664_1001588562 | 182 |
| 459 | 3300005578 | Ga0068854_100359210 | Ga0068854_1003592102 | 182 |
| 460 | 3300005615 | Ga0070702_100038949 | Ga0070702_1000389492 | 182 |
| 461 | 3300005616 | Ga0068852_100069202 | Ga0068852_1000692023 | 182 |
| 462 | 3300005617 | Ga0068859_100108026 | Ga0068859_1001080263 | 182 |
| 463 | 3300005618 | Ga0068864_100184046 | Ga0068864_1001840462 | 182 |
| 464 | 3300005718 | Ga0068866_10034411 | Ga0068866_100344113 | 182 |
| 465 | 3300005719 | Ga0068861_100053204 | Ga0068861_1000532043 | 182 |
| 466 | 3300005840 | Ga0068870_10008986 | Ga0068870_100089862 | 182 |
| 467 | 3300005841 | Ga0068863_100107060 | Ga0068863_1001070602 | 182 |
| 468 | 3300005842 | Ga0068858_100033133 | Ga0068858_1000331335 | 182 |
| 469 | 3300005843 | Ga0068860_100079778 | Ga0068860_1000797782 | 182 |
| 470 | 3300005844 | Ga0068862_100044328 | Ga0068862_1000443284 | 182 |
| 471 | 3300005937 | Ga0081455_10196255 | Ga0081455_101962551 | 182 |
| 472 | 3300005983 | Ga0081540_1007964 | Ga0081540_10079644 | 182 |
| 473 | 3300006028 | Ga0070717_10075127 | Ga0070717_100751271 | 182 |
| 474 | 3300006038 | Ga0075365_10130672 | Ga0075365_101306722 | 182 |
| 475 | 3300006163 | Ga0070715_10003065 | Ga0070715_100030654 | 182 |
| 476 | 3300006173 | Ga0070716_100229831 | Ga0070716_1002298312 | 182 |
| 477 | 3300006237 | Ga0097621_100090043 | Ga0097621_1000900433 | 182 |
| 478 | 3300006358 | Ga0068871_100174461 | Ga0068871_1001744613 | 182 |
| 479 | 3300006844 | Ga0075428_100005580 | Ga0075428_1000055807 | 182 |
| 480 | 3300006847 | Ga0075431_100272313 | Ga0075431_1002723133 | 182 |
| 481 | 3300006847 | Ga0075431_100985753 | Ga0075431_1009857532 | 182 |
| 482 | 3300006871 | Ga0075434_100015883 | Ga0075434_1000158837 | 182 |
| 483 | 3300006881 | Ga0068865_100050171 | Ga0068865_1000501712 | 182 |
| 484 | 3300006914 | Ga0075436_100099569 | Ga0075436_1000995692 | 182 |
| 485 | 3300006914 | Ga0075436_100379075 | Ga0075436_1003790752 | 182 |
| 486 | 3300006931 | Ga0097620_100108031 | Ga0097620_1001080313 | 182 |
| 487 | 3300007076 | Ga0075435_100212545 | Ga0075435_1002125452 | 182 |
| 488 | 3300007076 | Ga0075435_100593983 | Ga0075435_1005939832 | 182 |
| 489 | 3300007265 | Ga0099794_10075565 | Ga0099794_100755652 | 182 |
| 490 | 3300009094 | Ga0111539_11482029 | Ga0111539_114820292 | 182 |
| 491 | 3300009147 | Ga0114129_10268007 | Ga0114129_102680072 | 182 |
| 492 | 3300013306 | Ga0163162_10765115 | Ga0163162_107651152 | 182 |
| 493 | 3300017792 | Ga0163161_10175555 | Ga0163161_101755552 | 182 |
| 494 | 3300025315 | Ga0207697_10052539 | Ga0207697_100525393 | 182 |
| 495 | 3300025321 | Ga0207656_10035880 | Ga0207656_100358803 | 182 |
| 496 | 3300025901 | Ga0207688_10002481 | Ga0207688_100024815 | 182 |
| 497 | 3300025903 | Ga0207680_10202603 | Ga0207680_102026032 | 182 |
| 498 | 3300025907 | Ga0207645_10009079 | Ga0207645_100090792 | 182 |
| 499 | 3300025908 | Ga0207643_10010475 | Ga0207643_100104754 | 182 |
| 500 | 3300025911 | Ga0207654_10201254 | Ga0207654_102012542 | 182 |
| 501 | 3300025914 | Ga0207671_10056891 | Ga0207671_100568912 | 182 |
| 502 | 3300025915 | Ga0207693_10018047 | Ga0207693_100180472 | 182 |
| 503 | 3300025915 | Ga0207693_10019443 | Ga0207693_100194433 | 182 |
| 504 | 3300025915 | Ga0207693_10054732 | Ga0207693_100547323 | 182 |
| 505 | 3300025916 | Ga0207663_10067641 | Ga0207663_100676413 | 182 |
| 506 | 3300025918 | Ga0207662_10010556 | Ga0207662_100105562 | 182 |
| 507 | 3300025919 | Ga0207657_10035303 | Ga0207657_100353034 | 182 |
