F465343

General Info

Members Datasets Scaffolds Average Seq Length
574 266 573 219

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0020585|Ga0501031_0020585_841_1500
Length 208
Sequence MKFFLDTANLDELKKGAAWGIVDGVTTNPSLIAKEGVAIEEQIRRICDIIDGDISAEVVSLEADEMVREGRRLASIHKNVVVKLPLTRDGIRACSTLCFSAGQALLAAKAGAYIISPFIGRLDDIGTAGMNLIQDIVTIYRNYGYPTQILAASLRSPMHVIDSAKAGAHIGTMPFKVLDMLFQHPLTDKGLDQFLKDYAKAFQPAAAR

Samples

Sample ID Description Type Environment
1 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
239 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.39
Metatranscriptomes 2.44
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 0.7
Rhizosphere 95.12
Stem 0
Stem Tuber 0
Unclassified 4.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058862_11102382 3300004803 Bacteria 838
2 Ga0070683_100000032 3300005329 Bacteria 148421
3 Ga0070683_100003090 3300005329 Bacteria 13403
4 Ga0070683_100022080 3300005329 Bacteria 5684
5 Ga0070683_100279463 3300005329 Unclassified 1588
6 Ga0070690_100079933 3300005330 Bacteria 2138
7 Ga0068869_100001087 3300005334 Bacteria 15859
8 Ga0068869_100136967 3300005334 Bacteria 1887
9 Ga0070666_10099084 3300005335 Bacteria 2007
10 Ga0070680_100147107 3300005336 Unclassified 1977
11 Ga0070660_100012269 3300005339 Bacteria 6115
12 Ga0070660_100400902 3300005339 Bacteria 1134
13 Ga0070689_100242992 3300005340 Bacteria 1483
14 Ga0070691_10000650 3300005341 Bacteria 13440
15 Ga0070661_100092140 3300005344 Bacteria 2245
16 Ga0070661_100401274 3300005344 Bacteria 1084
17 Ga0070692_10345475 3300005345 Bacteria 923
18 Ga0070669_100535688 3300005353 Archaea 975
19 Ga0070671_100213255 3300005355 Bacteria 1638
20 Ga0070673_100221459 3300005364 Bacteria 1638
21 Ga0070659_100110236 3300005366 Bacteria 2221
22 Ga0070709_10048432 3300005434 Bacteria 2652
23 Ga0070714_100003583 3300005435 Bacteria 11616
24 Ga0070714_100405717 3300005435 Unclassified 1289
25 Ga0070713_100008969 3300005436 Bacteria 7127
26 Ga0070713_100270060 3300005436 Unclassified 1557
27 Ga0070711_100018991 3300005439 Bacteria 4400
28 Ga0070711_100041883 3300005439 Bacteria 3094
29 Ga0070711_100088814 3300005439 Unclassified 2222
30 Ga0070711_100137523 3300005439 Bacteria 1828
31 Ga0070711_100190425 3300005439 Unclassified 1576
32 Ga0070711_100316215 3300005439 Bacteria 1246
33 Ga0070705_100253711 3300005440 Bacteria 1236
34 Ga0070678_100231488 3300005456 Bacteria 1541
35 Ga0070678_100318559 3300005456 Bacteria 1327
36 Ga0070678_100344802 3300005456 Bacteria 1279
37 Ga0070678_100438182 3300005456 Archaea 1142
38 Ga0070678_100616739 3300005456 Bacteria 970
39 Ga0070662_100130844 3300005457 Bacteria 1934
40 Ga0070681_10007857 3300005458 Bacteria 10433
41 Ga0070681_10018766 3300005458 Bacteria 6922
42 Ga0070681_10301085 3300005458 Bacteria 1513
43 Ga0068867_100173958 3300005459 Bacteria 1707
44 Ga0070685_10138169 3300005466 Archaea 1531
45 Ga0070685_10251352 3300005466 Bacteria 1171
46 Ga0070706_100091523 3300005467 Bacteria 2821
47 Ga0070698_100592055 3300005471 Bacteria 1049
48 Ga0070699_100190857 3300005518 Bacteria 1820
49 Ga0070679_100005785 3300005530 Bacteria 11471
50 Ga0070679_100425086 3300005530 Bacteria 1274
51 Ga0070679_100507976 3300005530 Bacteria 1149
52 Ga0070684_100000046 3300005535 Bacteria 83793
53 Ga0070684_100000438 3300005535 Bacteria 28577
54 Ga0070684_100017985 3300005535 Bacteria 5812
55 Ga0070684_100042197 3300005535 Bacteria 3937
56 Ga0070684_100079691 3300005535 Bacteria 2895
57 Ga0070684_100380024 3300005535 Bacteria 1301
58 Ga0070684_100692085 3300005535 Bacteria 950
59 Ga0070684_100861522 3300005535 Bacteria 848
60 Ga0070697_100634610 3300005536 Unclassified 940
61 Ga0068853_100146800 3300005539 Bacteria 2120
62 Ga0068853_100384599 3300005539 Bacteria 1311
63 Ga0070672_100565183 3300005543 Bacteria 988
64 Ga0070696_100004136 3300005546 Bacteria 9674
65 Ga0070696_100026436 3300005546 Bacteria 3948
66 Ga0070693_100021984 3300005547 Bacteria 3385
67 Ga0068855_100002651 3300005563 Bacteria 22053
68 Ga0070664_100023571 3300005564 Bacteria 5084
69 Ga0068857_100048200 3300005577 Bacteria 3783
70 Ga0068857_100287702 3300005577 Bacteria 1513
71 Ga0068854_100017963 3300005578 Bacteria 4740
72 Ga0068856_100039231 3300005614 Bacteria 4649
73 Ga0068856_100098934 3300005614 Bacteria 2908
74 Ga0068856_100607538 3300005614 Unclassified 1115
75 Ga0068852_100007445 3300005616 Bacteria 7990
76 Ga0068852_100037441 3300005616 Bacteria 4067
77 Ga0068859_100507014 3300005617 Bacteria 1302
78 Ga0068859_100531212 3300005617 Bacteria 1271
79 Ga0068859_101339455 3300005617 Unclassified 789
80 Ga0068851_10136571 3300005834 Bacteria 1330
81 Ga0068863_100211914 3300005841 Bacteria 1866
82 Ga0068863_100262547 3300005841 Bacteria 1670
83 Ga0068858_100024769 3300005842 Bacteria 5588
84 Ga0068858_100061185 3300005842 Bacteria 3481
85 Ga0068858_100103374 3300005842 Bacteria 2658
86 Ga0068858_100227692 3300005842 Bacteria 1767
87 Ga0081540_1133072 3300005983 Bacteria 1012
88 Ga0070717_10087015 3300006028 Bacteria 2631
89 Ga0070717_10162660 3300006028 Bacteria 1937
90 Ga0070717_10439853 3300006028 Bacteria 1174
91 Ga0070716_100136935 3300006173 Bacteria 1556
92 Ga0097621_100031444 3300006237 Bacteria 4213
93 Ga0097621_100087313 3300006237 Bacteria 2604
94 Ga0097621_101066073 3300006237 Unclassified 758
95 Ga0068871_100005166 3300006358 Bacteria 9127
96 Ga0068871_100028570 3300006358 Bacteria 4373
97 Ga0068871_100070668 3300006358 Bacteria 2869
98 Ga0075431_100005373 3300006847 Bacteria 12644
99 Ga0068865_100446178 3300006881 Bacteria 1069
100 Ga0075436_100003504 3300006914 Bacteria 10757
101 Ga0075436_100405450 3300006914 Bacteria 988
102 Ga0097620_100507011 3300006931 Bacteria 1302
103 Ga0097620_100531311 3300006931 Bacteria 1271
104 Ga0097620_101339495 3300006931 Unclassified 789
105 Ga0075435_100264808 3300007076 Bacteria 1465
106 Ga0105240_10000973 3300009093 Bacteria 51092
107 Ga0105240_10012536 3300009093 Bacteria 11694
108 Ga0105240_10016249 3300009093 Bacteria 10086
109 Ga0105240_10017257 3300009093 Bacteria 9737
110 Ga0105240_10042639 3300009093 Bacteria 5781
111 Ga0105240_10043375 3300009093 Bacteria 5724
112 Ga0105240_10048236 3300009093 Bacteria 5384
113 Ga0105240_10102044 3300009093 Bacteria 3487
114 Ga0105240_11482810 3300009093 Bacteria 712
115 Ga0111539_10115439 3300009094 Archaea 3149
116 Ga0111539_10244020 3300009094 Archaea 2091
117 Ga0105245_10010618 3300009098 Bacteria 8012
118 Ga0105245_10012844 3300009098 Bacteria 7297
119 Ga0105245_10016803 3300009098 Bacteria 6389
120 Ga0105245_10138245 3300009098 Bacteria 2292
121 Ga0105245_10376045 3300009098 Bacteria 1414
122 Ga0105245_10795716 3300009098 Bacteria 983
123 Ga0105245_10941934 3300009098 Bacteria 906
124 Ga0105245_11199142 3300009098 Bacteria 807
125 Ga0105247_10219482 3300009101 Bacteria 1286
126 Ga0105243_10456285 3300009148 Bacteria 1200
127 Ga0105243_10515467 3300009148 Unclassified 1136
128 Ga0105241_10006584 3300009174 Bacteria 8557
129 Ga0105241_10024088 3300009174 Bacteria 4520
130 Ga0105241_10039207 3300009174 Bacteria 3573
131 Ga0105242_10012749 3300009176 Bacteria 6474
132 Ga0105242_11023082 3300009176 Bacteria 835
133 Ga0105248_10008816 3300009177 Bacteria 11077
134 Ga0105248_10014020 3300009177 Bacteria 8820
135 Ga0105248_10023792 3300009177 Bacteria 6809
136 Ga0105248_10033296 3300009177 Bacteria 5756
137 Ga0105248_10069890 3300009177 Bacteria 3943
138 Ga0105248_10217772 3300009177 Bacteria 2150
139 Ga0105248_10293514 3300009177 Bacteria 1831
140 Ga0105248_10854562 3300009177 Bacteria 1027
141 Ga0105248_11121974 3300009177 Unclassified 889
142 Ga0105237_10012342 3300009545 Bacteria 9001
143 Ga0105237_10014726 3300009545 Bacteria 8163
144 Ga0105237_10017252 3300009545 Bacteria 7487
145 Ga0105237_10070153 3300009545 Bacteria 3500
146 Ga0105237_10071375 3300009545 Bacteria 3467
147 Ga0105237_10167848 3300009545 Bacteria 2194
148 Ga0105237_10213449 3300009545 Bacteria 1929
149 Ga0105237_10403004 3300009545 Bacteria 1372
150 Ga0105238_10003305 3300009551 Bacteria 16105
151 Ga0105238_10018451 3300009551 Bacteria 7100
152 Ga0105238_10038449 3300009551 Bacteria 4860