| 508 | 3300025920 | Ga0207649_10071654 | Ga0207649_100716543 | 182 |
| 509 | 3300025925 | Ga0207650_10004077 | Ga0207650_100040778 | 182 |
| 510 | 3300025926 | Ga0207659_10300450 | Ga0207659_103004502 | 182 |
| 511 | 3300025927 | Ga0207687_10200921 | Ga0207687_102009212 | 182 |
| 512 | 3300025928 | Ga0207700_10309016 | Ga0207700_103090162 | 182 |
| 513 | 3300025928 | Ga0207700_10366074 | Ga0207700_103660741 | 182 |
| 514 | 3300025931 | Ga0207644_10137532 | Ga0207644_101375323 | 182 |
| 515 | 3300025932 | Ga0207690_10222037 | Ga0207690_102220372 | 182 |
| 516 | 3300025932 | Ga0207690_10224390 | Ga0207690_102243902 | 182 |
| 517 | 3300025933 | Ga0207706_10014540 | Ga0207706_100145402 | 182 |
| 518 | 3300025934 | Ga0207686_10125170 | Ga0207686_101251702 | 182 |
| 519 | 3300025935 | Ga0207709_10301907 | Ga0207709_103019072 | 182 |
| 520 | 3300025936 | Ga0207670_10450573 | Ga0207670_104505731 | 182 |
| 521 | 3300025936 | Ga0207670_10530357 | Ga0207670_105303572 | 182 |
| 522 | 3300025937 | Ga0207669_10110399 | Ga0207669_101103992 | 182 |
| 523 | 3300025938 | Ga0207704_10107147 | Ga0207704_101071472 | 182 |
| 524 | 3300025939 | Ga0207665_10001380 | Ga0207665_100013805 | 182 |
| 525 | 3300025940 | Ga0207691_10003955 | Ga0207691_100039559 | 182 |
| 526 | 3300025941 | Ga0207711_10227592 | Ga0207711_102275922 | 182 |
| 527 | 3300025942 | Ga0207689_10027088 | Ga0207689_100270882 | 182 |
| 528 | 3300025944 | Ga0207661_10163673 | Ga0207661_101636732 | 182 |
| 529 | 3300025945 | Ga0207679_10111382 | Ga0207679_101113822 | 182 |
| 530 | 3300025960 | Ga0207651_10101366 | Ga0207651_101013662 | 182 |
| 531 | 3300025961 | Ga0207712_10071332 | Ga0207712_100713323 | 182 |
| 532 | 3300025972 | Ga0207668_10055888 | Ga0207668_100558882 | 182 |
| 533 | 3300025972 | Ga0207668_10595242 | Ga0207668_105952422 | 182 |
| 534 | 3300025981 | Ga0207640_10050588 | Ga0207640_100505882 | 182 |
| 535 | 3300026023 | Ga0207677_10252401 | Ga0207677_102524012 | 182 |
| 536 | 3300026035 | Ga0207703_11014702 | Ga0207703_110147022 | 182 |
| 537 | 3300026067 | Ga0207678_10021417 | Ga0207678_100214172 | 182 |
| 538 | 3300026075 | Ga0207708_10005365 | Ga0207708_100053655 | 182 |
| 539 | 3300026089 | Ga0207648_10011418 | Ga0207648_100114184 | 182 |
| 540 | 3300026095 | Ga0207676_10135032 | Ga0207676_101350323 | 182 |
| 541 | 3300026118 | Ga0207675_100008064 | Ga0207675_1000080645 | 182 |
| 542 | 3300026121 | Ga0207683_10064788 | Ga0207683_100647883 | 182 |
| 543 | 3300026142 | Ga0207698_10283235 | Ga0207698_102832352 | 182 |
| 544 | 3300027907 | Ga0207428_10333773 | Ga0207428_103337732 | 182 |
| 545 | 3300028379 | Ga0268266_11356995 | Ga0268266_113569952 | 182 |
| 546 | 3300028380 | Ga0268265_10216840 | Ga0268265_102168403 | 182 |
| 547 | 3300028381 | Ga0268264_10154036 | Ga0268264_101540363 | 182 |
| 548 | 3300038443 | Ga0395901_1102196 | Ga0395901_1102196_22_585 | 182 |
| 549 | 3300039447 | Ga0436361_0555100 | Ga0436361_0555100_1248_1802 | 182 |
| 550 | 3300048903 | Ga0496100_0048861 | Ga0496100_0048861_2145_2696 | 182 |
| 551 | 3300048903 | Ga0496100_0789860 | Ga0496100_0789860_77_628 | 182 |
| 552 | 3300048904 | Ga0496101_0091551 | Ga0496101_0091551_1230_1781 | 182 |
| 553 | 3300048905 | Ga0496102_0181998 | Ga0496102_0181998_860_1411 | 182 |
| 554 | 3300048907 | Ga0496104_0075910 | Ga0496104_0075910_1270_1821 | 182 |
| 555 | 3300048908 | Ga0496105_0027183 | Ga0496105_0027183_905_1456 | 182 |
| 556 | 3300048908 | Ga0496105_0820982 | Ga0496105_0820982_107_658 | 182 |
| 557 | 3300048909 | Ga0496106_0118723 | Ga0496106_0118723_1445_1996 | 182 |