153 Ga0105238_10060275 3300009551 Bacteria 3800
154 Ga0105238_10271029 3300009551 Bacteria 1678
155 Ga0105238_10480085 3300009551 Bacteria 1242
156 Ga0105238_10740745 3300009551 Bacteria 996
157 Ga0105249_10046424 3300009553 Bacteria 3953
158 Ga0105249_10243279 3300009553 Bacteria 1780
159 Ga0105249_10507465 3300009553 Bacteria 1252
160 Ga0105239_10001226 3300010375 Bacteria 34944
161 Ga0105239_10012176 3300010375 Bacteria 9590
162 Ga0105239_10018816 3300010375 Bacteria 7630
163 Ga0105239_10259517 3300010375 Bacteria 1953
164 Ga0105246_10037263 3300011119 Unclassified 3263
165 Ga0105246_10086625 3300011119 Bacteria 2246
166 Ga0157373_10191033 3300013100 Bacteria 1443
167 Ga0157371_10272218 3300013102 Bacteria 1222
168 Ga0157370_10005508 3300013104 Bacteria 14189
169 Ga0157370_10019028 3300013104 Bacteria 6903
170 Ga0157370_10296865 3300013104 Bacteria 1492
171 Ga0157370_10480089 3300013104 Bacteria 1142
172 Ga0157369_10007462 3300013105 Bacteria 12594
173 Ga0157369_10009069 3300013105 Bacteria 11386
174 Ga0157369_10025176 3300013105 Bacteria 6607
175 Ga0157369_10071151 3300013105 Bacteria 3735
176 Ga0157369_10253439 3300013105 Bacteria 1836
177 Ga0157374_10034937 3300013296 Bacteria 4596
178 Ga0157374_10098476 3300013296 Unclassified 2800
179 Ga0157374_10357714 3300013296 Bacteria 1451
180 Ga0157374_10966835 3300013296 Bacteria 870
181 Ga0157378_10013190 3300013297 Bacteria 7229
182 Ga0157378_10274389 3300013297 Bacteria 1623
183 Ga0157378_10388140 3300013297 Bacteria 1373
184 Ga0163162_10075158 3300013306 Bacteria 3439
185 Ga0163162_10255400 3300013306 Bacteria 1885
186 Ga0163162_10430069 3300013306 Bacteria 1452
187 Ga0157372_10012335 3300013307 Bacteria 9107
188 Ga0157372_10028219 3300013307 Bacteria 6125
189 Ga0157372_10031778 3300013307 Bacteria 5783
190 Ga0157372_10186434 3300013307 Bacteria 2403
191 Ga0157372_10857517 3300013307 Bacteria 1054
192 Ga0157375_10169140 3300013308 Bacteria 2332
193 Ga0157375_10606977 3300013308 Bacteria 1253
194 Ga0157375_10688238 3300013308 Bacteria 1177
195 Ga0157375_10926923 3300013308 Bacteria 1014
196 Ga0163163_10035605 3300014325 Bacteria 4830
197 Ga0163163_10038907 3300014325 Unclassified 4638
198 Ga0163163_10055059 3300014325 Bacteria 3931
199 Ga0163163_10087869 3300014325 Unclassified 3119
200 Ga0163163_10163555 3300014325 Bacteria 2271
201 Ga0163163_10208313 3300014325 Bacteria 2004
202 Ga0163163_10895910 3300014325 Bacteria 950
203 Ga0157377_10073386 3300014745 Unclassified 1983
204 Ga0157377_10224596 3300014745 Archaea 1204
205 Ga0157376_10033816 3300014969 Bacteria 4121
206 Ga0157376_10146205 3300014969 Unclassified 2126
207 Ga0157376_10299115 3300014969 Bacteria 1522
208 Ga0157376_10903158 3300014969 Bacteria 901
209 Ga0163161_10201341 3300017792 Bacteria 1534
210 Ga0206352_10686219 3300020078 Bacteria 787
211 Ga0206350_10071010 3300020080 Unclassified 871
212 Ga0154015_1217243 3300020610 Bacteria 819
213 Ga0213873_10014975 3300021358 Unclassified 1728
214 Ga0213872_10000640 3300021361 Bacteria 26458
215 Ga0213874_10002716 3300021377 Bacteria 3843
216 Ga0213876_10024426 3300021384 Bacteria 3190
217 Ga0213876_10116540 3300021384 Bacteria 1418
218 Ga0213876_10156375 3300021384 Bacteria 1213
219 Ga0213875_10000004 3300021388 Bacteria 703388
220 Ga0213875_10041027 3300021388 Unclassified 2177
221 Ga0213875_10075182 3300021388 Unclassified 1576
222 Ga0213875_10305499 3300021388 Bacteria 753
223 Ga0207656_10087850 3300025321 Bacteria 1407
224 Ga0207642_10321664 3300025899 Archaea 903
225 Ga0207688_10035047 3300025901 Archaea 2780
226 Ga0207680_10094554 3300025903 Bacteria 1908
227 Ga0207680_10156077 3300025903 Bacteria 1526
228 Ga0207647_10071013 3300025904 Archaea 2101
229 Ga0207685_10235826 3300025905 Bacteria 877
230 Ga0207699_10376108 3300025906 Bacteria 1007
231 Ga0207645_10125851 3300025907 Bacteria 1666
232 Ga0207684_10262233 3300025910 Bacteria 1491
233 Ga0207654_10010799 3300025911 Bacteria 4650
234 Ga0207654_10232002 3300025911 Bacteria 1230
235 Ga0207654_10370905 3300025911 Bacteria 989
236 Ga0207707_10004585 3300025912 Bacteria 12142
237 Ga0207707_10114410 3300025912 Bacteria 2358
238 Ga0207707_10335578 3300025912 Bacteria 1304
239 Ga0207695_10002536 3300025913 Bacteria 26833
240 Ga0207695_10003356 3300025913 Bacteria 22617
241 Ga0207695_10038753 3300025913 Bacteria 5126
242 Ga0207695_10055261 3300025913 Unclassified 4139
243 Ga0207695_10057341 3300025913 Bacteria 4047
244 Ga0207695_10116819 3300025913 Bacteria 2641
245 Ga0207671_10014487 3300025914 Bacteria 6227
246 Ga0207671_10033055 3300025914 Bacteria 3850
247 Ga0207671_10084349 3300025914 Unclassified 2386
248 Ga0207671_10139573 3300025914 Bacteria 1866
249 Ga0207671_10215406 3300025914 Bacteria 1503
250 Ga0207671_10732639 3300025914 Bacteria 786
251 Ga0207671_10776992 3300025914 Bacteria 760
252 Ga0207693_10024432 3300025915 Bacteria 4795
253 Ga0207663_10023367 3300025916 Bacteria 3547
254 Ga0207663_10027747 3300025916 Bacteria 3305
255 Ga0207663_10029461 3300025916 Bacteria 3224
256 Ga0207663_10176371 3300025916 Bacteria 1522
257 Ga0207660_10106510 3300025917 Bacteria 2102
258 Ga0207660_10377981 3300025917 Bacteria 1138
259 Ga0207662_10389782 3300025918 Unclassified 942
260 Ga0207657_10021210 3300025919 Bacteria 6120
261 Ga0207649_10078660 3300025920 Bacteria 2129
262 Ga0207652_10005239 3300025921 Bacteria 10541
263 Ga0207652_10386999 3300025921 Bacteria 1262
264 Ga0207652_10802388 3300025921 Unclassified 836
265 Ga0207694_10001736 3300025924 Bacteria 18273
266 Ga0207694_10004446 3300025924 Bacteria 10958
267 Ga0207694_10023938 3300025924 Bacteria 4638
268 Ga0207694_10425448 3300025924 Bacteria 1107
269 Ga0207694_10839081 3300025924 Bacteria 777
270 Ga0207659_10233519 3300025926 Bacteria 1485
271 Ga0207687_10000181 3300025927 Bacteria 41696
272 Ga0207687_10007479 3300025927 Bacteria 7189
273 Ga0207687_10010218 3300025927 Bacteria 6131
274 Ga0207700_10001102 3300025928 Bacteria 15557
275 Ga0207700_10270663 3300025928 Unclassified 1458
276 Ga0207664_10007557 3300025929 Bacteria 7543
277 Ga0207644_10167227 3300025931 Bacteria 1714
278 Ga0207706_10038992 3300025933 Bacteria 4214
279 Ga0207686_10017973 3300025934 Bacteria 3996
280 Ga0207686_10169909 3300025934 Bacteria 1537
281 Ga0207709_10601167 3300025935 Bacteria 871
282 Ga0207670_10084292 3300025936 Archaea 2231
283 Ga0207665_10255345 3300025939 Unclassified 1297
284 Ga0207711_10012815 3300025941 Bacteria 6965
285 Ga0207711_10013647 3300025941 Bacteria 6747
286 Ga0207711_10028899 3300025941 Bacteria 4671
287 Ga0207711_10046658 3300025941 Bacteria 3702
288 Ga0207711_10075228 3300025941 Bacteria 2938
289 Ga0207711_10116131 3300025941 Bacteria 2385
290 Ga0207711_10159254 3300025941 Bacteria 2042
291 Ga0207711_10343421 3300025941 Bacteria 1382
292 Ga0207711_10430199 3300025941 Bacteria 1228
293 Ga0207689_10003833 3300025942 Bacteria 13701
294 Ga0207689_10023577 3300025942 Bacteria 5162
295 Ga0207689_10514497 3300025942 Bacteria 1003
296 Ga0207661_10000020 3300025944 Bacteria 216011
297 Ga0207661_10041191 3300025944 Bacteria 3635
298 Ga0207661_10061694 3300025944 Bacteria 3030
299 Ga0207661_10172275 3300025944 Bacteria 1884
300 Ga0207661_10228710 3300025944 Unclassified 1646
301 Ga0207661_10246225 3300025944 Bacteria 1587
302 Ga0207661_10733690 3300025944 Unclassified 909
303 Ga0207667_10000483 3300025949 Bacteria 52728
304 Ga0207667_10001959 3300025949 Bacteria 25792
305 Ga0207667_10018123 3300025949 Bacteria 7903
306 Ga0207667_10340314 3300025949 Bacteria 1531
307 Ga0207651_10222982 3300025960 Bacteria 1525
308 Ga0207651_10356079 3300025960 Bacteria 1234
309 Ga0207712_10005026 3300025961 Bacteria 8368
310 Ga0207712_10077757 3300025961 Archaea 2406
311 Ga0207712_10118290 3300025961 Bacteria 2000
312 Ga0207668_10195484 3300025972 Archaea 1607
313 Ga0207703_10013985 3300026035 Bacteria 6257
314 Ga0207639_10140420 3300026041 Bacteria 2012
315 Ga0207639_10308434 3300026041 Bacteria 1401
316 Ga0207708_10085791 3300026075 Bacteria 2422
317 Ga0207702_10049636 3300026078 Bacteria 3541
318 Ga0207702_10078300 3300026078 Bacteria 2861
319 Ga0207702_10203219 3300026078 Bacteria 1838
320 Ga0207702_10518408 3300026078 Bacteria 1164
321 Ga0207702_11001835 3300026078 Unclassified 829
322 Ga0207641_10283025 3300026088 Bacteria 1560
323 Ga0207648_10107546 3300026089 Bacteria 2448
324 Ga0207648_11216126 3300026089 Bacteria 708
325 Ga0207676_10119584 3300026095 Unclassified 2219
326 Ga0207676_10256812 3300026095 Bacteria 1576
327 Ga0207674_10000097 3300026116 Bacteria 98549
328 Ga0207675_100190454 3300026118 Bacteria 1967
329 Ga0207675_101213003 3300026118 Bacteria 775
330 Ga0207683_10084401 3300026121 Bacteria 2823
331 Ga0207683_10497634 3300026121 Archaea 1125
332 Ga0207683_10506068 3300026121 Bacteria 1116
333 Ga0207698_10008487 3300026142 Bacteria 6502
334 Ga0207698_10043575 3300026142 Bacteria 3363
335 Ga0207698_10623013 3300026142 Unclassified 1066
336 Ga0268266_10095221 3300028379 Bacteria 2615
337 Ga0268264_10338150 3300028381 Bacteria 1429
338 Ga0265338_10536744 3300028800 Unclassified 820
339 Ga0265340_10011941 3300031247 Bacteria 4598
340 Ga0265316_10249893 3300031344 Unclassified 1302
341 Ga0265313_10002989 3300031595 Bacteria 14102
342 Ga0265314_10006965 3300031711 Bacteria 9890
343 Ga0373926_0142244 3300035083 Bacteria 911
344 Ga0373934_0012449 3300035086 Bacteria 3211
345 Ga0373934_0055210 3300035086 Bacteria 1578
346 Ga0373923_0051203 3300035111 Bacteria 1732
347 Ga0373923_0118251 3300035111 Bacteria 1182
348 Ga0373923_0187812 3300035111 Bacteria 951
349 Ga0373953_0011086 3300035117 Bacteria 3153
350 Ga0373953_0124065 3300035117 Bacteria 1098
351 Ga0373954_0002222 3300035118 Bacteria 8067
352 Ga0373954_0008895 3300035118 Bacteria 4418
353 Ga0373954_0271170 3300035118 Unclassified 836
354 Ga0373955_0022945 3300035172 Bacteria 3173
355 Ga0373955_0046978 3300035172 Unclassified 2336
356 Ga0373955_0058041 3300035172 Bacteria 2128
357 Ga0373924_0023044 3300035410 Bacteria 2438
358 Ga0373924_0229435 3300035410 Bacteria 821
359 Ga0373935_0104997 3300035692 Unclassified 1868
360 Ga0373935_0146175 3300035692 Bacteria 1601
361 Ga0373935_0299067 3300035692 Unclassified 1137
362 Ga0373935_0658183 3300035692 Bacteria 769
363 Ga0373927_0009771 3300035695 Bacteria 6434
364 Ga0373927_0092713 3300035695 Bacteria 1962
365 Ga0373927_0161306 3300035695 Bacteria 1469
366 Ga0373927_0345622 3300035695 Bacteria 980
367 Ga0373933_0011224 3300035724 Bacteria 4931
368 Ga0373933_0028156 3300035724 Bacteria 3240
369 Ga0373933_0081948 3300035724 Bacteria 1980
370 Ga0373933_0124965 3300035724 Bacteria 1613
371 Ga0373933_0151200 3300035724 Bacteria 1470
372 Ga0373933_0274071 3300035724 Bacteria 1089
373 Ga0373933_0304839 3300035724 Bacteria 1031
374 Ga0373947_0010405 3300035725 Bacteria 5338
375 Ga0373947_0112704 3300035725 Bacteria 1721
376 Ga0373947_0151570 3300035725 Bacteria 1494
377 Ga0373937_0010397 3300036401 Bacteria 8128
378 Ga0373937_0033571 3300036401 Bacteria 4661
379 Ga0373937_0058021 3300036401 Bacteria 3556
380 Ga0373937_0086984 3300036401 Unclassified 2892
381 Ga0373937_0132483 3300036401 Unclassified 2329
382 Ga0373937_0175805 3300036401 Unclassified 2010
383 Ga0373937_0220557 3300036401 Bacteria 1785
384 Ga0373937_0223875 3300036401 Bacteria 1771
385 Ga0373937_0279637 3300036401 Bacteria 1576
386 Ga0373937_0402844 3300036401 Bacteria 1298
387 Ga0373925_0013512 3300037068 Bacteria 5910
388 Ga0373925_0124157 3300037068 Unclassified 2007
389 Ga0373925_0217418 3300037068 Bacteria 1524
390 Ga0373925_0336112 3300037068 Bacteria 1224
391 Ga0395900_0052307 3300037418 Bacteria 4205
392 Ga0395898_0096440 3300037466 Bacteria 2841
393 Ga0436364_0166152 3300037853 Unclassified 868
394 Ga0436364_0368914 3300037853 Bacteria 4083
395 Ga0436364_0702152 3300037853 Bacteria 6615
396 Ga0436364_0711432 3300037853 Bacteria 4520
397 Ga0436364_0748068 3300037853 Bacteria 528910
398 Ga0436364_0799574 3300037853 Unclassified 1045
399 Ga0436364_0848422 3300037853 Bacteria 3309
400 Ga0436364_1353109 3300037853 Bacteria 10406
401 Ga0395901_0638996 3300038443 Bacteria 1069
402 Ga0436365_0404647 3300039437 Bacteria 4712
403 Ga0436365_0967668 3300039437 Bacteria 1662
404 Ga0436365_1124207 3300039437 Bacteria 1326
405 Ga0436361_1130066 3300039447 Bacteria 21265
406 Ga0436363_0421543 3300039450 Bacteria 1827
407 Ga0436363_0912388 3300039450 Unclassified 1051
408 Ga0436363_0938087 3300039450 Bacteria 4280
409 Ga0436363_1067205 3300039450 Bacteria 2769
410 Ga0436362_0513528 3300039453 Bacteria 3490
411 Ga0439448_0159261 3300042005 Bacteria 785
412 Ga0451577_0000266 3300042876 Bacteria 103006
413 Ga0451577_0000331 3300042876 Bacteria 88029
414 Ga0453683_0003332 3300044673 Bacteria 11880
415 Ga0453683_0028145 3300044673 Bacteria 3560
416 Ga0453684_0000429 3300044712 Bacteria 171513
417 Ga0453684_0000844 3300044712 Bacteria 103386
418 Ga0453684_0566893 3300044712 Bacteria 1249
419 Ga0466959_0167407 3300045049 Bacteria 1543
420 Ga0451576_0005501 3300045051 Bacteria 15835
421 Ga0451576_1461151 3300045051 Unclassified 711
422 Ga0466967_0314706 3300045976 Bacteria 1509
423 Ga0495592_0006436 3300046454 Bacteria 8744
424 Ga0495592_0033818 3300046454 Bacteria 3856
425 Ga0495629_0296795 3300046459 Bacteria 1107
426 Ga0495629_0495446 3300046459 Bacteria 824
427 Ga0495629_0604194 3300046459 Unclassified 733
428 Ga0495651_0067959 3300046462 Bacteria 2717
429 Ga0495651_0132173 3300046462 Bacteria 1820
430 Ga0495653_0076604 3300046463 Bacteria 2486
431 Ga0495653_0155775 3300046463 Bacteria 1591
432 Ga0495580_0001919 3300046472 Bacteria 18293
433 Ga0495580_0003479 3300046472 Bacteria 13408
434 Ga0495580_0012449 3300046472 Bacteria 6521
435 Ga0495580_0025378 3300046472 Bacteria 4332
436 Ga0495580_0055605 3300046472 Bacteria 2788
437 Ga0495580_0081510 3300046472 Unclassified 2255
438 Ga0495580_0320471 3300046472 Bacteria 1053
439 Ga0495582_0001911 3300046473 Bacteria 11714
440 Ga0495639_0108295 3300046475 Bacteria 1316
441 Ga0495662_0057138 3300046476 Bacteria 1884
442 Ga0495664_0562667 3300046477 Bacteria 679
443 Ga0495594_0389459 3300046499 Unclassified 793
444 Ga0495608_0089307 3300046511 Bacteria 1995
445 Ga0495608_0133911 3300046511 Unclassified 1585
446 Ga0495608_0152808 3300046511 Bacteria 1470
447 Ga0495628_0036373 3300046516 Bacteria 3952
448 Ga0495630_0104743 3300046517 Bacteria 2141
449 Ga0495666_0097817 3300046526 Bacteria 1384
450 Ga0495652_0014217 3300046529 Bacteria 7150
451 Ga0495652_0060802 3300046529 Bacteria 3191
452 Ga0495665_0056833 3300046531 Bacteria 2066
453 Ga0495665_0066864 3300046531 Bacteria 1896
454 Ga0495665_0202000 3300046531 Bacteria 1030
455 Ga0495665_0267062 3300046531 Bacteria 879
456 Ga0495640_0188303 3300046533 Bacteria 1312
457 Ga0495587_0066565 3300046536 Bacteria 2101
458 Ga0495587_0191947 3300046536 Bacteria 1156
459 Ga0495587_0227340 3300046536 Bacteria 1052
460 Ga0495645_0079768 3300046543 Bacteria 2350
461 Ga0495667_0047050 3300046559 Bacteria 2851
462 Ga0495667_0157572 3300046559 Bacteria 1460
463 Ga0495667_0212493 3300046559 Bacteria 1236
464 Ga0495667_0271966 3300046559 Bacteria 1076
465 Ga0495667_0278034 3300046559 Bacteria 1063
466 Ga0495635_0063404 3300046663 Bacteria 2538
467 Ga0495635_0236295 3300046663 Bacteria 1234
468 Ga0495635_0343403 3300046663 Bacteria 997
469 Ga0495599_0006479 3300046678 Bacteria 7066
470 Ga0495599_0039920 3300046678 Bacteria 2949
471 Ga0495623_0018679 3300046679 Bacteria 4477
472 Ga0495623_0041184 3300046679 Bacteria 2948
473 Ga0495623_0204787 3300046679 Bacteria 1133
474 Ga0495658_0046942 3300046683 Bacteria 2430
475 Ga0495669_0030225 3300046684 Bacteria 2378
476 Ga0495613_0105142 3300046689 Unclassified 2038
477 Ga0495613_0556508 3300046689 Unclassified 767
478 Ga0495600_0232621 3300046809 Bacteria 1176
479 Ga0495600_0415748 3300046809 Bacteria 835
480 Ga0495581_0149294 3300047315 Bacteria 1365
481 Ga0495604_0151813 3300047317 Bacteria 1645
482 Ga0495674_0063405 3300047319 Bacteria 3215
483 Ga0495674_0130514 3300047319 Bacteria 2117
484 Ga0495674_0205182 3300047319 Bacteria 1634
485 Ga0495674_0379033 3300047319 Bacteria 1145
486 Ga0495674_0498634 3300047319 Bacteria 974
487 Ga0495674_0782650 3300047319 Bacteria 743
488 Ga0495680_0073184 3300047322 Bacteria 2605
489 Ga0495680_0087249 3300047322 Bacteria 2347
490 Ga0495680_0169844 3300047322 Bacteria 1579
491 Ga0495680_0466909 3300047322 Bacteria 861
492 Ga0495675_0380141 3300047444 Unclassified 826
493 Ga0495684_0003519 3300047471 Bacteria 12252
494 Ga0495684_0014941 3300047471 Bacteria 5979
495 Ga0495684_0016853 3300047471 Bacteria 5629
496 Ga0495593_0149862 3300047673 Bacteria 1180
497 Ga0495602_0001814 3300048088 Bacteria 21326
498 Ga0495602_0024460 3300048088 Bacteria 5859
499 Ga0495602_0142469 3300048088 Bacteria 1896
500 Ga0495602_0169010 3300048088 Bacteria 1699
501 Ga0495602_0267173 3300048088 Bacteria 1266
502 Ga0496104_0061582 3300048907 Bacteria 3558
503 Ga0496104_0621899 3300048907 Bacteria 990
504 Ga0496110_0549299 3300048913 Unclassified 1050
505 Ga0496115_0111814 3300048918 Bacteria 2244
506 Ga0501031_0020585 3300049568 Bacteria 4301
507 Ga0501032_0013202 3300049569 Bacteria 5878
508 Ga0501033_0061442 3300049570 Bacteria 2768
509 Ga0501034_0088117 3300049571 Bacteria 3102
510 Ga0501034_0316327 3300049571 Archaea 1494
511 Ga0501036_0032147 3300049572 Archaea 4433
512 Ga0501037_0130818 3300049573 Bacteria 1799
513 Ga0501037_0256174 3300049573 Archaea 1223
514 Ga0501038_0001450 3300049574 Bacteria 21792
515 Ga0501039_0007251 3300049575 Bacteria 8446
516 Ga0501039_0017082 3300049575 Archaea 5563
517 Ga0501040_0050447 3300049576 Archaea 2846
518 Ga0501041_0114079 3300049577 Archaea 1677
519 Ga0501042_0019140 3300049578 Archaea 4750
520 Ga0501043_0002148 3300049579 Bacteria 16806
521 Ga0501046_0007238 3300049580 Bacteria 9757
522 Ga0501046_0081706 3300049580 Archaea 2495
523 Ga0501047_0555405 3300049581 Archaea 972
524 Ga0501048_0015240 3300049582 Archaea 5678
525 Ga0501048_0038495 3300049582 Bacteria 3431
526 Ga0501067_0077920 3300049583 Bacteria 1836
527 Ga0501068_0000159 3300049584 Bacteria 31176
528 Ga0501069_0019789 3300049585 Bacteria 3641
529 Ga0501070_0071035 3300049586 Bacteria 2882
530 Ga0501071_0015411 3300049587 Archaea 5247
531 Ga0501072_0044163 3300049588 Bacteria 3504
532 Ga0501073_0002400 3300049589 Bacteria 14015
533 Ga0501074_0090020 3300049590 Bacteria 2197
534 Ga0501074_0123344 3300049590 Archaea 1853
535 Ga0501075_0109242 3300049591 Archaea 2102
536 Ga0501076_0027775 3300049592 Archaea 4388
537 Ga0501077_0013021 3300049593 Bacteria 5211
538 Ga0501257_085021 3300049686 Bacteria 819
539 Ga0501079_0004266 3300049741 Bacteria 10608
540 Ga0501079_0028847 3300049741 Archaea 4259
541 Ga0501080_0003704 3300049742 Bacteria 13488
542 Ga0501080_0009912 3300049742 Archaea 8705
543 Ga0501081_0138720 3300049743 Archaea 1742
544 Ga0501083_0059275 3300049744 Bacteria 2560
545 Ga0501083_0128055 3300049744 Archaea 1664
546 Ga0501035_0023212 3300049822 Bacteria 5690
547 Ga0501035_0049515 3300049822 Archaea 3764
548 Ga0501044_0125148 3300049823 Archaea 2568
549 Ga0501044_0239955 3300049823 Bacteria 1756
550 Ga0501045_0008222 3300049824 Archaea 7266
551 nmdc:mga05p37_98443_c1 3300050507 Bacteria 3602
552 nmdc:mga06r32_9107_c1 3300050510 Bacteria 8948
553 nmdc:mga08y16_1416413_c1 3300050511 Bacteria 658
554 nmdc:mga0n895_122831_c1 3300050512 Bacteria 2618
555 nmdc:mga0rr50_411873_c1 3300050513 Bacteria 1143
556 nmdc:mga08x19_13579_c1 3300050514 Bacteria 4926
557 Ga0495601_0069359 3300053077 Bacteria 2249
558 Ga0500568_0012686 3300053139 Unclassified 3866
559 Ga0501084_0013531 3300054114 Bacteria 6751
560 Ga0501084_0022312 3300054114 Archaea 5283
561 Ga0587070_041503 3300059491 Bacteria 882
562 Ga0587080_039510 3300059503 Bacteria 854
563 Ga0587083_0067356 3300059505 Bacteria 823
564 Ga0587099_011510 3300059622 Unclassified 898
565 Ga0587130_013870 3300059631 Bacteria 818
566 Ga0587068_043646 3300059641 Unclassified 819
567 Ga0587075_020148 3300059644 Bacteria 983
568 Ga0587075_036013 3300059644 Unclassified 810
569 Ga0587107_030755 3300059652 Bacteria 815
570 Ga0587071_052055 3300060344 Bacteria 849
571 Ga0501082_0232187 3300060353 Bacteria 1605
572 Ga0501082_0428392 3300060353 Archaea 1155
573 Ga0530510_0022988 3300061734 Archaea 4443

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035117 Ga0373953_0011086 Ga0373953_0011086_31_621 195
2 3300046477 Ga0495664_0562667 Ga0495664_0562667_74_664 195
3 3300050511 nmdc:mga08y16_1416413_c1 nmdc:mga08y16_1416413_c1_21_608 195
4 3300026089 Ga0207648_11216126 Ga0207648_112161261 197
5 3300046459 Ga0495629_0296795 Ga0495629_0296795_20_619 198
6 3300049568 Ga0501031_0020585 Ga0501031_0020585_841_1500 207
7 3300049569 Ga0501032_0013202 Ga0501032_0013202_4523_5182 207
8 3300049570 Ga0501033_0061442 Ga0501033_0061442_1382_2041 207
9 3300049571 Ga0501034_0088117 Ga0501034_0088117_748_1407 207
10 3300049573 Ga0501037_0130818 Ga0501037_0130818_299_958 207
11 3300049574 Ga0501038_0001450 Ga0501038_0001450_19670_20329 207
12 3300049575 Ga0501039_0007251 Ga0501039_0007251_3870_4529 207
13 3300049579 Ga0501043_0002148 Ga0501043_0002148_10761_11420 207
14 3300049580 Ga0501046_0007238 Ga0501046_0007238_1128_1787 207
15 3300049582 Ga0501048_0038495 Ga0501048_0038495_1394_2053 207
16 3300049583 Ga0501067_0077920 Ga0501067_0077920_464_1123 207
17 3300049584 Ga0501068_0000159 Ga0501068_0000159_18748_19407 207
18 3300049585 Ga0501069_0019789 Ga0501069_0019789_1815_2474 207
19 3300049586 Ga0501070_0071035 Ga0501070_0071035_1382_2041 207
20 3300049588 Ga0501072_0044163 Ga0501072_0044163_1464_2123 207
21 3300049589 Ga0501073_0002400 Ga0501073_0002400_1382_2041 207
22 3300049590 Ga0501074_0090020 Ga0501074_0090020_697_1356 207
23 3300049593 Ga0501077_0013021 Ga0501077_0013021_4208_4867 207
24 3300049741 Ga0501079_0004266 Ga0501079_0004266_842_1501 207
25 3300049742 Ga0501080_0003704 Ga0501080_0003704_11770_12429 207
26 3300049744 Ga0501083_0059275 Ga0501083_0059275_842_1501 207
27 3300049822 Ga0501035_0023212 Ga0501035_0023212_464_1123 207
28 3300049823 Ga0501044_0239955 Ga0501044_0239955_105_764 207
29 3300054114 Ga0501084_0013531 Ga0501084_0013531_4518_5177 207
30 3300060353 Ga0501082_0232187 Ga0501082_0232187_842_1501 207
31 iso_pu_bacteria 3006969106 3006969501 212
32 3300005546 Ga0070696_100026436 Ga0070696_1000264363 214
33 3300042876 Ga0451577_0000266 Ga0451577_0000266_51084_51731 214
34 3300044673 Ga0453683_0003332 Ga0453683_0003332_9127_9774 214
35 3300044712 Ga0453684_0000844 Ga0453684_0000844_51656_52303 214
36 3300044712 Ga0453684_0566893 Ga0453684_0566893_410_1057 214
37 3300042876 Ga0451577_0000331 Ga0451577_0000331_56305_56952 215
38 3300044673 Ga0453683_0028145 Ga0453683_0028145_2857_3504 215
39 3300044712 Ga0453684_0000429 Ga0453684_0000429_99579_100226 215
40 3300045051 Ga0451576_0005501 Ga0451576_0005501_11749_12396 215
41 3300046536 Ga0495587_0191947 Ga0495587_0191947_11_661 215
42 3300046559 Ga0495667_0271966 Ga0495667_0271966_11_661 215
43 3300048918 Ga0496115_0111814 Ga0496115_0111814_1508_2158 215
44 3300005334 Ga0068869_100001087 Ga0068869_1000010872 216
45 3300005459 Ga0068867_100173958 Ga0068867_1001739582 216
46 3300009177 Ga0105248_10014020 Ga0105248_100140202 216
47 3300014745 Ga0157377_10073386 Ga0157377_100733862 216
48 3300025941 Ga0207711_10075228 Ga0207711_100752282 216
49 3300025942 Ga0207689_10003833 Ga0207689_100038332 216
50 3300028800 Ga0265338_10536744 Ga0265338_105367441 216
51 3300009177 Ga0105248_10217772 Ga0105248_102177722 217
52 3300025941 Ga0207711_10430199 Ga0207711_104301992 217
53 3300053139 Ga0500568_0012686 Ga0500568_0012686_185_841 217
54 3300005353 Ga0070669_100535688 Ga0070669_1005356882 218
55 3300005456 Ga0070678_100438182 Ga0070678_1004381822 218
56 3300005466 Ga0070685_10138169 Ga0070685_101381692 218
57 3300005530 Ga0070679_100507976 Ga0070679_1005079762 218
58 3300005617 Ga0068859_100507014 Ga0068859_1005070142 218
59 3300005983 Ga0081540_1133072 Ga0081540_11330722 218
60 3300006931 Ga0097620_100507011 Ga0097620_1005070112 218
61 3300009093 Ga0105240_10017257 Ga0105240_100172574 218
62 3300009094 Ga0111539_10115439 Ga0111539_101154392 218
63 3300009094 Ga0111539_10244020 Ga0111539_102440202 218
64 3300009098 Ga0105245_11199142 Ga0105245_111991421 218
65 3300013100 Ga0157373_10191033 Ga0157373_101910332 218
66 3300013102 Ga0157371_10272218 Ga0157371_102722182 218
67 3300013104 Ga0157370_10296865 Ga0157370_102968652 218
68 3300013105 Ga0157369_10071151 Ga0157369_100711512 218
69 3300013105 Ga0157369_10253439 Ga0157369_102534392 218
70 3300013306 Ga0163162_10255400 Ga0163162_102554003 218
71 3300013307 Ga0157372_10857517 Ga0157372_108575172 218
72 3300014745 Ga0157377_10224596 Ga0157377_102245962 218
73 3300021358 Ga0213873_10014975 Ga0213873_100149751 218
74 3300021361 Ga0213872_10000640 Ga0213872_1000064012 218
75 3300021377 Ga0213874_10002716 Ga0213874_100027164 218
76 3300021384 Ga0213876_10024426 Ga0213876_100244262 218
77 3300021388 Ga0213875_10000004 Ga0213875_10000004462 218
78 3300021388 Ga0213875_10041027 Ga0213875_100410273 218
79 3300021388 Ga0213875_10075182 Ga0213875_100751822 218
80 3300021388 Ga0213875_10305499 Ga0213875_103054991 218
81 3300025899 Ga0207642_10321664 Ga0207642_103216641 218
82 3300025901 Ga0207688_10035047 Ga0207688_100350473 218
83 3300025904 Ga0207647_10071013 Ga0207647_100710131 218
84 3300025936 Ga0207670_10084292 Ga0207670_100842922 218
85 3300025961 Ga0207712_10077757 Ga0207712_100777572 218
86 3300025972 Ga0207668_10195484 Ga0207668_101954842 218
87 3300026075 Ga0207708_10085791 Ga0207708_100857913 218
88 3300026078 Ga0207702_10518408 Ga0207702_105184081 218
89 3300026118 Ga0207675_100190454 Ga0207675_1001904541 218
90 3300026121 Ga0207683_10497634 Ga0207683_104976342 218
91 3300035692 Ga0373935_0299067 Ga0373935_0299067_358_1014 218
92 3300037418 Ga0395900_0052307 Ga0395900_0052307_1905_2561 218
93 3300037466 Ga0395898_0096440 Ga0395898_0096440_1731_2387 218
94 3300037853 Ga0436364_0368914 Ga0436364_0368914_308_964 218
95 3300037853 Ga0436364_0702152 Ga0436364_0702152_4466_5122 218
96 3300037853 Ga0436364_0711432 Ga0436364_0711432_1296_1952 218
97 3300037853 Ga0436364_0748068 Ga0436364_0748068_86293_86949 218
98 3300037853 Ga0436364_0799574 Ga0436364_0799574_86_742 218
99 3300037853 Ga0436364_0848422 Ga0436364_0848422_992_1648 218
100 3300037853 Ga0436364_1353109 Ga0436364_1353109_5219_5875 218
101 3300038443 Ga0395901_0638996 Ga0395901_0638996_238_894 218
102 3300039437 Ga0436365_0404647 Ga0436365_0404647_2848_3504 218
103 3300039447 Ga0436361_1130066 Ga0436361_1130066_11591_12247 218
104 3300039450 Ga0436363_0421543 Ga0436363_0421543_124_780 218
105 3300039450 Ga0436363_0912388 Ga0436363_0912388_154_810 218
106 3300039450 Ga0436363_0938087 Ga0436363_0938087_728_1384 218
107 3300039450 Ga0436363_1067205 Ga0436363_1067205_383_1039 218
108 3300039453 Ga0436362_0513528 Ga0436362_0513528_2148_2804 218
109 3300048913 Ga0496110_0549299 Ga0496110_0549299_262_918 218
110 3300049571 Ga0501034_0316327 Ga0501034_0316327_338_1003 218
111 3300049572 Ga0501036_0032147 Ga0501036_0032147_2896_3561 218
112 3300049573 Ga0501037_0256174 Ga0501037_0256174_194_859 218
113 3300049575 Ga0501039_0017082 Ga0501039_0017082_2719_3384 218
114 3300049576 Ga0501040_0050447 Ga0501040_0050447_128_793 218
115 3300049577 Ga0501041_0114079 Ga0501041_0114079_689_1354 218
116 3300049578 Ga0501042_0019140 Ga0501042_0019140_2719_3384 218
117 3300049580 Ga0501046_0081706 Ga0501046_0081706_365_1030 218
118 3300049581 Ga0501047_0555405 Ga0501047_0555405_183_848 218
119 3300049582 Ga0501048_0015240 Ga0501048_0015240_371_1036 218
120 3300049587 Ga0501071_0015411 Ga0501071_0015411_3428_4093 218
121 3300049590 Ga0501074_0123344 Ga0501074_0123344_392_1057 218
122 3300049591 Ga0501075_0109242 Ga0501075_0109242_693_1358 218
123 3300049592 Ga0501076_0027775 Ga0501076_0027775_1463_2128 218
124 3300049741 Ga0501079_0028847 Ga0501079_0028847_2236_2901 218
125 3300049742 Ga0501080_0009912 Ga0501080_0009912_3146_3811 218
126 3300049743 Ga0501081_0138720 Ga0501081_0138720_496_1161 218
127 3300049744 Ga0501083_0128055 Ga0501083_0128055_872_1537 218
128 3300049822 Ga0501035_0049515 Ga0501035_0049515_2647_3312 218
129 3300049823 Ga0501044_0125148 Ga0501044_0125148_346_1011 218
130 3300049824 Ga0501045_0008222 Ga0501045_0008222_4717_5382 218
131 3300054114 Ga0501084_0022312 Ga0501084_0022312_2640_3305 218
132 3300059491 Ga0587070_041503 Ga0587070_041503_176_832 218
133 3300059503 Ga0587080_039510 Ga0587080_039510_24_680 218
134 3300059505 Ga0587083_0067356 Ga0587083_0067356_71_727 218
135 3300059622 Ga0587099_011510 Ga0587099_011510_173_829 218
136 3300059631 Ga0587130_013870 Ga0587130_013870_69_725 218
137 3300059641 Ga0587068_043646 Ga0587068_043646_71_727 218
138 3300059644 Ga0587075_020148 Ga0587075_020148_257_913 218
139 3300059644 Ga0587075_036013 Ga0587075_036013_96_752 218
140 3300059652 Ga0587107_030755 Ga0587107_030755_71_727 218
141 3300060344 Ga0587071_052055 Ga0587071_052055_25_681 218
142 3300060353 Ga0501082_0428392 Ga0501082_0428392_70_735 218
143 3300061734 Ga0530510_0022988 Ga0530510_0022988_384_1049 218
144 3300004803 Ga0058862_11102382 Ga0058862_111023822 219
145 3300005329 Ga0070683_100000032 Ga0070683_10000003252 219
146 3300005329 Ga0070683_100003090 Ga0070683_1000030905 219
147 3300005329 Ga0070683_100022080 Ga0070683_1000220806 219
148 3300005329 Ga0070683_100279463 Ga0070683_1002794633 219
149 3300005330 Ga0070690_100079933 Ga0070690_1000799331 219
150 3300005334 Ga0068869_100136967 Ga0068869_1001369672 219
151 3300005335 Ga0070666_10099084 Ga0070666_100990842 219
152 3300005336 Ga0070680_100147107 Ga0070680_1001471071 219
153 3300005339 Ga0070660_100012269 Ga0070660_1000122693 219
154 3300005339 Ga0070660_100400902 Ga0070660_1004009022 219
155 3300005340 Ga0070689_100242992 Ga0070689_1002429922 219
156 3300005341 Ga0070691_10000650 Ga0070691_100006506 219
157 3300005344 Ga0070661_100092140 Ga0070661_1000921402 219
158 3300005344 Ga0070661_100401274 Ga0070661_1004012742 219
159 3300005345 Ga0070692_10345475 Ga0070692_103454751 219
160 3300005355 Ga0070671_100213255 Ga0070671_1002132552 219
161 3300005364 Ga0070673_100221459 Ga0070673_1002214592 219
162 3300005366 Ga0070659_100110236 Ga0070659_1001102362 219
163 3300005434 Ga0070709_10048432 Ga0070709_100484324 219
164 3300005435 Ga0070714_100003583 Ga0070714_1000035837 219
165 3300005435 Ga0070714_100405717 Ga0070714_1004057171 219
166 3300005436 Ga0070713_100008969 Ga0070713_1000089698 219
167 3300005436 Ga0070713_100270060 Ga0070713_1002700602 219
168 3300005439 Ga0070711_100018991 Ga0070711_1000189914 219
169 3300005439 Ga0070711_100041883 Ga0070711_1000418833 219
170 3300005439 Ga0070711_100088814 Ga0070711_1000888142 219
171 3300005439 Ga0070711_100137523 Ga0070711_1001375234 219
172 3300005439 Ga0070711_100190425 Ga0070711_1001904252 219
173 3300005439 Ga0070711_100316215 Ga0070711_1003162152 219
174 3300005440 Ga0070705_100253711 Ga0070705_1002537112 219
175 3300005456 Ga0070678_100231488 Ga0070678_1002314882 219
176 3300005456 Ga0070678_100318559 Ga0070678_1003185592 219
177 3300005456 Ga0070678_100344802 Ga0070678_1003448022 219
178 3300005456 Ga0070678_100616739 Ga0070678_1006167391 219
179 3300005457 Ga0070662_100130844 Ga0070662_1001308442 219
180 3300005458 Ga0070681_10007857 Ga0070681_100078571 219
181 3300005458 Ga0070681_10018766 Ga0070681_100187666 219
182 3300005458 Ga0070681_10301085 Ga0070681_103010852 219
183 3300005466 Ga0070685_10251352 Ga0070685_102513522 219
184 3300005467 Ga0070706_100091523 Ga0070706_1000915233 219
185 3300005471 Ga0070698_100592055 Ga0070698_1005920552 219
186 3300005518 Ga0070699_100190857 Ga0070699_1001908572 219
187 3300005530 Ga0070679_100005785 Ga0070679_10000578515 219
188 3300005530 Ga0070679_100425086 Ga0070679_1004250862 219
189 3300005535 Ga0070684_100000046 Ga0070684_10000004652 219
190 3300005535 Ga0070684_100000438 Ga0070684_1000004386 219
191 3300005535 Ga0070684_100017985 Ga0070684_1000179853 219
192 3300005535 Ga0070684_100042197 Ga0070684_1000421975 219
193 3300005535 Ga0070684_100079691 Ga0070684_1000796913 219
194 3300005535 Ga0070684_100380024 Ga0070684_1003800242 219
195 3300005535 Ga0070684_100692085 Ga0070684_1006920852 219
196 3300005535 Ga0070684_100861522 Ga0070684_1008615221 219
197 3300005536 Ga0070697_100634610 Ga0070697_1006346101 219
198 3300005539 Ga0068853_100146800 Ga0068853_1001468002 219
199 3300005539 Ga0068853_100384599 Ga0068853_1003845992 219
200 3300005543 Ga0070672_100565183 Ga0070672_1005651832 219
201 3300005546 Ga0070696_100004136 Ga0070696_1000041364 219
202 3300005547 Ga0070693_100021984 Ga0070693_1000219841 219
203 3300005563 Ga0068855_100002651 Ga0068855_1000026516 219
204 3300005564 Ga0070664_100023571 Ga0070664_1000235715 219
205 3300005577 Ga0068857_100048200 Ga0068857_1000482005 219
206 3300005577 Ga0068857_100287702 Ga0068857_1002877023 219
207 3300005578 Ga0068854_100017963 Ga0068854_1000179635 219
208 3300005614 Ga0068856_100039231 Ga0068856_1000392315 219
209 3300005614 Ga0068856_100098934 Ga0068856_1000989343 219
210 3300005614 Ga0068856_100607538 Ga0068856_1006075382 219
211 3300005616 Ga0068852_100007445 Ga0068852_1000074456 219
212 3300005616 Ga0068852_100037441 Ga0068852_1000374413 219
213 3300005617 Ga0068859_100531212 Ga0068859_1005312122 219
214 3300005617 Ga0068859_101339455 Ga0068859_1013394551 219
215 3300005834 Ga0068851_10136571 Ga0068851_101365712 219
216 3300005841 Ga0068863_100211914 Ga0068863_1002119142 219
217 3300005841 Ga0068863_100262547 Ga0068863_1002625472 219
218 3300005842 Ga0068858_100024769 Ga0068858_1000247694 219
219 3300005842 Ga0068858_100061185 Ga0068858_1000611852 219
220 3300005842 Ga0068858_100103374 Ga0068858_1001033741 219
221 3300005842 Ga0068858_100227692 Ga0068858_1002276922 219
222 3300006028 Ga0070717_10087015 Ga0070717_100870155 219
223 3300006028 Ga0070717_10162660 Ga0070717_101626602 219
224 3300006028 Ga0070717_10439853 Ga0070717_104398532 219
225 3300006173 Ga0070716_100136935 Ga0070716_1001369352 219
226 3300006237 Ga0097621_100031444 Ga0097621_1000314444 219
227 3300006237 Ga0097621_100087313 Ga0097621_1000873134 219
228 3300006237 Ga0097621_101066073 Ga0097621_1010660731 219
229 3300006358 Ga0068871_100005166 Ga0068871_1000051665 219
230 3300006358 Ga0068871_100028570 Ga0068871_1000285702 219
231 3300006358 Ga0068871_100070668 Ga0068871_1000706682 219
232 3300006847 Ga0075431_100005373 Ga0075431_1000053737 219
233 3300006881 Ga0068865_100446178 Ga0068865_1004461782 219
234 3300006914 Ga0075436_100003504 Ga0075436_1000035044 219
235 3300006914 Ga0075436_100405450 Ga0075436_1004054501 219
236 3300006931 Ga0097620_100531311 Ga0097620_1005313112 219
237 3300006931 Ga0097620_101339495 Ga0097620_1013394951 219
238 3300007076 Ga0075435_100264808 Ga0075435_1002648083 219
239 3300009093 Ga0105240_10000973 Ga0105240_1000097337 219
240 3300009093 Ga0105240_10012536 Ga0105240_1001253611 219
241 3300009093 Ga0105240_10016249 Ga0105240_100162493 219
242 3300009093 Ga0105240_10042639 Ga0105240_100426394 219
243 3300009093 Ga0105240_10043375 Ga0105240_100433753 219
244 3300009093 Ga0105240_10048236 Ga0105240_100482365 219
245 3300009093 Ga0105240_10102044 Ga0105240_101020445 219
246 3300009093 Ga0105240_11482810 Ga0105240_114828101 219
247 3300009098 Ga0105245_10010618 Ga0105245_100106187 219
248 3300009098 Ga0105245_10012844 Ga0105245_100128443 219
249 3300009098 Ga0105245_10016803 Ga0105245_100168036 219
250 3300009098 Ga0105245_10138245 Ga0105245_101382451 219
251 3300009098 Ga0105245_10376045 Ga0105245_103760452 219
252 3300009098 Ga0105245_10795716 Ga0105245_107957161 219
253 3300009098 Ga0105245_10941934 Ga0105245_109419342 219
254 3300009101 Ga0105247_10219482 Ga0105247_102194822 219
255 3300009148 Ga0105243_10456285 Ga0105243_104562852 219
256 3300009148 Ga0105243_10515467 Ga0105243_105154672 219
257 3300009174 Ga0105241_10006584 Ga0105241_100065841 219
258 3300009174 Ga0105241_10024088 Ga0105241_100240884 219
259 3300009174 Ga0105241_10039207 Ga0105241_100392075 219
260 3300009176 Ga0105242_10012749 Ga0105242_100127496 219
261 3300009176 Ga0105242_11023082 Ga0105242_110230821 219
262 3300009177 Ga0105248_10008816 Ga0105248_100088163 219
263 3300009177 Ga0105248_10023792 Ga0105248_100237924 219
264 3300009177 Ga0105248_10033296 Ga0105248_100332962 219
265 3300009177 Ga0105248_10069890 Ga0105248_100698902 219
266 3300009177 Ga0105248_10293514 Ga0105248_102935142 219
267 3300009177 Ga0105248_10854562 Ga0105248_108545622 219
268 3300009177 Ga0105248_11121974 Ga0105248_111219741 219
269 3300009545 Ga0105237_10012342 Ga0105237_100123428 219
270 3300009545 Ga0105237_10014726 Ga0105237_100147262 219
271 3300009545 Ga0105237_10017252 Ga0105237_100172528 219
272 3300009545 Ga0105237_10070153 Ga0105237_100701531 219
273 3300009545 Ga0105237_10071375 Ga0105237_100713752 219
274 3300009545 Ga0105237_10167848 Ga0105237_101678482 219
275 3300009545 Ga0105237_10213449 Ga0105237_102134492 219
276 3300009545 Ga0105237_10403004 Ga0105237_104030043 219
277 3300009551 Ga0105238_10003305 Ga0105238_100033055 219
278 3300009551 Ga0105238_10018451 Ga0105238_100184512 219
279 3300009551 Ga0105238_10038449 Ga0105238_100384494 219
280 3300009551 Ga0105238_10060275 Ga0105238_100602753 219
281 3300009551 Ga0105238_10271029 Ga0105238_102710292 219
282 3300009551 Ga0105238_10480085 Ga0105238_104800852 219
283 3300009551 Ga0105238_10740745 Ga0105238_107407452 219
284 3300009553 Ga0105249_10046424 Ga0105249_100464242 219
285 3300009553 Ga0105249_10243279 Ga0105249_102432792 219
286 3300009553 Ga0105249_10507465 Ga0105249_105074651 219
287 3300010375 Ga0105239_10001226 Ga0105239_1000122615 219
288 3300010375 Ga0105239_10012176 Ga0105239_100121766 219
289 3300010375 Ga0105239_10018816 Ga0105239_100188168 219
290 3300010375 Ga0105239_10259517 Ga0105239_102595172 219
291 3300011119 Ga0105246_10037263 Ga0105246_100372635 219
292 3300011119 Ga0105246_10086625 Ga0105246_100866252 219
293 3300013104 Ga0157370_10005508 Ga0157370_100055084 219
294 3300013104 Ga0157370_10019028 Ga0157370_100190285 219
295 3300013104 Ga0157370_10480089 Ga0157370_104800891 219
296 3300013105 Ga0157369_10007462 Ga0157369_1000746212 219
297 3300013105 Ga0157369_10009069 Ga0157369_100090698 219
298 3300013105 Ga0157369_10025176 Ga0157369_100251762 219
299 3300013296 Ga0157374_10034937 Ga0157374_100349376 219
300 3300013296 Ga0157374_10098476 Ga0157374_100984762 219
301 3300013296 Ga0157374_10357714 Ga0157374_103577142 219
302 3300013296 Ga0157374_10966835 Ga0157374_109668351 219
303 3300013297 Ga0157378_10013190 Ga0157378_100131906 219
304 3300013297 Ga0157378_10274389 Ga0157378_102743892 219
305 3300013297 Ga0157378_10388140 Ga0157378_103881402 219
306 3300013306 Ga0163162_10075158 Ga0163162_100751584 219
307 3300013306 Ga0163162_10430069 Ga0163162_104300692 219
308 3300013307 Ga0157372_10012335 Ga0157372_100123353 219
309 3300013307 Ga0157372_10028219 Ga0157372_100282194 219
310 3300013307 Ga0157372_10031778 Ga0157372_100317785 219
311 3300013307 Ga0157372_10186434 Ga0157372_101864342 219
312 3300013308 Ga0157375_10169140 Ga0157375_101691402 219
313 3300013308 Ga0157375_10606977 Ga0157375_106069773 219
314 3300013308 Ga0157375_10688238 Ga0157375_106882382 219
315 3300013308 Ga0157375_10926923 Ga0157375_109269231 219
316 3300014325 Ga0163163_10035605 Ga0163163_100356052 219
317 3300014325 Ga0163163_10038907 Ga0163163_100389073 219
318 3300014325 Ga0163163_10055059 Ga0163163_100550593 219
319 3300014325 Ga0163163_10087869 Ga0163163_100878693 219
320 3300014325 Ga0163163_10163555 Ga0163163_101635552 219
321 3300014325 Ga0163163_10208313 Ga0163163_102083132 219
322 3300014325 Ga0163163_10895910 Ga0163163_108959102 219
323 3300014969 Ga0157376_10033816 Ga0157376_100338162 219
324 3300014969 Ga0157376_10146205 Ga0157376_101462052 219
325 3300014969 Ga0157376_10299115 Ga0157376_102991152 219
326 3300014969 Ga0157376_10903158 Ga0157376_109031582 219
327 3300017792 Ga0163161_10201341 Ga0163161_102013412 219
328 3300020078 Ga0206352_10686219 Ga0206352_106862191 219
329 3300020080 Ga0206350_10071010 Ga0206350_100710101 219
330 3300020610 Ga0154015_1217243 Ga0154015_12172431 219
331 3300021384 Ga0213876_10116540 Ga0213876_101165403 219
332 3300021384 Ga0213876_10156375 Ga0213876_101563751 219
333 3300025321 Ga0207656_10087850 Ga0207656_100878502 219
334 3300025903 Ga0207680_10094554 Ga0207680_100945543 219
335 3300025903 Ga0207680_10156077 Ga0207680_101560772 219
336 3300025905 Ga0207685_10235826 Ga0207685_102358262 219
337 3300025906 Ga0207699_10376108 Ga0207699_103761081 219
338 3300025907 Ga0207645_10125851 Ga0207645_101258512 219
339 3300025910 Ga0207684_10262233 Ga0207684_102622333 219
340 3300025911 Ga0207654_10010799 Ga0207654_100107993 219
341 3300025911 Ga0207654_10232002 Ga0207654_102320022 219
342 3300025911 Ga0207654_10370905 Ga0207654_103709051 219
343 3300025912 Ga0207707_10004585 Ga0207707_100045853 219
344 3300025912 Ga0207707_10114410 Ga0207707_101144102 219
345 3300025912 Ga0207707_10335578 Ga0207707_103355782 219
346 3300025913 Ga0207695_10002536 Ga0207695_100025368 219
347 3300025913 Ga0207695_10003356 Ga0207695_100033567 219
348 3300025913 Ga0207695_10038753 Ga0207695_100387534 219
349 3300025913 Ga0207695_10055261 Ga0207695_100552612 219
350 3300025913 Ga0207695_10057341 Ga0207695_100573413 219
351 3300025913 Ga0207695_10116819 Ga0207695_101168191 219
352 3300025914 Ga0207671_10014487 Ga0207671_100144875 219
353 3300025914 Ga0207671_10033055 Ga0207671_100330553 219
354 3300025914 Ga0207671_10084349 Ga0207671_100843492 219
355 3300025914 Ga0207671_10139573 Ga0207671_101395732 219
356 3300025914 Ga0207671_10215406 Ga0207671_102154062 219
357 3300025914 Ga0207671_10732639 Ga0207671_107326391 219
358 3300025914 Ga0207671_10776992 Ga0207671_107769921 219
359 3300025915 Ga0207693_10024432 Ga0207693_100244324 219
360 3300025916 Ga0207663_10023367 Ga0207663_100233673 219
361 3300025916 Ga0207663_10027747 Ga0207663_100277474 219
362 3300025916 Ga0207663_10029461 Ga0207663_100294614 219
363 3300025916 Ga0207663_10176371 Ga0207663_101763712 219
364 3300025917 Ga0207660_10106510 Ga0207660_101065103 219
365 3300025917 Ga0207660_10377981 Ga0207660_103779812 219
366 3300025918 Ga0207662_10389782 Ga0207662_103897821 219
367 3300025919 Ga0207657_10021210 Ga0207657_100212104 219
368 3300025920 Ga0207649_10078660 Ga0207649_100786601 219
369 3300025921 Ga0207652_10005239 Ga0207652_100052393 219
370 3300025921 Ga0207652_10386999 Ga0207652_103869992 219
371 3300025921 Ga0207652_10802388 Ga0207652_108023881 219
372 3300025924 Ga0207694_10001736 Ga0207694_1000173616 219
373 3300025924 Ga0207694_10004446 Ga0207694_100044463 219
374 3300025924 Ga0207694_10023938 Ga0207694_100239384 219
375 3300025924 Ga0207694_10425448 Ga0207694_104254482 219
376 3300025924 Ga0207694_10839081 Ga0207694_108390811 219
377 3300025926 Ga0207659_10233519 Ga0207659_102335192 219
378 3300025927 Ga0207687_10000181 Ga0207687_100001813 219
379 3300025927 Ga0207687_10007479 Ga0207687_100074797 219
380 3300025927 Ga0207687_10010218 Ga0207687_100102182 219
381 3300025928 Ga0207700_10001102 Ga0207700_100011028 219
382 3300025928 Ga0207700_10270663 Ga0207700_102706632 219
383 3300025929 Ga0207664_10007557 Ga0207664_100075576 219
384 3300025931 Ga0207644_10167227 Ga0207644_101672272 219
385 3300025933 Ga0207706_10038992 Ga0207706_100389922 219
386 3300025934 Ga0207686_10017973 Ga0207686_100179733 219
387 3300025934 Ga0207686_10169909 Ga0207686_101699091 219
388 3300025935 Ga0207709_10601167 Ga0207709_106011671 219
389 3300025939 Ga0207665_10255345 Ga0207665_102553451 219
390 3300025941 Ga0207711_10012815 Ga0207711_100128156 219
391 3300025941 Ga0207711_10013647 Ga0207711_100136475 219
392 3300025941 Ga0207711_10028899 Ga0207711_100288995 219
393 3300025941 Ga0207711_10046658 Ga0207711_100466585 219
394 3300025941 Ga0207711_10116131 Ga0207711_101161312 219
395 3300025941 Ga0207711_10159254 Ga0207711_101592542 219
396 3300025941 Ga0207711_10343421 Ga0207711_103434212 219
397 3300025942 Ga0207689_10023577 Ga0207689_100235776 219
398 3300025942 Ga0207689_10514497 Ga0207689_105144971 219
399 3300025944 Ga0207661_10000020 Ga0207661_10000020145 219
400 3300025944 Ga0207661_10041191 Ga0207661_100411915 219
401 3300025944 Ga0207661_10061694 Ga0207661_100616942 219
402 3300025944 Ga0207661_10172275 Ga0207661_101722751 219
403 3300025944 Ga0207661_10228710 Ga0207661_102287101 219
404 3300025944 Ga0207661_10246225 Ga0207661_102462252 219
405 3300025944 Ga0207661_10733690 Ga0207661_107336902 219
406 3300025949 Ga0207667_10000483 Ga0207667_100004839 219
407 3300025949 Ga0207667_10001959 Ga0207667_1000195916 219
408 3300025949 Ga0207667_10018123 Ga0207667_100181232 219
409 3300025949 Ga0207667_10340314 Ga0207667_103403142 219
410 3300025960 Ga0207651_10222982 Ga0207651_102229821 219
411 3300025960 Ga0207651_10356079 Ga0207651_103560792 219
412 3300025961 Ga0207712_10005026 Ga0207712_100050265 219
413 3300025961 Ga0207712_10118290 Ga0207712_101182902 219
414 3300026035 Ga0207703_10013985 Ga0207703_100139853 219
415 3300026041 Ga0207639_10140420 Ga0207639_101404202 219
416 3300026041 Ga0207639_10308434 Ga0207639_103084342 219
417 3300026078 Ga0207702_10049636 Ga0207702_100496362 219
418 3300026078 Ga0207702_10078300 Ga0207702_100783004 219
419 3300026078 Ga0207702_10203219 Ga0207702_102032191 219
420 3300026078 Ga0207702_11001835 Ga0207702_110018351 219
421 3300026088 Ga0207641_10283025 Ga0207641_102830252 219
422 3300026089 Ga0207648_10107546 Ga0207648_101075464 219
423 3300026095 Ga0207676_10119584 Ga0207676_101195843 219
424 3300026095 Ga0207676_10256812 Ga0207676_102568122 219
425 3300026116 Ga0207674_10000097 Ga0207674_1000009741 219
426 3300026118 Ga0207675_101213003 Ga0207675_1012130032 219
427 3300026121 Ga0207683_10084401 Ga0207683_100844013 219
428 3300026121 Ga0207683_10506068 Ga0207683_105060681 219
429 3300026142 Ga0207698_10008487 Ga0207698_100084876 219
430 3300026142 Ga0207698_10043575 Ga0207698_100435754 219
431 3300026142 Ga0207698_10623013 Ga0207698_106230132 219
432 3300028379 Ga0268266_10095221 Ga0268266_100952213 219
433 3300028381 Ga0268264_10338150 Ga0268264_103381502 219
434 3300031247 Ga0265340_10011941 Ga0265340_100119413 219
435 3300031344 Ga0265316_10249893 Ga0265316_102498932 219
436 3300031595 Ga0265313_10002989 Ga0265313_1000298915 219
437 3300031711 Ga0265314_10006965 Ga0265314_100069655 219
438 3300035083 Ga0373926_0142244 Ga0373926_0142244_135_800 219
439 3300035086 Ga0373934_0012449 Ga0373934_0012449_2200_2865 219
440 3300035086 Ga0373934_0055210 Ga0373934_0055210_71_733 219
441 3300035111 Ga0373923_0051203 Ga0373923_0051203_280_942 219
442 3300035111 Ga0373923_0118251 Ga0373923_0118251_157_819 219
443 3300035111 Ga0373923_0187812 Ga0373923_0187812_63_728 219
444 3300035117 Ga0373953_0124065 Ga0373953_0124065_28_693 219
445 3300035118 Ga0373954_0002222 Ga0373954_0002222_165_827 219
446 3300035118 Ga0373954_0008895 Ga0373954_0008895_3336_3998 219
447 3300035118 Ga0373954_0271170 Ga0373954_0271170_43_705 219
448 3300035172 Ga0373955_0022945 Ga0373955_0022945_596_1258 219
449 3300035172 Ga0373955_0046978 Ga0373955_0046978_961_1623 219
450 3300035172 Ga0373955_0058041 Ga0373955_0058041_44_706 219
451 3300035410 Ga0373924_0023044 Ga0373924_0023044_1509_2171 219
452 3300035410 Ga0373924_0229435 Ga0373924_0229435_34_696 219
453 3300035692 Ga0373935_0104997 Ga0373935_0104997_1150_1812 219
454 3300035692 Ga0373935_0146175 Ga0373935_0146175_498_1160 219
455 3300035692 Ga0373935_0658183 Ga0373935_0658183_11_673 219
456 3300035695 Ga0373927_0009771 Ga0373927_0009771_920_1582 219
457 3300035695 Ga0373927_0092713 Ga0373927_0092713_967_1632 219
458 3300035695 Ga0373927_0161306 Ga0373927_0161306_208_870 219
459 3300035695 Ga0373927_0345622 Ga0373927_0345622_106_768 219
460 3300035724 Ga0373933_0011224 Ga0373933_0011224_1898_2560 219
461 3300035724 Ga0373933_0028156 Ga0373933_0028156_785_1447 219
462 3300035724 Ga0373933_0081948 Ga0373933_0081948_809_1474 219
463 3300035724 Ga0373933_0124965 Ga0373933_0124965_216_878 219
464 3300035724 Ga0373933_0151200 Ga0373933_0151200_24_686 219
465 3300035724 Ga0373933_0274071 Ga0373933_0274071_364_1026 219
466 3300035724 Ga0373933_0304839 Ga0373933_0304839_143_805 219
467 3300035725 Ga0373947_0010405 Ga0373947_0010405_1192_1857 219
468 3300035725 Ga0373947_0112704 Ga0373947_0112704_183_845 219
469 3300035725 Ga0373947_0151570 Ga0373947_0151570_786_1454 219
470 3300036401 Ga0373937_0010397 Ga0373937_0010397_2453_3118 219
471 3300036401 Ga0373937_0033571 Ga0373937_0033571_1733_2395 219
472 3300036401 Ga0373937_0058021 Ga0373937_0058021_1687_2349 219
473 3300036401 Ga0373937_0086984 Ga0373937_0086984_419_1084 219
474 3300036401 Ga0373937_0132483 Ga0373937_0132483_1013_1675 219
475 3300036401 Ga0373937_0175805 Ga0373937_0175805_29_733 219
476 3300036401 Ga0373937_0220557 Ga0373937_0220557_445_1107 219
477 3300036401 Ga0373937_0223875 Ga0373937_0223875_235_897 219
478 3300036401 Ga0373937_0279637 Ga0373937_0279637_481_1143 219
479 3300036401 Ga0373937_0402844 Ga0373937_0402844_262_924 219
480 3300037068 Ga0373925_0013512 Ga0373925_0013512_2645_3307 219
481 3300037068 Ga0373925_0124157 Ga0373925_0124157_907_1572 219
482 3300037068 Ga0373925_0217418 Ga0373925_0217418_464_1129 219
483 3300037068 Ga0373925_0336112 Ga0373925_0336112_95_757 219
484 3300037853 Ga0436364_0166152 Ga0436364_0166152_154_822 219
485 3300039437 Ga0436365_0967668 Ga0436365_0967668_784_1449 219
486 3300039437 Ga0436365_1124207 Ga0436365_1124207_162_827 219
487 3300042005 Ga0439448_0159261 Ga0439448_0159261_84_746 219
488 3300045049 Ga0466959_0167407 Ga0466959_0167407_472_1137 219
489 3300045051 Ga0451576_1461151 Ga0451576_1461151_23_685 219
490 3300045976 Ga0466967_0314706 Ga0466967_0314706_289_948 219
491 3300046454 Ga0495592_0006436 Ga0495592_0006436_6951_7613 219
492 3300046454 Ga0495592_0033818 Ga0495592_0033818_2655_3317 219
493 3300046459 Ga0495629_0495446 Ga0495629_0495446_110_772 219
494 3300046459 Ga0495629_0604194 Ga0495629_0604194_34_696 219
495 3300046462 Ga0495651_0067959 Ga0495651_0067959_1409_2071 219
496 3300046462 Ga0495651_0132173 Ga0495651_0132173_1082_1744 219
497 3300046463 Ga0495653_0076604 Ga0495653_0076604_748_1452 219
498 3300046463 Ga0495653_0155775 Ga0495653_0155775_533_1195 219
499 3300046472 Ga0495580_0001919 Ga0495580_0001919_10703_11365 219
500 3300046472 Ga0495580_0003479 Ga0495580_0003479_6954_7619 219
501 3300046472 Ga0495580_0012449 Ga0495580_0012449_2999_3661 219
502 3300046472 Ga0495580_0025378 Ga0495580_0025378_832_1494 219
503 3300046472 Ga0495580_0055605 Ga0495580_0055605_708_1412 219
504 3300046472 Ga0495580_0081510 Ga0495580_0081510_1075_1737 219
505 3300046472 Ga0495580_0320471 Ga0495580_0320471_40_702 219
506 3300046473 Ga0495582_0001911 Ga0495582_0001911_7714_8376 219
507 3300046475 Ga0495639_0108295 Ga0495639_0108295_280_942 219
508 3300046476 Ga0495662_0057138 Ga0495662_0057138_1125_1787 219
509 3300046499 Ga0495594_0389459 Ga0495594_0389459_86_748 219
510 3300046511 Ga0495608_0089307 Ga0495608_0089307_1173_1835 219
511 3300046511 Ga0495608_0133911 Ga0495608_0133911_191_853 219
512 3300046511 Ga0495608_0152808 Ga0495608_0152808_789_1451 219
513 3300046516 Ga0495628_0036373 Ga0495628_0036373_1463_2125 219
514 3300046517 Ga0495630_0104743 Ga0495630_0104743_144_806 219
515 3300046526 Ga0495666_0097817 Ga0495666_0097817_349_1011 219
516 3300046529 Ga0495652_0014217 Ga0495652_0014217_1586_2248 219
517 3300046529 Ga0495652_0060802 Ga0495652_0060802_1274_1936 219
518 3300046531 Ga0495665_0056833 Ga0495665_0056833_318_980 219
519 3300046531 Ga0495665_0066864 Ga0495665_0066864_456_1118 219
520 3300046531 Ga0495665_0202000 Ga0495665_0202000_226_888 219
521 3300046531 Ga0495665_0267062 Ga0495665_0267062_170_832 219
522 3300046533 Ga0495640_0188303 Ga0495640_0188303_280_942 219
523 3300046536 Ga0495587_0066565 Ga0495587_0066565_527_1189 219
524 3300046536 Ga0495587_0227340 Ga0495587_0227340_193_855 219
525 3300046543 Ga0495645_0079768 Ga0495645_0079768_205_867 219
526 3300046559 Ga0495667_0047050 Ga0495667_0047050_1605_2267 219
527 3300046559 Ga0495667_0157572 Ga0495667_0157572_203_862 219
528 3300046559 Ga0495667_0212493 Ga0495667_0212493_535_1197 219
529 3300046559 Ga0495667_0278034 Ga0495667_0278034_193_855 219
530 3300046663 Ga0495635_0063404 Ga0495635_0063404_837_1499 219
531 3300046663 Ga0495635_0236295 Ga0495635_0236295_128_790 219
532 3300046663 Ga0495635_0343403 Ga0495635_0343403_199_861 219
533 3300046678 Ga0495599_0006479 Ga0495599_0006479_1933_2595 219
534 3300046678 Ga0495599_0039920 Ga0495599_0039920_537_1199 219
535 3300046679 Ga0495623_0018679 Ga0495623_0018679_3647_4309 219
536 3300046679 Ga0495623_0041184 Ga0495623_0041184_498_1160 219
537 3300046679 Ga0495623_0204787 Ga0495623_0204787_430_1092 219
538 3300046683 Ga0495658_0046942 Ga0495658_0046942_860_1522 219
539 3300046684 Ga0495669_0030225 Ga0495669_0030225_1378_2040 219
540 3300046689 Ga0495613_0105142 Ga0495613_0105142_748_1410 219
541 3300046689 Ga0495613_0556508 Ga0495613_0556508_41_703 219
542 3300046809 Ga0495600_0232621 Ga0495600_0232621_280_942 219
543 3300046809 Ga0495600_0415748 Ga0495600_0415748_149_811 219
544 3300047315 Ga0495581_0149294 Ga0495581_0149294_140_802 219
545 3300047317 Ga0495604_0151813 Ga0495604_0151813_907_1569 219
546 3300047319 Ga0495674_0063405 Ga0495674_0063405_1650_2330 219
547 3300047319 Ga0495674_0130514 Ga0495674_0130514_677_1339 219
548 3300047319 Ga0495674_0205182 Ga0495674_0205182_877_1545 219
549 3300047319 Ga0495674_0379033 Ga0495674_0379033_293_955 219
550 3300047319 Ga0495674_0498634 Ga0495674_0498634_97_756 219
551 3300047319 Ga0495674_0782650 Ga0495674_0782650_58_720 219
552 3300047322 Ga0495680_0073184 Ga0495680_0073184_1220_1882 219
553 3300047322 Ga0495680_0087249 Ga0495680_0087249_1158_1820 219
554 3300047322 Ga0495680_0169844 Ga0495680_0169844_890_1552 219
555 3300047322 Ga0495680_0466909 Ga0495680_0466909_39_701 219
556 3300047444 Ga0495675_0380141 Ga0495675_0380141_86_748 219
557 3300047471 Ga0495684_0003519 Ga0495684_0003519_209_871 219
558 3300047471 Ga0495684_0014941 Ga0495684_0014941_873_1535 219
559 3300047471 Ga0495684_0016853 Ga0495684_0016853_1121_1783 219
560 3300047673 Ga0495593_0149862 Ga0495593_0149862_22_684 219
561 3300048088 Ga0495602_0001814 Ga0495602_0001814_7615_8277 219
562 3300048088 Ga0495602_0024460 Ga0495602_0024460_5066_5728 219
563 3300048088 Ga0495602_0142469 Ga0495602_0142469_1206_1868 219
564 3300048088 Ga0495602_0169010 Ga0495602_0169010_894_1556 219
565 3300048088 Ga0495602_0267173 Ga0495602_0267173_275_937 219
566 3300048907 Ga0496104_0061582 Ga0496104_0061582_1347_2009 219
567 3300048907 Ga0496104_0621899 Ga0496104_0621899_111_773 219
568 3300049686 Ga0501257_085021 Ga0501257_085021_18_680 219
569 3300050507 nmdc:mga05p37_98443_c1 nmdc:mga05p37_98443_c1_1636_2298 219
570 3300050510 nmdc:mga06r32_9107_c1 nmdc:mga06r32_9107_c1_4789_5451 219
571 3300050512 nmdc:mga0n895_122831_c1 nmdc:mga0n895_122831_c1_1939_2601 219
572 3300050513 nmdc:mga0rr50_411873_c1 nmdc:mga0rr50_411873_c1_333_995 219
573 3300050514 nmdc:mga08x19_13579_c1 nmdc:mga08x19_13579_c1_1683_2345 219
574 3300053077 Ga0495601_0069359 Ga0495601_0069359_509_1171 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

3

206

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r8r-assembly1.cif.gz_C transaldolase from bacillus subtilis 0.9855 1 209
3r8r-assembly2.cif.gz_M transaldolase from bacillus subtilis 0.9846 1 209
3r8r-assembly1.cif.gz_J transaldolase from bacillus subtilis 0.9844 1 209
3r8r-assembly1.cif.gz_H transaldolase from bacillus subtilis 0.9836 1 210
3r8r-assembly1.cif.gz_I transaldolase from bacillus subtilis 0.9836 1 210
ID Description Score Start End Superfamily
3r8rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9806 1 210 3.20.20.70
3r8rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.967 1 210 3.20.20.70
1l6wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9569 1 214 3.20.20.70
1l6wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9317 1 214 3.20.20.70
af_A0A1L1QZF2_1_286_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8811 1 192 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A4U3ASF6-F1-model_v4 deleted 0.9993 109 183
AF-A0A4U3BD06-F1-model_v4 deleted 0.9952 1 116
AF-W1XGA7-F1-model_v4 Putative transaldolase 1 0.9952 99 185 GO:0005975
AF-A0A1F3B825-F1-model_v4 Fructose-6-phosphate aldolase 0.9945 1 202 GO:0005737
GO:0005975
GO:0016832
AF-A0A533XG32-F1-model_v4 Fructose-6-phosphate aldolase 0.9944 1 157 GO:0005737
GO:0005975
GO:0016832

Feature Viewer

pLDDT pTM Quality
95.16 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map