| 558 | 3300048910 | Ga0496107_0022278 | Ga0496107_0022278_2169_2720 | 182 |
| 559 | 3300048910 | Ga0496107_0120440 | Ga0496107_0120440_1059_1610 | 182 |
| 560 | 3300048911 | Ga0496108_0029188 | Ga0496108_0029188_2727_3278 | 182 |
| 561 | 3300048912 | Ga0496109_0020360 | Ga0496109_0020360_3801_4352 | 182 |
| 562 | 3300048913 | Ga0496110_0031616 | Ga0496110_0031616_2727_3278 | 182 |
| 563 | 3300048914 | Ga0496111_0003120 | Ga0496111_0003120_7340_7891 | 182 |
| 564 | 3300048914 | Ga0496111_0174392 | Ga0496111_0174392_454_1008 | 182 |
| 565 | 3300048915 | Ga0496112_0016600 | Ga0496112_0016600_2551_3102 | 182 |
| 566 | 3300048915 | Ga0496112_0716776 | Ga0496112_0716776_87_638 | 182 |
| 567 | 3300048915 | Ga0496112_1037394 | Ga0496112_1037394_95_649 | 182 |
| 568 | 3300048916 | Ga0496113_0001270 | Ga0496113_0001270_2486_3037 | 182 |
| 569 | 3300048918 | Ga0496115_0190094 | Ga0496115_0190094_408_959 | 182 |
| 570 | 3300050510 | nmdc:mga06r32_958259_c1 | nmdc:mga06r32_958259_c1_96_647 | 182 |
| 571 | 3300050511 | nmdc:mga08y16_293005_c1 | nmdc:mga08y16_293005_c1_1054_1605 | 182 |
| 572 | 3300050512 | nmdc:mga0n895_33053_c1 | nmdc:mga0n895_33053_c1_3473_4024 | 182 |
| 573 | 3300050512 | nmdc:mga0n895_427962_c1 | nmdc:mga0n895_427962_c1_103_654 | 182 |
| 574 | 3300050515 | nmdc:mga0a205_319649_c1 | nmdc:mga0a205_319649_c1_159_713 | 182 |
| 575 | 3300053083 | Ga0495655_0012017 | Ga0495655_0012017_412_960 | 182 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7zx8-assembly1.cif.gz_c | structure of snapc containing pol ii pre-initiation complex bound to u1 snrna promoter (oc) | 0.9285 | 84 | 131 |
| 6ryp-assembly1.cif.gz_A | bacterial membrane enzyme structure by the in meso method at 2.3 a resolution | 0.8632 | 23 | 173 |
| 6ryo-assembly1.cif.gz_A | bacterial membrane enzyme structure by the in meso method at 1.9 a resolution | 0.8376 | 23 | 175 |
| 6fms-assembly2.cif.gz_B | imisx-ep of se-lspa | 0.8328 | 22 | 169 |
| 5dir-assembly4.cif.gz_D | membrane protein at 2.8 angstroms | 0.831 | 25 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P00804_15_157_3.90.1420.10 | Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain | 0.9139 | 29 | 174 | 3.90.1420.10 |
| af_P00804_15_157_3.90.1420.10 | Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain | 0.9018 | 29 | 174 | 3.90.1420.10 |
| af_Q2FZ79_13_152_3.90.1420.10 | Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain | 0.8378 | 29 | 173 | 3.90.1420.10 |
| af_Q2FZ79_13_152_3.90.1420.10 | Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain | 0.8215 | 29 | 173 | 3.90.1420.10 |
| af_P9WK99_39_178_3.90.1420.10 | Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain | 0.8097 | 29 | 173 | 3.90.1420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H2E9T9-F1-model_v4 | Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) | 0.9843 | 16 | 172 |
GO:0004190
GO:0005886 GO:0006508 |
| AF-A0A2D8RYR1-F1-model_v4 | Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) | 0.9815 | 16 | 174 |
GO:0004190
GO:0005886 GO:0006508 |
| AF-B8IB41-F1-model_v4 | Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) | 0.9679 | 22 | 173 |
GO:0004190
GO:0005886 GO:0006508 |
| AF-A0A5E4NZU5-F1-model_v4 | Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) | 0.967 | 22 | 176 |
GO:0004190
GO:0005886 GO:0006508 |
| AF-A0A2E5BNL6-F1-model_v4 | Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) | 0.9655 | 11 | 178 |
GO:0004190
GO:0005886 GO:0006508 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar