F465332

General Info

Members Datasets Scaffolds Average Seq Length
574 341 518 268

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0002925|Ga0495592_0002925_7757_8725
Length 307
Sequence MRAPSPITPEDRALPFASAVEHCRCIAPPLFNQSKATYPTRDILDLDTIRVFIMTRGIDLGTKVLIIGLLRKVLARNGRVDPTLAHYLGSILGGLLNXXXILAILQIFGVQTTSFAALLAGLGLAIGTAWGGLLAHFAAGVFMQVLRPFKVGDFVTAGGVTGTVSELGLFGTTIVTPDNVTTIVGNNKVFSDTISNFSVLPVRRVELTAKIANGVDPTDAMNRLRAAIVQIPNVAESPAPDIEVLSFTPEGPLLCVRPYTANDHYWQVYFDTNRAIVQTFKEAGYPTPETPLAPRAVGPGATGTAAG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
11 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
12 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
13 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
14 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
15 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
16 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
17 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
18 2643221660 Methylibium sp. Root1272 Isolate Unclassified
19 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
20 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
21 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
22 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
23 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
24 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
25 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
26 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
27 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
28 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
29 2818991452 Burkholderia cepacia 561 Isolate Unclassified
30 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
31 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
32 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
33 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
34 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
35 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
36 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
37 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
38 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
39 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
40 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
41 2904564687 Burkholderia sp. 571 Isolate Unclassified
42 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
43 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
44 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
45 2928163908 Burkholderia sp. 567 Isolate Unclassified
46 2928170801 Burkholderia sp. 572 Isolate Unclassified
47 2928536128 Burkholderia sola 565 Isolate Unclassified
48 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
49 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
50 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
51 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
52 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
53 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
54 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
55 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
56 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
57 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
58 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
59 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
60 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
61 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
62 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
63 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
64 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
65 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
66 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
67 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
68 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
69 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
70 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
71 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
72 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
73 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
74 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
75 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
76 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
77 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
78 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
79 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
80 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
81 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
82 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
83 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
84 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
85 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
86 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
87 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
88 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
89 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
90 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
91 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
92 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
93 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
94 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
95 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
96 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
100 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
101 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
102 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
103 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
104 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
105 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
106 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
107 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
108 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
109 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
110 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
111 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
112 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
113 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
114 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
115 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
145 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
146 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
154 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
158 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
213 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
214 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
215 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
216 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
221 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
237 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
242 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
246 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
247 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
248 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
249 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
257 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
258 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
259 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
268 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
273 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
274 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
275 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
276 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
277 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
278 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
279 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
280 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
281 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
282 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
283 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
286 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
291 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
292 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
293 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
294 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
299 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
300 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
301 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
309 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
310 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
311 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
312 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
321 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
325 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
326 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
327 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
328 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
329 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
330 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
333 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
334 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
335 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
336 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
337 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
338 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
339 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
340 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
341 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.07
Metatranscriptomes 0
Isolates 9.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.88
Nodule 2.26
Rhizoplane 7.32
Rhizosphere 75.09
Stem 0
Stem Tuber 0
Unclassified 10.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_140113 2162886007 Bacteria 12908
2 JGI24739J22299_10067103 3300001989 Bacteria 1122
3 JGI25156J39149_1001801 3300002705 Bacteria 8400
4 rootH1_10005951 3300003316 Bacteria 5860
5 rootH1_10005951 3300003323 Bacteria 6736
6 rootL2_10038338 3300003322 Bacteria 4984
7 rootH1_10294715 3300003323 Bacteria 2224
8 JGI25160J50197_1000130 3300003354 Bacteria 67851
9 Ga0055532_1000158 3300003758 Bacteria 59310
10 Ga0055525_1000031 3300003759 Bacteria 314909
11 Ga0055527_1000151 3300003760 Bacteria 49117
12 Ga0055535_1000269 3300003761 Bacteria 54490
13 Ga0055542_1000282 3300003762 Bacteria 57045
14 Ga0055529_1000320 3300003763 Bacteria 54572
15 Ga0055528_1021356 3300003790 Bacteria 2058
16 Ga0055531_10000647 3300003794 Bacteria 30060
17 Ga0058692_1005128 3300003856 Bacteria 3771
18 Ga0065165_1000424 3300005262 Bacteria 66582
19 Ga0065704_10000235 3300005289 Bacteria 60501
20 Ga0065712_10142885 3300005290 Bacteria 1434
21 Ga0070658_10056599 3300005327 Bacteria 3188
22 Ga0070676_10009755 3300005328 Bacteria 5193
23 Ga0070683_100035538 3300005329 Bacteria 4555
24 Ga0070690_100020928 3300005330 Bacteria 3990
25 Ga0070690_100022261 3300005330 Bacteria 3876
26 Ga0070670_100058879 3300005331 Bacteria 3297
27 Ga0070670_100283969 3300005331 Bacteria 1445
28 Ga0070677_10008720 3300005333 Bacteria 3421
29 Ga0068869_100005703 3300005334 Bacteria 7855
30 Ga0070666_10009873 3300005335 Bacteria 5961
31 Ga0070666_10018615 3300005335 Bacteria 4470
32 Ga0068868_100080665 3300005338 Bacteria 2608
33 Ga0068868_100145003 3300005338 Bacteria 1952
34 Ga0070660_100068769 3300005339 Bacteria 2761
35 Ga0070660_100561983 3300005339 Bacteria 952
36 Ga0070689_100079347 3300005340 Bacteria 2575
37 Ga0070687_100006238 3300005343 Bacteria 4877
38 Ga0070687_100076210 3300005343 Bacteria 1816
39 Ga0070661_100001117 3300005344 Bacteria 18832
40 Ga0070661_100023174 3300005344 Bacteria 4448
41 Ga0070668_100014171 3300005347 Bacteria 5955
42 Ga0070668_100041014 3300005347 Bacteria 3545
43 Ga0070669_100000933 3300005353 Bacteria 21303
44 Ga0070669_100012526 3300005353 Bacteria 6017
45 Ga0070675_100021566 3300005354 Bacteria 5148
46 Ga0070671_100127083 3300005355 Bacteria 2147
47 Ga0070674_100004162 3300005356 Bacteria 8219
48 Ga0070674_100006354 3300005356 Bacteria 6890
49 Ga0070674_100134052 3300005356 Bacteria 1851
50 Ga0070673_100184820 3300005364 Bacteria 1786
51 Ga0070659_100014990 3300005366 Bacteria 5798
52 Ga0070667_100004808 3300005367 Bacteria 11316
53 Ga0070667_100005256 3300005367 Bacteria 10826
54 Ga0070667_100168882 3300005367 Bacteria 1930
55 Ga0070714_100001578 3300005435 Bacteria 16557
56 Ga0070713_100018003 3300005436 Bacteria 5363
57 Ga0070700_100060289 3300005441 Bacteria 2391
58 Ga0070663_100041256 3300005455 Bacteria 3236
59 Ga0070663_100106863 3300005455 Bacteria 2097
60 Ga0070678_100047942 3300005456 Bacteria 3073
61 Ga0070678_100063579 3300005456 Bacteria 2731
62 Ga0070662_100005485 3300005457 Bacteria 8108
63 Ga0070662_100039264 3300005457 Bacteria 3367
64 Ga0070662_100103287 3300005457 Bacteria 2161
65 Ga0070681_10015999 3300005458 Bacteria 7479
66 Ga0068867_100033237 3300005459 Bacteria 3733
67 Ga0068867_100041953 3300005459 Bacteria 3344
68 Ga0070684_100006951 3300005535 Bacteria 8790
69 Ga0070684_100233292 3300005535 Bacteria 1680
70 Ga0068853_100075441 3300005539 Bacteria 2943
71 Ga0068853_100094127 3300005539 Bacteria 2639
72 Ga0070672_100016946 3300005543 Bacteria 5230
73 Ga0070672_100020624 3300005543 Bacteria 4810
74 Ga0070704_100434554 3300005549 Bacteria 1127
75 Ga0068855_100003881 3300005563 Bacteria 18269
76 Ga0070664_100001653 3300005564 Bacteria 17820
77 Ga0070664_100060253 3300005564 Bacteria 3231
78 Ga0068857_100001618 3300005577 Bacteria 18074
79 Ga0068854_100014974 3300005578 Bacteria 5125
80 Ga0068856_100010244 3300005614 Bacteria 9112
81 Ga0068852_100000773 3300005616 Bacteria 21097
82 Ga0068859_100010559 3300005617 Bacteria 9296
83 Ga0068859_100039722 3300005617 Bacteria 4721
84 Ga0068859_100254400 3300005617 Bacteria 1847
85 Ga0068859_100254957 3300005617 Bacteria 1845
86 Ga0068864_100028260 3300005618 Bacteria 4738
87 Ga0068864_100084098 3300005618 Bacteria 2796
88 Ga0068864_100110833 3300005618 Bacteria 2444
89 Ga0068866_10005722 3300005718 Bacteria 5152
90 Ga0068866_10022044 3300005718 Bacteria 2943
91 Ga0068861_100001379 3300005719 Bacteria 15247
92 Ga0068861_100021917 3300005719 Bacteria 4596
93 Ga0068851_10002990 3300005834 Bacteria 7468
94 Ga0068851_10035817 3300005834 Bacteria 2483
95 Ga0068863_100003342 3300005841 Bacteria 15840
96 Ga0068863_100014771 3300005841 Bacteria 7510
97 Ga0068858_100001135 3300005842 Bacteria 27560
98 Ga0068858_100003538 3300005842 Bacteria 15470
99 Ga0068860_100006027 3300005843 Bacteria 12202
100 Ga0068860_100007280 3300005843 Bacteria 11070
101 Ga0068862_100036016 3300005844 Bacteria 4192
102 Ga0068862_100042288 3300005844 Bacteria 3882
103 Ga0081540_1100749 3300005983 Bacteria 1245
104 Ga0068871_100057272 3300006358 Bacteria 3170
105 Ga0068871_100311410 3300006358 Bacteria 1384
106 Ga0068865_100000981 3300006881 Bacteria 16322
107 Ga0068865_100016791 3300006881 Bacteria 4692
108 Ga0097620_100010559 3300006931 Bacteria 9296
109 Ga0097620_100039722 3300006931 Bacteria 4721
110 Ga0097620_100254410 3300006931 Bacteria 1847
111 Ga0097620_100254944 3300006931 Bacteria 1845
112 Ga0075435_100277002 3300007076 Bacteria 1432
113 Ga0105240_10005275 3300009093 Bacteria 19294
114 Ga0105240_10006454 3300009093 Bacteria 17236
115 Ga0105240_10088858 3300009093 Bacteria 3780
116 Ga0111539_10112024 3300009094 Bacteria 3201
117 Ga0111539_10416939 3300009094 Bacteria 1564
118 Ga0105245_10076976 3300009098 Bacteria 3040
119 Ga0105245_10202609 3300009098 Bacteria 1906
120 Ga0105243_10002261 3300009148 Bacteria 16188
121 Ga0105243_10014689 3300009148 Bacteria 5924
122 Ga0105243_10417778 3300009148 Bacteria 1250
123 Ga0105241_10081879 3300009174 Bacteria 2529
124 Ga0105248_10004719 3300009177 Bacteria 15086
125 Ga0105248_10013178 3300009177 Bacteria 9103
126 Ga0105248_10038950 3300009177 Bacteria 5322
127 Ga0105248_10046617 3300009177 Bacteria 4858
128 Ga0105248_10231403 3300009177 Bacteria 2081
129 Ga0105248_10767162 3300009177 Bacteria 1088
130 Ga0105238_10002047 3300009551 Bacteria 20346
131 Ga0105238_10055412 3300009551 Bacteria 3980
132 Ga0105249_10019510 3300009553 Bacteria 6050
133 Ga0105249_10029450 3300009553 Bacteria 4958
134 Ga0105249_10549917 3300009553 Bacteria 1205
135 Ga0105239_10412881 3300010375 Bacteria 1529
136 Ga0105246_10419254 3300011119 Bacteria 1117
137 Ga0157373_10015002 3300013100 Bacteria 5667
138 Ga0157371_10096481 3300013102 Bacteria 2095
139 Ga0157371_10113590 3300013102 Bacteria 1923
140 Ga0157370_10008140 3300013104 Bacteria 11344
141 Ga0157370_10014058 3300013104 Bacteria 8214
142 Ga0157369_10002386 3300013105 Bacteria 22557
143 Ga0157369_10089712 3300013105 Bacteria 3282
144 Ga0157374_10031714 3300013296 Bacteria 4806
145 Ga0157378_10167594 3300013297 Bacteria 2058
146 Ga0163162_10001279 3300013306 Bacteria 23543
147 Ga0163162_10006993 3300013306 Bacteria 10945
148 Ga0163162_10018074 3300013306 Bacteria 6900
149 Ga0163162_10032370 3300013306 Bacteria 5193
150 Ga0157372_10004036 3300013307 Bacteria 15742
151 Ga0157372_10138558 3300013307 Bacteria 2803
152 Ga0157372_10182791 3300013307 Bacteria 2427
153 Ga0157375_10004351 3300013308 Bacteria 12296
154 Ga0157375_10007629 3300013308 Bacteria 9464
155 Ga0157375_10012298 3300013308 Bacteria 7589
156 Ga0157375_10843834 3300013308 Bacteria 1063
157 Ga0157380_10010189 3300014326 Bacteria 6754
158 Ga0157380_10035252 3300014326 Bacteria 3864
159 Ga0157380_10053918 3300014326 Bacteria 3189
160 Ga0157380_10701381 3300014326 Bacteria 1017
161 Ga0157379_10011787 3300014968 Bacteria 7635
162 Ga0157379_10032167 3300014968 Bacteria 4676
163 Ga0157379_10044522 3300014968 Bacteria 3962
164 Ga0157376_10540693 3300014969 Bacteria 1151
165 Ga0183361_10026 3300016635 Bacteria 62773
166 Ga0163161_10007501 3300017792 Bacteria 7537
167 Ga0163161_10023841 3300017792 Bacteria 4318
168 Ga0213872_10000006 3300021361 Bacteria 249845
169 Ga0213872_10001699 3300021361 Bacteria 13851
170 Ga0209435_107255 3300025206 Bacteria 1228
171 Ga0209566_100338 3300025225 Bacteria 41148
172 Ga0209674_104932 3300025226 Bacteria 2071
173 Ga0209672_100028 3300025228 Bacteria 341962
174 Ga0209147_100117 3300025229 Bacteria 143852
175 Ga0209147_100216 3300025229 Bacteria 59996
176 Ga0209563_100044 3300025230 Bacteria 396812
177 Ga0209258_100112 3300025242 Bacteria 192884
178 Ga0209148_1000081 3300025254 Bacteria 273676
179 Ga0209759_1000120 3300025256 Bacteria 138967
180 Ga0209455_1000050 3300025272 Bacteria 373239
181 Ga0209673_1000038 3300025273 Bacteria 312957
182 Ga0209673_1032644 3300025273 Bacteria 1601
183 Ga0209564_1014519 3300025295 Bacteria 3270
184 Ga0207426_1000037 3300025302 Bacteria 442735
185 Ga0209051_1000591 3300025303 Bacteria 42820
186 Ga0209051_1009868 3300025303 Bacteria 4882
187 Ga0209257_1000015 3300025304 Bacteria 908141
188 Ga0207697_10006014 3300025315 Bacteria 5555
189 Ga0207697_10053903 3300025315 Bacteria 1666
190 Ga0207682_10048774 3300025893 Bacteria 1746
191 Ga0207688_10024894 3300025901 Bacteria 3284
192 Ga0207680_10002693 3300025903 Bacteria 8304
193 Ga0207645_10001805 3300025907 Bacteria 17283
194 Ga0207645_10011458 3300025907 Bacteria 6051
195 Ga0207643_10112233 3300025908 Bacteria 1607
196 Ga0207705_10227246 3300025909 Bacteria 1419
197 Ga0207707_10007126 3300025912 Bacteria 9741
198 Ga0207695_10001966 3300025913 Bacteria 31833
199 Ga0207695_10038953 3300025913 Bacteria 5112
200 Ga0207695_10405469 3300025913 Bacteria 1248
201 Ga0207662_10011430 3300025918 Bacteria 4925
202 Ga0207657_10077831 3300025919 Bacteria 2794
203 Ga0207649_10009313 3300025920 Bacteria 5373
204 Ga0207652_10057306 3300025921 Bacteria 3355
205 Ga0207652_10229050 3300025921 Bacteria 1675
206 Ga0207681_10000565 3300025923 Bacteria 25285
207 Ga0207694_10001672 3300025924 Bacteria 18592
208 Ga0207650_10355312 3300025925 Bacteria 1206
209 Ga0207659_10020679 3300025926 Bacteria 4354
210 Ga0207659_10046395 3300025926 Bacteria 3068
211 Ga0207659_10087034 3300025926 Bacteria 2325
212 Ga0207687_10011566 3300025927 Bacteria 5768
213 Ga0207700_10049239 3300025928 Bacteria 3134
214 Ga0207644_10061094 3300025931 Bacteria 2728
215 Ga0207644_10083751 3300025931 Bacteria 2363
216 Ga0207690_10006714 3300025932 Bacteria 6818
217 Ga0207706_10003299 3300025933 Bacteria 15455
218 Ga0207706_10035409 3300025933 Bacteria 4438
219 Ga0207706_10148467 3300025933 Bacteria 2062
220 Ga0207686_10024667 3300025934 Bacteria 3487
221 Ga0207709_10017159 3300025935 Bacteria 4036
222 Ga0207709_10036867 3300025935 Bacteria 2901
223 Ga0207669_10006024 3300025937 Bacteria 5498
224 Ga0207669_10006673 3300025937 Bacteria 5291
225 Ga0207669_10144220 3300025937 Bacteria 1658
226 Ga0207704_10006037 3300025938 Bacteria 5616
227 Ga0207704_10009093 3300025938 Bacteria 4777
228 Ga0207691_10025849 3300025940 Bacteria 5510
229 Ga0207691_10033796 3300025940 Bacteria 4761
230 Ga0207711_10007796 3300025941 Bacteria 8951
231 Ga0207711_10017149 3300025941 Bacteria 6016
232 Ga0207711_10033968 3300025941 Bacteria 4318
233 Ga0207689_10010737 3300025942 Bacteria 7881
234 Ga0207689_10108087 3300025942 Bacteria 2286
235 Ga0207661_10096785 3300025944 Bacteria 2470
236 Ga0207661_10160869 3300025944 Bacteria 1948
237 Ga0207679_10016803 3300025945 Bacteria 4864
238 Ga0207667_10012214 3300025949 Bacteria 9919
239 Ga0207667_10398733 3300025949 Bacteria 1401
240 Ga0207712_10002887 3300025961 Bacteria 10982
241 Ga0207712_10118324 3300025961 Bacteria 2000
242 Ga0207668_10045887 3300025972 Bacteria 2982
243 Ga0207640_10016554 3300025981 Bacteria 4292
244 Ga0207658_10002076 3300025986 Bacteria 14913
245 Ga0207658_10036586 3300025986 Bacteria 3520
246 Ga0207658_10143562 3300025986 Bacteria 1935
247 Ga0207658_10195472 3300025986 Bacteria 1685
248 Ga0207677_10043550 3300026023 Bacteria 2985
249 Ga0207677_10158808 3300026023 Bacteria 1754
250 Ga0207677_10217222 3300026023 Bacteria 1531
251 Ga0207703_10001247 3300026035 Bacteria 23852
252 Ga0207703_10004316 3300026035 Bacteria 11692
253 Ga0207639_10018478 3300026041 Bacteria 4955
254 Ga0207678_10063281 3300026067 Bacteria 3179
255 Ga0207678_10116658 3300026067 Bacteria 2278
256 Ga0207678_10217751 3300026067 Bacteria 1634
257 Ga0207708_10078925 3300026075 Bacteria 2528
258 Ga0207708_10087539 3300026075 Bacteria 2398
259 Ga0207702_10002061 3300026078 Bacteria 19456
260 Ga0207641_10005861 3300026088 Bacteria 10425
261 Ga0207641_10010892 3300026088 Bacteria 7450
262 Ga0207641_10232727 3300026088 Bacteria 1713
263 Ga0207648_10003583 3300026089 Bacteria 16250
264 Ga0207648_10019571 3300026089 Bacteria 6109
265 Ga0207676_10039966 3300026095 Bacteria 3592
266 Ga0207676_10061905 3300026095 Bacteria 2965
267 Ga0207676_10195783 3300026095 Bacteria 1782
268 Ga0207674_10001568 3300026116 Bacteria 29439
269 Ga0207675_100002267 3300026118 Bacteria 19129
270 Ga0207675_100013432 3300026118 Bacteria 7642
271 Ga0207683_10024095 3300026121 Bacteria 5237
272 Ga0207683_10049712 3300026121 Bacteria 3672
273 Ga0207698_10018139 3300026142 Bacteria 4789
274 Ga0207698_10083743 3300026142 Bacteria 2582
275 Ga0209371_1000090 3300027312 Bacteria 173119
276 Ga0207428_10435339 3300027907 Bacteria 957
277 Ga0268264_10003528 3300028381 Bacteria 13474
278 Ga0268264_10005666 3300028381 Bacteria 10587
279 Ga0307515_10000062 3300028794 Bacteria 247284
280 Ga0307515_10000398 3300028794 Bacteria 105087
281 Ga0307515_10037057 3300028794 Bacteria 7859
282 Ga0265338_10000251 3300028800 Bacteria 98343
283 Ga0268256_1000115 3300030500 Bacteria 116918
284 Ga0265331_10003815 3300031250 Bacteria 9557
285 Ga0265327_10000328 3300031251 Bacteria 90489
286 Ga0265327_10002520 3300031251 Bacteria 19081
287 Ga0307513_10004318 3300031456 Bacteria 18996
288 Ga0307509_10129547 3300031507 Bacteria 2482
289 Ga0307408_100444037 3300031548 Bacteria 1124
290 Ga0265342_10050003 3300031712 Bacteria 2499
291 Ga0307516_10126562 3300031730 Bacteria 2339
292 Ga0373925_0311782 3300037068 Bacteria 1272
293 Ga0395900_0515712 3300037418 Bacteria 1144
294 Ga0395905_0000168 3300037471 Bacteria 107034
295 Ga0395905_0301092 3300037471 Bacteria 1491
296 Ga0436364_0460366 3300037853 Bacteria 1545
297 Ga0436365_0259972 3300039437 Bacteria 5547
298 Ga0436361_0215868 3300039447 Bacteria 46672
299 Ga0436361_0337087 3300039447 Bacteria 12820
300 Ga0436361_0649532 3300039447 Bacteria 4198
301 Ga0439464_0029405 3300042439 Bacteria 1535
302 Ga0451577_0003537 3300042876 Bacteria 17284
303 Ga0451577_0022587 3300042876 Bacteria 5744
304 Ga0466966_0099138 3300044684 Bacteria 1803
305 Ga0453684_0746722 3300044712 Bacteria 1059
306 Ga0466960_0223848 3300044901 Bacteria 1036
307 Ga0451576_0001177 3300045051 Bacteria 46919
308 Ga0451576_0024364 3300045051 Bacteria 6537
309 Ga0451576_0353942 3300045051 Bacteria 1537
310 Ga0495592_0002925 3300046454 Bacteria 12151
311 Ga0495603_0000456 3300046455 Bacteria 22437
312 Ga0495590_0022150 3300046457 Bacteria 2248
313 Ga0495590_0079707 3300046457 Bacteria 1153
314 Ga0495590_0094266 3300046457 Bacteria 1060
315 Ga0495591_007313 3300046458 Bacteria 4718
316 Ga0495591_032160 3300046458 Bacteria 1565
317 Ga0495629_0000184 3300046459 Bacteria 56265
318 Ga0495629_0002636 3300046459 Bacteria 13746
319 Ga0495629_0004848 3300046459 Bacteria 10088
320 Ga0495638_0017619 3300046460 Bacteria 4757
321 Ga0495638_0019691 3300046460 Bacteria 4462
322 Ga0495651_0016428 3300046462 Bacteria 5732
323 Ga0495651_0078993 3300046462 Bacteria 2488
324 Ga0495653_0000402 3300046463 Bacteria 34782
325 Ga0495653_0008595 3300046463 Bacteria 8369
326 Ga0495653_0047405 3300046463 Bacteria 3323
327 Ga0495653_0125288 3300046463 Bacteria 1825
328 Ga0495650_0000155 3300046471 Bacteria 155947
329 Ga0495650_0009654 3300046471 Bacteria 5469
330 Ga0495650_0020598 3300046471 Bacteria 3211
331 Ga0495650_0029175 3300046471 Bacteria 2519
332 Ga0495580_0003240 3300046472 Bacteria 13917
333 Ga0495580_0025967 3300046472 Bacteria 4275
334 Ga0495580_0040154 3300046472 Bacteria 3345
335 Ga0495580_0041866 3300046472 Bacteria 3264
336 Ga0495582_0003942 3300046473 Bacteria 8340
337 Ga0495582_0242830 3300046473 Bacteria 1032
338 Ga0495605_0008788 3300046474 Bacteria 5700
339 Ga0495605_0021288 3300046474 Bacteria 3437
340 Ga0495664_0133377 3300046477 Bacteria 1504
341 Ga0495585_0143917 3300046492 Bacteria 1247
342 Ga0495596_0001350 3300046500 Bacteria 14138
343 Ga0495596_0083992 3300046500 Bacteria 1236
344 Ga0495583_0005616 3300046506 Bacteria 8452
345 Ga0495606_0014382 3300046507 Bacteria 6182
346 Ga0495606_0027698 3300046507 Bacteria 4011
347 Ga0495606_0173896 3300046507 Bacteria 1247
348 Ga0495606_0180729 3300046507 Bacteria 1216
349 Ga0495608_0006589 3300046511 Bacteria 8241
350 Ga0495608_0278773 3300046511 Bacteria 1038
351 Ga0495618_0004205 3300046514 Bacteria 8886
352 Ga0495620_0016431 3300046515 Bacteria 3713
353 Ga0495628_0011566 3300046516 Bacteria 7461
354 Ga0495628_0022364 3300046516 Bacteria 5194
355 Ga0495628_0052783 3300046516 Bacteria 3210
356 Ga0495630_0009093 3300046517 Bacteria 7141
357 Ga0495630_0009338 3300046517 Bacteria 7052
358 Ga0495630_0063910 3300046517 Bacteria 2764
359 Ga0495630_0097561 3300046517 Bacteria 2223
360 Ga0495644_0027424 3300046523 Bacteria 2158
361 Ga0495648_0014937 3300046524 Bacteria 5656
362 Ga0495666_0004021 3300046526 Bacteria 7435
363 Ga0495666_0011718 3300046526 Bacteria 4371
364 Ga0495666_0094716 3300046526 Bacteria 1408
365 Ga0495666_0115666 3300046526 Bacteria 1258
366 Ga0495642_0001828 3300046528 Bacteria 9115
367 Ga0495642_0061547 3300046528 Bacteria 1558
368 Ga0495652_0012413 3300046529 Bacteria 7684
369 Ga0495652_0183129 3300046529 Bacteria 1605
370 Ga0495665_0000096 3300046531 Bacteria 40491
371 Ga0495665_0006625 3300046531 Bacteria 6250
372 Ga0495665_0046254 3300046531 Bacteria 2311
373 Ga0495640_0002389 3300046533 Bacteria 15068
374 Ga0495586_0117494 3300046535 Bacteria 1484
375 Ga0495587_0017477 3300046536 Bacteria 4455
376 Ga0495609_0052878 3300046538 Bacteria 1807
377 Ga0495645_0000102 3300046543 Bacteria 59126
378 Ga0495645_0010907 3300046543 Bacteria 6384
379 Ga0495645_0036931 3300046543 Bacteria 3560
380 Ga0495622_0014385 3300046557 Bacteria 3675
381 Ga0495668_0166421 3300046616 Bacteria 1208
382 Ga0495634_0016770 3300046642 Bacteria 5232
383 Ga0495634_0042500 3300046642 Bacteria 3083
384 Ga0495634_0152308 3300046642 Bacteria 1462
385 Ga0495625_0231045 3300046660 Bacteria 1208
386 Ga0495635_0014329 3300046663 Bacteria 5547
387 Ga0495661_0030024 3300046665 Bacteria 3463
388 Ga0495661_0054042 3300046665 Bacteria 2413
389 Ga0495588_0039512 3300046674 Bacteria 2404
390 Ga0495657_0179828 3300046675 Bacteria 1299
391 Ga0495599_0053718 3300046678 Bacteria 2524
392 Ga0495599_0083242 3300046678 Bacteria 1998
393 Ga0495599_0161723 3300046678 Bacteria 1383
394 Ga0495599_0247203 3300046678 Bacteria 1086
395 Ga0495623_0002769 3300046679 Bacteria 11585
396 Ga0495623_0004393 3300046679 Bacteria 9264
397 Ga0495623_0005756 3300046679 Bacteria 8091
398 Ga0495646_0006924 3300046680 Bacteria 7197
399 Ga0495646_0023644 3300046680 Bacteria 3868
400 Ga0495646_0042708 3300046680 Bacteria 2780
401 Ga0495613_0009898 3300046689 Bacteria 7087
402 Ga0495613_0018646 3300046689 Bacteria 5175
403 Ga0495613_0029819 3300046689 Bacteria 4055
404 Ga0495624_0001277 3300046690 Bacteria 19837
405 Ga0495624_0004770 3300046690 Bacteria 9858
406 Ga0495624_0009933 3300046690 Bacteria 6577
407 Ga0495670_0038332 3300046691 Bacteria 2389
408 Ga0495671_0019964 3300046692 Bacteria 3536
409 Ga0495671_0041267 3300046692 Bacteria 2324
410 Ga0495649_0003577 3300046694 Bacteria 10421
411 Ga0495649_0081965 3300046694 Bacteria 1724
412 Ga0495589_0004735 3300046794 Bacteria 7222
413 Ga0495589_0020228 3300046794 Bacteria 3405
414 Ga0495589_0033080 3300046794 Bacteria 2598
415 Ga0495589_0058620 3300046794 Bacteria 1893
416 Ga0495600_0117325 3300046809 Bacteria 1732
417 Ga0495600_0152748 3300046809 Bacteria 1494
418 Ga0495581_0000479 3300047315 Bacteria 20370
419 Ga0495604_0000954 3300047317 Bacteria 24110
420 Ga0495604_0004275 3300047317 Bacteria 11309
421 Ga0495604_0025251 3300047317 Bacteria 4736
422 Ga0495674_0009120 3300047319 Bacteria 9425
423 Ga0495674_0076699 3300047319 Bacteria 2874
424 Ga0495674_0082408 3300047319 Bacteria 2758
425 Ga0495676_0015747 3300047321 Bacteria 6721
426 Ga0495680_0050863 3300047322 Bacteria 3238
427 Ga0495680_0065708 3300047322 Bacteria 2777
428 Ga0495680_0080161 3300047322 Bacteria 2467
429 Ga0495683_0004330 3300047323 Bacteria 8091
430 Ga0495683_0004782 3300047323 Bacteria 7607
431 Ga0495683_0011517 3300047323 Bacteria 4651
432 Ga0495687_011870 3300047443 Bacteria 4651
433 Ga0495687_022047 3300047443 Bacteria 3066
434 Ga0495675_0011856 3300047444 Bacteria 5479
435 Ga0495675_0090124 3300047444 Bacteria 1925
436 Ga0495679_000109 3300047446 Bacteria 74134
437 Ga0495679_001087 3300047446 Bacteria 16478
438 Ga0495679_036242 3300047446 Bacteria 1559
439 Ga0495673_0010950 3300047469 Bacteria 4906
440 Ga0495684_0136039 3300047471 Bacteria 1844
441 Ga0495686_0096911 3300047472 Bacteria 1784
442 Ga0495686_0105512 3300047472 Bacteria 1695
443 Ga0495593_0001173 3300047673 Bacteria 15323
444 Ga0495593_0011057 3300047673 Bacteria 5193
445 Ga0495602_0006713 3300048088 Bacteria 12071
446 Ga0495602_0043431 3300048088 Bacteria 4086
447 Ga0495602_0056564 3300048088 Bacteria 3448
448 Ga0495602_0150951 3300048088 Bacteria 1826
449 Ga0495602_0464206 3300048088 Bacteria 891
450 Ga0495614_0003519 3300048089 Bacteria 7016
451 Ga0495614_0039057 3300048089 Bacteria 2037
452 Ga0495626_0027419 3300048091 Bacteria 2770
453 Ga0496100_0029880 3300048903 Bacteria 3375
454 Ga0496100_0085191 3300048903 Bacteria 2144
455 Ga0496101_0111864 3300048904 Bacteria 2056
456 Ga0496101_0166672 3300048904 Bacteria 1691
457 Ga0496102_0027064 3300048905 Bacteria 5120
458 Ga0496102_0029234 3300048905 Bacteria 4930
459 Ga0496102_0030639 3300048905 Bacteria 4816
460 Ga0496102_0059029 3300048905 Bacteria 3507
461 Ga0496103_0001142 3300048906 Bacteria 18385
462 Ga0496103_0010223 3300048906 Bacteria 5551
463 Ga0496103_0011242 3300048906 Bacteria 5303
464 Ga0496103_0055676 3300048906 Bacteria 2453
465 Ga0496103_0377427 3300048906 Bacteria 911
466 Ga0496104_0073066 3300048907 Bacteria 3263
467 Ga0496104_0090431 3300048907 Bacteria 2925
468 Ga0496104_0115916 3300048907 Bacteria 2571
469 Ga0496104_0125597 3300048907 Bacteria 2463
470 Ga0496104_0132803 3300048907 Bacteria 2391
471 Ga0496104_0168490 3300048907 Bacteria 2100
472 Ga0496105_0091212 3300048908 Bacteria 2516
473 Ga0496105_0114880 3300048908 Bacteria 2220
474 Ga0496106_0000031 3300048909 Bacteria 135370
475 Ga0496106_0003457 3300048909 Bacteria 11767
476 Ga0496106_0069634 3300048909 Bacteria 2686
477 Ga0496106_0168393 3300048909 Bacteria 1735
478 Ga0496107_0013109 3300048910 Bacteria 5792
479 Ga0496107_0110354 3300048910 Bacteria 2021
480 Ga0496107_0167255 3300048910 Bacteria 1631
481 Ga0496108_0326529 3300048911 Bacteria 1338
482 Ga0496109_0366259 3300048912 Bacteria 1361
483 Ga0496110_0084022 3300048913 Bacteria 2841
484 Ga0496110_0142488 3300048913 Bacteria 2167
485 Ga0496110_0395594 3300048913 Bacteria 1260
486 Ga0496111_0202213 3300048914 Bacteria 1476
487 Ga0496112_0277372 3300048915 Bacteria 1624
488 Ga0496113_0065733 3300048916 Bacteria 2745
489 Ga0496114_0001973 3300048917 Bacteria 15587
490 Ga0496115_0181076 3300048918 Bacteria 1742
491 Ga0496116_0058823 3300048919 Bacteria 2503
492 Ga0496117_0013267 3300048920 Bacteria 7203
493 Ga0496117_0029805 3300048920 Bacteria 4200
494 Ga0496117_0054205 3300048920 Bacteria 2810
495 Ga0496117_0217949 3300048920 Bacteria 1064
496 Ga0496118_0013992 3300048921 Bacteria 7537
497 Ga0496118_0018999 3300048921 Bacteria 6161
498 Ga0496118_0064832 3300048921 Bacteria 2677
499 Ga0496118_0117381 3300048921 Bacteria 1746
500 Ga0496119_0133091 3300048922 Bacteria 1352
501 Ga0496119_0179611 3300048922 Bacteria 1111
502 Ga0496120_0052658 3300048923 Bacteria 2317
503 Ga0496121_0001437 3300048924 Bacteria 40244
504 Ga0496121_0006600 3300048924 Bacteria 14315
505 Ga0496121_0015621 3300048924 Bacteria 7927
506 Ga0496121_0075004 3300048924 Bacteria 2703
507 Ga0496121_0366913 3300048924 Bacteria 954
508 Ga0496122_0104313 3300048925 Bacteria 1884
509 Ga0496125_0130818 3300048928 Bacteria 1767
510 Ga0496126_0002517 3300048929 Bacteria 24555
511 Ga0496126_0010004 3300048929 Bacteria 10008
512 Ga0496126_0150610 3300048929 Bacteria 1994
513 Ga0495682_0015051 3300049460 Bacteria 2932
514 Ga0501081_0005668 3300049743 Bacteria 8081
515 nmdc:mga0k408_97728_c1 3300050493 Bacteria 1729
516 nmdc:mga0rr50_264453_c1 3300050513 Bacteria 1432
517 Ga0500593_059476 3300053117 Bacteria 1681
518 Ga0501082_0064484 3300060353 Bacteria 3155

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0515712 Ga0395900_0515712_38_817 242
2 3300047319 Ga0495674_0082408 Ga0495674_0082408_159_971 245
3 3300048907 Ga0496104_0132803 Ga0496104_0132803_84_896 245
4 3300048910 Ga0496107_0167255 Ga0496107_0167255_427_1239 245
5 3300009177 Ga0105248_10013178 Ga0105248_100131783 246
6 3300046557 Ga0495622_0014385 Ga0495622_0014385_543_1382 246
7 3300047472 Ga0495686_0105512 Ga0495686_0105512_704_1486 246
8 3300048919 Ga0496116_0058823 Ga0496116_0058823_878_1660 246
9 3300048924 Ga0496121_0366913 Ga0496121_0366913_61_843 246
10 3300037471 Ga0395905_0000168 Ga0395905_0000168_1007_1789 248
11 3300037471 Ga0395905_0301092 Ga0395905_0301092_694_1476 248
12 3300046526 Ga0495666_0115666 Ga0495666_0115666_491_1246 250
13 3300025931 Ga0207644_10083751 Ga0207644_100837512 251
14 3300003316 rootH1_10005951 rootH1_100059516 252
15 3300003322 rootL2_10038338 rootL2_100383387 252
16 3300003354 JGI25160J50197_1000130 JGI25160J50197_10001304 252
17 3300005262 Ga0065165_1000424 Ga0065165_100042457 252
18 3300005455 Ga0070663_100106863 Ga0070663_1001068633 252
19 3300005983 Ga0081540_1100749 Ga0081540_11007491 252
20 3300009093 Ga0105240_10088858 Ga0105240_100888584 252
21 3300025302 Ga0207426_1000037 Ga0207426_1000037211 252
22 3300026067 Ga0207678_10116658 Ga0207678_101166581 252
23 3300031730 Ga0307516_10126562 Ga0307516_101265622 252
24 3300046462 Ga0495651_0078993 Ga0495651_0078993_931_1743 252
25 3300046678 Ga0495599_0161723 Ga0495599_0161723_528_1340 252
26 3300046679 Ga0495623_0002769 Ga0495623_0002769_384_1196 252
27 3300047317 Ga0495604_0004275 Ga0495604_0004275_1075_1887 252
28 3300047322 Ga0495680_0080161 Ga0495680_0080161_802_1614 252
29 3300048088 Ga0495602_0150951 Ga0495602_0150951_429_1241 252
30 3300048903 Ga0496100_0029880 Ga0496100_0029880_448_1260 252
31 3300048904 Ga0496101_0166672 Ga0496101_0166672_717_1529 252
32 3300048905 Ga0496102_0027064 Ga0496102_0027064_2084_2896 252
33 3300048906 Ga0496103_0001142 Ga0496103_0001142_4244_5056 252
34 3300048907 Ga0496104_0168490 Ga0496104_0168490_504_1316 252
35 3300048920 Ga0496117_0217949 Ga0496117_0217949_36_848 252
36 3300048921 Ga0496118_0018999 Ga0496118_0018999_1995_2807 252
37 3300048923 Ga0496120_0052658 Ga0496120_0052658_1215_2027 252
38 3300048924 Ga0496121_0075004 Ga0496121_0075004_1001_1813 252
39 3300003759 Ga0055525_1000031 Ga0055525_1000031282 253
40 3300025230 Ga0209563_100044 Ga0209563_100044351 253
41 3300046462 Ga0495651_0016428 Ga0495651_0016428_1656_2468 253
42 3300046463 Ga0495653_0125288 Ga0495653_0125288_419_1231 253
43 3300046472 Ga0495580_0003240 Ga0495580_0003240_5763_6575 253
44 3300046516 Ga0495628_0022364 Ga0495628_0022364_4114_4926 253
45 3300046517 Ga0495630_0063910 Ga0495630_0063910_1441_2253 253
46 3300046526 Ga0495666_0004021 Ga0495666_0004021_5930_6742 253
47 3300046529 Ga0495652_0183129 Ga0495652_0183129_497_1309 253
48 3300046690 Ga0495624_0009933 Ga0495624_0009933_833_1645 253
49 3300047317 Ga0495604_0025251 Ga0495604_0025251_541_1353 253
50 3300047322 Ga0495680_0065708 Ga0495680_0065708_296_1108 253
51 3300047444 Ga0495675_0011856 Ga0495675_0011856_83_895 253
52 3300047471 Ga0495684_0136039 Ga0495684_0136039_866_1678 253
53 3300048929 Ga0496126_0002517 Ga0496126_0002517_827_1639 253
54 3300002705 JGI25156J39149_1001801 JGI25156J39149_10018016 254
55 3300016635 Ga0183361_10026 Ga0183361_100262 254
56 3300025256 Ga0209759_1000120 Ga0209759_100012015 254
57 3300044684 Ga0466966_0099138 Ga0466966_0099138_471_1283 254
58 3300046457 Ga0495590_0022150 Ga0495590_0022150_486_1298 254
59 3300046460 Ga0495638_0017619 Ga0495638_0017619_2846_3658 254
60 3300046463 Ga0495653_0008595 Ga0495653_0008595_4696_5508 254
61 3300046471 Ga0495650_0009654 Ga0495650_0009654_878_1690 254
62 3300046472 Ga0495580_0041866 Ga0495580_0041866_804_1616 254
63 3300046473 Ga0495582_0242830 Ga0495582_0242830_112_924 254
64 3300046474 Ga0495605_0008788 Ga0495605_0008788_1217_2029 254
65 3300046506 Ga0495583_0005616 Ga0495583_0005616_1850_2662 254
66 3300046507 Ga0495606_0027698 Ga0495606_0027698_1860_2672 254
67 3300046516 Ga0495628_0052783 Ga0495628_0052783_1199_2011 254
68 3300046526 Ga0495666_0094716 Ga0495666_0094716_570_1382 254
69 3300046528 Ga0495642_0061547 Ga0495642_0061547_577_1389 254
70 3300046538 Ga0495609_0052878 Ga0495609_0052878_979_1791 254
71 3300046642 Ga0495634_0152308 Ga0495634_0152308_24_836 254
72 3300046665 Ga0495661_0054042 Ga0495661_0054042_1103_1915 254
73 3300046680 Ga0495646_0006924 Ga0495646_0006924_1340_2152 254
74 3300046689 Ga0495613_0018646 Ga0495613_0018646_3886_4698 254
75 3300046690 Ga0495624_0001277 Ga0495624_0001277_10906_11718 254
76 3300046692 Ga0495671_0041267 Ga0495671_0041267_665_1477 254
77 3300047443 Ga0495687_022047 Ga0495687_022047_1065_1877 254
78 3300047446 Ga0495679_000109 Ga0495679_000109_6715_7527 254
79 3300047472 Ga0495686_0096911 Ga0495686_0096911_293_1105 254
80 3300047673 Ga0495593_0011057 Ga0495593_0011057_1636_2448 254
81 3300048088 Ga0495602_0464206 Ga0495602_0464206_54_866 254
82 3300048091 Ga0495626_0027419 Ga0495626_0027419_1280_2092 254
83 3300048920 Ga0496117_0029805 Ga0496117_0029805_2847_3659 254
84 3300048924 Ga0496121_0015621 Ga0496121_0015621_1191_2003 254
85 3300001989 JGI24739J22299_10067103 JGI24739J22299_100671031 257
86 3300003758 Ga0055532_1000158 Ga0055532_100015840 257
87 3300003760 Ga0055527_1000151 Ga0055527_10001513 257
88 3300003761 Ga0055535_1000269 Ga0055535_10002697 257
89 3300003762 Ga0055542_1000282 Ga0055542_100028241 257
90 3300003763 Ga0055529_1000320 Ga0055529_100032039 257
91 3300003790 Ga0055528_1021356 Ga0055528_10213562 257
92 3300003856 Ga0058692_1005128 Ga0058692_10051283 257
93 3300009093 Ga0105240_10005275 Ga0105240_1000527515 257
94 3300025225 Ga0209566_100338 Ga0209566_10033816 257
95 3300025226 Ga0209674_104932 Ga0209674_1049321 257
96 3300025228 Ga0209672_100028 Ga0209672_100028197 257
97 3300025229 Ga0209147_100117 Ga0209147_1001179 257
98 3300025229 Ga0209147_100216 Ga0209147_1002168 257
99 3300025242 Ga0209258_100112 Ga0209258_10011251 257
100 3300025254 Ga0209148_1000081 Ga0209148_100008141 257
101 3300025272 Ga0209455_1000050 Ga0209455_1000050123 257
102 3300025273 Ga0209673_1000038 Ga0209673_100003860 257
103 3300025913 Ga0207695_10001966 Ga0207695_1000196617 257
104 3300025913 Ga0207695_10405469 Ga0207695_104054692 257
105 3300027312 Ga0209371_1000090 Ga0209371_1000090114 257
106 3300030500 Ga0268256_1000115 Ga0268256_100011561 257
107 3300039437 Ga0436365_0259972 Ga0436365_0259972_125_937 257
108 3300048921 Ga0496118_0064832 Ga0496118_0064832_1181_2089 257
109 3300021361 Ga0213872_10001699 Ga0213872_100016994 258
110 3300027907 Ga0207428_10435339 Ga0207428_104353391 258
111 3300039447 Ga0436361_0337087 Ga0436361_0337087_3379_4191 258
112 3300048088 Ga0495602_0056564 Ga0495602_0056564_474_1286 258
113 3300005367 Ga0070667_100168882 Ga0070667_1001688824 259
114 3300009177 Ga0105248_10046617 Ga0105248_100466173 259
115 3300011119 Ga0105246_10419254 Ga0105246_104192542 259
116 3300013306 Ga0163162_10001279 Ga0163162_100012798 259
117 3300013308 Ga0157375_10007629 Ga0157375_100076294 259
118 3300025941 Ga0207711_10033968 Ga0207711_100339682 259
119 3300025986 Ga0207658_10143562 Ga0207658_101435622 259
120 3300045051 Ga0451576_0024364 Ga0451576_0024364_4404_5219 259
121 3300046460 Ga0495638_0019691 Ga0495638_0019691_2411_3226 259
122 3300046471 Ga0495650_0029175 Ga0495650_0029175_282_1097 259
123 3300046492 Ga0495585_0143917 Ga0495585_0143917_83_898 259
124 3300046500 Ga0495596_0083992 Ga0495596_0083992_402_1217 259
125 3300046523 Ga0495644_0027424 Ga0495644_0027424_836_1651 259
126 3300046616 Ga0495668_0166421 Ga0495668_0166421_22_858 259
127 3300046660 Ga0495625_0231045 Ga0495625_0231045_13_828 259
128 3300046678 Ga0495599_0053718 Ga0495599_0053718_13_795 259
129 3300046689 Ga0495613_0029819 Ga0495613_0029819_971_1753 259
130 3300046691 Ga0495670_0038332 Ga0495670_0038332_1540_2355 259
131 3300046794 Ga0495589_0004735 Ga0495589_0004735_605_1420 259
132 3300048905 Ga0496102_0030639 Ga0496102_0030639_1462_2277 259
133 3300048906 Ga0496103_0011242 Ga0496103_0011242_450_1265 259
134 3300048906 Ga0496103_0377427 Ga0496103_0377427_20_802 259
135 3300048907 Ga0496104_0115916 Ga0496104_0115916_1193_2008 259
136 3300048909 Ga0496106_0069634 Ga0496106_0069634_596_1411 259
137 3300048910 Ga0496107_0013109 Ga0496107_0013109_3605_4420 259
138 3300048922 Ga0496119_0179611 Ga0496119_0179611_120_935 259
139 3300048928 Ga0496125_0130818 Ga0496125_0130818_919_1755 259
140 3300047444 Ga0495675_0090124 Ga0495675_0090124_1066_1851 260
141 3300046471 Ga0495650_0020598 Ga0495650_0020598_498_1385 261
142 3300014326 Ga0157380_10701381 Ga0157380_107013811 262
143 3300046454 Ga0495592_0002925 Ga0495592_0002925_7757_8725 263
144 3300046458 Ga0495591_007313 Ga0495591_007313_541_1380 263
145 3300046459 Ga0495629_0002636 Ga0495629_0002636_8824_9792 263
146 3300046472 Ga0495580_0040154 Ga0495580_0040154_1887_2855 263
147 3300046500 Ga0495596_0001350 Ga0495596_0001350_8350_9189 263
148 3300046511 Ga0495608_0006589 Ga0495608_0006589_5270_6109 263
149 3300046514 Ga0495618_0004205 Ga0495618_0004205_6161_7000 263
150 3300046517 Ga0495630_0009338 Ga0495630_0009338_4076_5044 263
151 3300046524 Ga0495648_0014937 Ga0495648_0014937_2861_3829 263
152 3300046526 Ga0495666_0011718 Ga0495666_0011718_1972_2811 263
153 3300046531 Ga0495665_0006625 Ga0495665_0006625_4412_5380 263
154 3300046533 Ga0495640_0002389 Ga0495640_0002389_11006_11845 263
155 3300046535 Ga0495586_0117494 Ga0495586_0117494_124_963 263
156 3300046536 Ga0495587_0017477 Ga0495587_0017477_3153_3992 263
157 3300046642 Ga0495634_0016770 Ga0495634_0016770_3382_4350 263
158 3300046663 Ga0495635_0014329 Ga0495635_0014329_3686_4525 263
159 3300046665 Ga0495661_0030024 Ga0495661_0030024_2001_2969 263
160 3300046675 Ga0495657_0179828 Ga0495657_0179828_110_949 263
161 3300046678 Ga0495599_0083242 Ga0495599_0083242_1046_1885 263
162 3300046679 Ga0495623_0005756 Ga0495623_0005756_5119_6087 263
163 3300046680 Ga0495646_0042708 Ga0495646_0042708_1738_2577 263
164 3300046689 Ga0495613_0009898 Ga0495613_0009898_3062_4030 263
165 3300046692 Ga0495671_0019964 Ga0495671_0019964_918_1757 263
166 3300046794 Ga0495589_0020228 Ga0495589_0020228_592_1560 263
167 3300047319 Ga0495674_0009120 Ga0495674_0009120_7896_8735 263
168 3300047321 Ga0495676_0015747 Ga0495676_0015747_2113_2952 263
169 3300047323 Ga0495683_0004782 Ga0495683_0004782_4299_5138 263
170 3300047446 Ga0495679_001087 Ga0495679_001087_4773_5741 263
171 3300047469 Ga0495673_0010950 Ga0495673_0010950_3211_4179 263
172 3300047673 Ga0495593_0001173 Ga0495593_0001173_9760_10599 263
173 3300048088 Ga0495602_0043431 Ga0495602_0043431_190_1029 263
174 3300048089 Ga0495614_0003519 Ga0495614_0003519_1977_2945 263
175 3300048905 Ga0496102_0059029 Ga0496102_0059029_2201_3040 263
176 3300048906 Ga0496103_0010223 Ga0496103_0010223_2687_3526 263
177 3300048920 Ga0496117_0013267 Ga0496117_0013267_3282_4121 263
178 3300048921 Ga0496118_0013992 Ga0496118_0013992_2648_3487 263
179 3300048924 Ga0496121_0001437 Ga0496121_0001437_15469_16350 263
180 3300048929 Ga0496126_0010004 Ga0496126_0010004_2010_2891 263
181 3300049460 Ga0495682_0015051 Ga0495682_0015051_114_1082 263
182 3300060353 Ga0501082_0064484 Ga0501082_0064484_2336_3127 263
183 3300005327 Ga0070658_10056599 Ga0070658_100565992 264
184 3300005329 Ga0070683_100035538 Ga0070683_1000355385 264
185 3300005339 Ga0070660_100068769 Ga0070660_1000687691 264
186 3300005344 Ga0070661_100001117 Ga0070661_10000111710 264
187 3300005366 Ga0070659_100014990 Ga0070659_1000149906 264
188 3300005435 Ga0070714_100001578 Ga0070714_10000157812 264
189 3300005436 Ga0070713_100018003 Ga0070713_1000180035 264
190 3300005458 Ga0070681_10015999 Ga0070681_100159999 264
191 3300005535 Ga0070684_100006951 Ga0070684_1000069512 264
192 3300005539 Ga0068853_100094127 Ga0068853_1000941273 264
193 3300005563 Ga0068855_100003881 Ga0068855_10000388113 264
194 3300005564 Ga0070664_100001653 Ga0070664_10000165311 264
195 3300005577 Ga0068857_100001618 Ga0068857_1000016184 264
196 3300005578 Ga0068854_100014974 Ga0068854_1000149745 264
197 3300005614 Ga0068856_100010244 Ga0068856_10001024410 264
198 3300005616 Ga0068852_100000773 Ga0068852_10000077311 264
199 3300005834 Ga0068851_10035817 Ga0068851_100358172 264
200 3300009093 Ga0105240_10006454 Ga0105240_100064549 264
201 3300009174 Ga0105241_10081879 Ga0105241_100818793 264
202 3300009177 Ga0105248_10767162 Ga0105248_107671621 264
203 3300009551 Ga0105238_10002047 Ga0105238_1000204711 264
204 3300013100 Ga0157373_10015002 Ga0157373_100150022 264
205 3300013102 Ga0157371_10096481 Ga0157371_100964812 264
206 3300013104 Ga0157370_10008140 Ga0157370_100081405 264
207 3300013105 Ga0157369_10002386 Ga0157369_1000238618 264
208 3300013307 Ga0157372_10004036 Ga0157372_1000403610 264
209 3300014968 Ga0157379_10044522 Ga0157379_100445223 264
210 3300025909 Ga0207705_10227246 Ga0207705_102272462 264
211 3300025912 Ga0207707_10007126 Ga0207707_1000712610 264
212 3300025913 Ga0207695_10038953 Ga0207695_100389534 264
213 3300025919 Ga0207657_10077831 Ga0207657_100778314 264
214 3300025920 Ga0207649_10009313 Ga0207649_100093134 264
215 3300025921 Ga0207652_10057306 Ga0207652_100573062 264
216 3300025924 Ga0207694_10001672 Ga0207694_1000167210 264
217 3300025928 Ga0207700_10049239 Ga0207700_100492393 264
218 3300025932 Ga0207690_10006714 Ga0207690_100067146 264
219 3300025944 Ga0207661_10096785 Ga0207661_100967853 264
220 3300025945 Ga0207679_10016803 Ga0207679_100168034 264
221 3300025949 Ga0207667_10012214 Ga0207667_100122145 264
222 3300025981 Ga0207640_10016554 Ga0207640_100165545 264
223 3300026041 Ga0207639_10018478 Ga0207639_100184782 264
224 3300026078 Ga0207702_10002061 Ga0207702_100020618 264
225 3300026116 Ga0207674_10001568 Ga0207674_1000156813 264
226 3300026142 Ga0207698_10018139 Ga0207698_100181394 264
227 iso_pu_bacteria 2643221660 2644340769 264
228 3300005535 Ga0070684_100233292 Ga0070684_1002332921 265
229 3300005617 Ga0068859_100254400 Ga0068859_1002544002 265
230 3300005618 Ga0068864_100028260 Ga0068864_1000282604 265
231 3300006931 Ga0097620_100254410 Ga0097620_1002544102 265
232 3300009177 Ga0105248_10231403 Ga0105248_102314032 265
233 3300009553 Ga0105249_10549917 Ga0105249_105499172 265
234 3300013104 Ga0157370_10014058 Ga0157370_100140583 265
235 3300013307 Ga0157372_10138558 Ga0157372_101385582 265
236 3300025921 Ga0207652_10229050 Ga0207652_102290502 265
237 3300025986 Ga0207658_10195472 Ga0207658_101954722 265
238 3300026088 Ga0207641_10232727 Ga0207641_102327272 265
239 3300026095 Ga0207676_10195783 Ga0207676_101957832 265
240 iso_pu_bacteria 2513237082 2513554213 265
241 iso_pu_bacteria 2513237083 2513562491 265
242 iso_pu_bacteria 2513237166 2514046302 265
243 iso_pu_bacteria 2599185239 2599737044 265
244 iso_pu_bacteria 2599185240 2599742845 265
245 iso_pu_bacteria 2599185355 2600204963 265
246 iso_pu_bacteria 2675903129 2676741952 265
247 iso_pu_bacteria 2711768613 2713478244 265
248 iso_pu_bacteria 2744054900 2746092212 265
249 iso_pu_bacteria 2744054901 2746095253 265
250 iso_pu_bacteria 2751185846 2753568842 265
251 iso_pu_bacteria 2791355137 2792833031 265
252 iso_pu_bacteria 2818991452 2819632546 265
253 iso_pu_bacteria 2842324504 2842331315 265
254 iso_pu_bacteria 2842348783 2842355654 265
255 iso_pu_bacteria 2842454564 2842462042 265
256 iso_pu_bacteria 2863421361 2863421586 265
257 iso_pu_bacteria 2870068957 2870068987 265
258 iso_pu_bacteria 2900634093 2900636224 265
259 iso_pu_bacteria 2904564687 2904565769 265
260 iso_pu_bacteria 2904571731 2904572812 265
261 iso_pu_bacteria 2919527303 2919529933 265
262 iso_pu_bacteria 2921643360 2921643691 265
263 iso_pu_bacteria 2928163908 2928164125 265
264 iso_pu_bacteria 2928170801 2928173344 265
265 iso_pu_bacteria 2928536128 2928538664 265
266 iso_pu_bacteria 2981990288 2981994273 265
267 iso_pu_bacteria 641736154 642415354 265
268 iso_pu_bacteria 642555112 642594273 265
269 iso_pu_bacteria 642555113 642620316 265
270 iso_pu_bacteria 8003955200 8003959699 265
271 iso_pu_bacteria 8018845410 8018849004 265
272 iso_pu_bacteria 8020938398 8020944824 265
273 iso_pu_bacteria 8020945358 8020949697 265
274 iso_pu_bacteria 8020953355 8020959907 265
275 iso_pu_bacteria 8021120328 8021126709 265
276 iso_pu_bacteria 8039098773 8039099223 265
277 iso_pu_bacteria 2501025502 2501081751 266
278 iso_pu_bacteria 2510917013 2511085687 266
279 iso_pu_bacteria 2510917014 2511095816 266
280 iso_pu_bacteria 2510917015 2511103431 266
281 iso_pu_bacteria 2515154189 2516021514 266
282 iso_pu_bacteria 2808606384 2808971564 266
283 iso_pu_bacteria 2808606390 2809006393 266
284 iso_pu_bacteria 2808606391 2809013689 266
285 iso_pu_bacteria 2883087390 2883095194 266
286 iso_pu_bacteria 2510065045 2510249989 267
287 iso_pu_bacteria 2515154122 2515679405 267
288 iso_pu_bacteria 2718217991 2719639147 267
289 iso_pu_bacteria 2885270888 2885277284 267
290 iso_pu_bacteria 2902682994 2902683423 267
291 3300005290 Ga0065712_10142885 Ga0065712_101428852 268
292 3300005549 Ga0070704_100434554 Ga0070704_1004345541 268
293 3300005617 Ga0068859_100254957 Ga0068859_1002549572 268
294 3300006931 Ga0097620_100254944 Ga0097620_1002549442 268
295 3300014326 Ga0157380_10053918 Ga0157380_100539182 268
296 3300021361 Ga0213872_10000006 Ga0213872_10000006227 268
297 3300025908 Ga0207643_10112233 Ga0207643_101122332 268
298 3300025942 Ga0207689_10108087 Ga0207689_101080873 268
299 3300028794 Ga0307515_10000398 Ga0307515_1000039891 268
300 3300031250 Ga0265331_10003815 Ga0265331_100038156 268
301 3300031251 Ga0265327_10000328 Ga0265327_100003287 268
302 3300039447 Ga0436361_0215868 Ga0436361_0215868_3626_4447 268
303 3300039447 Ga0436361_0649532 Ga0436361_0649532_1316_2128 268
304 3300042876 Ga0451577_0003537 Ga0451577_0003537_5982_6791 268
305 3300044901 Ga0466960_0223848 Ga0466960_0223848_137_943 268
306 3300045051 Ga0451576_0001177 Ga0451576_0001177_40062_40868 268
307 3300045051 Ga0451576_0353942 Ga0451576_0353942_16_825 268
308 3300046543 Ga0495645_0010907 Ga0495645_0010907_1756_2565 268
309 3300046678 Ga0495599_0247203 Ga0495599_0247203_183_992 268
310 3300046809 Ga0495600_0117325 Ga0495600_0117325_856_1665 268
311 3300048909 Ga0496106_0003457 Ga0496106_0003457_10131_10943 268
312 3300048924 Ga0496121_0006600 Ga0496121_0006600_2996_3808 268
313 3300049743 Ga0501081_0005668 Ga0501081_0005668_2189_3010 268
314 3300003323 rootH1_10294715 rootH1_102947153 269
315 3300009551 Ga0105238_10055412 Ga0105238_100554125 269
316 3300013105 Ga0157369_10089712 Ga0157369_100897122 269
317 3300013308 Ga0157375_10843834 Ga0157375_108438342 269
318 3300025206 Ga0209435_107255 Ga0209435_1072552 269
319 3300025295 Ga0209564_1014519 Ga0209564_10145193 269
320 3300028800 Ga0265338_10000251 Ga0265338_1000025139 269
321 3300046455 Ga0495603_0000456 Ga0495603_0000456_1139_1951 269
322 3300046457 Ga0495590_0079707 Ga0495590_0079707_213_1025 269
323 3300046457 Ga0495590_0094266 Ga0495590_0094266_181_1047 269
324 3300046458 Ga0495591_032160 Ga0495591_032160_376_1188 269
325 3300046459 Ga0495629_0000184 Ga0495629_0000184_25458_26270 269
326 3300046459 Ga0495629_0004848 Ga0495629_0004848_3657_4469 269
327 3300046463 Ga0495653_0000402 Ga0495653_0000402_1985_2797 269
328 3300046471 Ga0495650_0000155 Ga0495650_0000155_105131_105943 269
329 3300046472 Ga0495580_0025967 Ga0495580_0025967_3396_4208 269
330 3300046473 Ga0495582_0003942 Ga0495582_0003942_5039_5851 269
331 3300046474 Ga0495605_0021288 Ga0495605_0021288_2118_2984 269
332 3300046477 Ga0495664_0133377 Ga0495664_0133377_403_1215 269
333 3300046507 Ga0495606_0014382 Ga0495606_0014382_3018_3830 269
334 3300046507 Ga0495606_0173896 Ga0495606_0173896_323_1135 269
335 3300046507 Ga0495606_0180729 Ga0495606_0180729_261_1157 269
336 3300046511 Ga0495608_0278773 Ga0495608_0278773_102_914 269
337 3300046515 Ga0495620_0016431 Ga0495620_0016431_1618_2514 269
338 3300046516 Ga0495628_0011566 Ga0495628_0011566_3003_3815 269
339 3300046517 Ga0495630_0009093 Ga0495630_0009093_3078_3890 269
340 3300046528 Ga0495642_0001828 Ga0495642_0001828_6096_6908 269
341 3300046529 Ga0495652_0012413 Ga0495652_0012413_1510_2322 269
342 3300046531 Ga0495665_0000096 Ga0495665_0000096_15818_16630 269
343 3300046531 Ga0495665_0046254 Ga0495665_0046254_650_1546 269
344 3300046543 Ga0495645_0000102 Ga0495645_0000102_51306_52118 269
345 3300046543 Ga0495645_0036931 Ga0495645_0036931_71_883 269
346 3300046642 Ga0495634_0042500 Ga0495634_0042500_2085_2894 269
347 3300046674 Ga0495588_0039512 Ga0495588_0039512_618_1430 269
348 3300046679 Ga0495623_0004393 Ga0495623_0004393_2752_3564 269
349 3300046680 Ga0495646_0023644 Ga0495646_0023644_2077_2889 269
350 3300046690 Ga0495624_0004770 Ga0495624_0004770_3507_4319 269
351 3300046694 Ga0495649_0003577 Ga0495649_0003577_1943_2755 269
352 3300046694 Ga0495649_0081965 Ga0495649_0081965_762_1658 269
353 3300046794 Ga0495589_0033080 Ga0495589_0033080_1330_2142 269
354 3300046794 Ga0495589_0058620 Ga0495589_0058620_31_843 269
355 3300046809 Ga0495600_0152748 Ga0495600_0152748_29_841 269
356 3300047315 Ga0495581_0000479 Ga0495581_0000479_6990_7802 269
357 3300047317 Ga0495604_0000954 Ga0495604_0000954_20867_21679 269
358 3300047319 Ga0495674_0076699 Ga0495674_0076699_1008_1874 269
359 3300047322 Ga0495680_0050863 Ga0495680_0050863_1414_2226 269
360 3300047323 Ga0495683_0004330 Ga0495683_0004330_3063_3959 269
361 3300047323 Ga0495683_0011517 Ga0495683_0011517_1089_1901 269
362 3300047443 Ga0495687_011870 Ga0495687_011870_1866_2678 269
363 3300047446 Ga0495679_036242 Ga0495679_036242_422_1234 269
364 3300048088 Ga0495602_0006713 Ga0495602_0006713_10897_11709 269
365 3300048089 Ga0495614_0039057 Ga0495614_0039057_198_1010 269
366 3300048903 Ga0496100_0085191 Ga0496100_0085191_1171_1983 269
367 3300048904 Ga0496101_0111864 Ga0496101_0111864_1141_1953 269
368 3300048905 Ga0496102_0029234 Ga0496102_0029234_3874_4770 269
369 3300048906 Ga0496103_0055676 Ga0496103_0055676_684_1580 269
370 3300048907 Ga0496104_0090431 Ga0496104_0090431_812_1678 269
371 3300048907 Ga0496104_0125597 Ga0496104_0125597_340_1152 269
372 3300048908 Ga0496105_0091212 Ga0496105_0091212_788_1654 269
373 3300048908 Ga0496105_0114880 Ga0496105_0114880_997_1809 269
374 3300048909 Ga0496106_0168393 Ga0496106_0168393_449_1315 269
375 3300048910 Ga0496107_0110354 Ga0496107_0110354_825_1721 269
376 3300048911 Ga0496108_0326529 Ga0496108_0326529_193_1059 269
377 3300048912 Ga0496109_0366259 Ga0496109_0366259_270_1166 269
378 3300048913 Ga0496110_0084022 Ga0496110_0084022_493_1389 269
379 3300048913 Ga0496110_0142488 Ga0496110_0142488_1225_2037 269
380 3300048913 Ga0496110_0395594 Ga0496110_0395594_104_916 269
381 3300048914 Ga0496111_0202213 Ga0496111_0202213_120_1016 269
382 3300048915 Ga0496112_0277372 Ga0496112_0277372_342_1238 269
383 3300048916 Ga0496113_0065733 Ga0496113_0065733_323_1219 269
384 3300048917 Ga0496114_0001973 Ga0496114_0001973_2772_3584 269
385 3300048918 Ga0496115_0181076 Ga0496115_0181076_367_1233 269
386 3300048920 Ga0496117_0054205 Ga0496117_0054205_1527_2423 269
387 3300048921 Ga0496118_0117381 Ga0496118_0117381_420_1316 269
388 3300048922 Ga0496119_0133091 Ga0496119_0133091_328_1224 269
389 3300048925 Ga0496122_0104313 Ga0496122_0104313_918_1814 269
390 3300048929 Ga0496126_0150610 Ga0496126_0150610_635_1447 269
391 iso_pu_bacteria 2512047030 2512347537 269
392 iso_pu_bacteria 2856287931 2856291980 269
393 iso_pu_bacteria 2857357740 2857360531 269
394 3300005328 Ga0070676_10009755 Ga0070676_100097554 270
395 3300005330 Ga0070690_100020928 Ga0070690_1000209281 270
396 3300005330 Ga0070690_100022261 Ga0070690_1000222614 270
397 3300005333 Ga0070677_10008720 Ga0070677_100087202 270
398 3300005334 Ga0068869_100005703 Ga0068869_1000057038 270
399 3300005335 Ga0070666_10009873 Ga0070666_100098733 270
400 3300005335 Ga0070666_10018615 Ga0070666_100186152 270
401 3300005338 Ga0068868_100080665 Ga0068868_1000806652 270
402 3300005339 Ga0070660_100561983 Ga0070660_1005619831 270
403 3300005340 Ga0070689_100079347 Ga0070689_1000793473 270
404 3300005343 Ga0070687_100006238 Ga0070687_1000062384 270
405 3300005343 Ga0070687_100076210 Ga0070687_1000762102 270
406 3300005347 Ga0070668_100014171 Ga0070668_1000141713 270
407 3300005347 Ga0070668_100041014 Ga0070668_1000410142 270
408 3300005353 Ga0070669_100000933 Ga0070669_10000093314 270
409 3300005353 Ga0070669_100012526 Ga0070669_1000125262 270
410 3300005354 Ga0070675_100021566 Ga0070675_1000215666 270
411 3300005355 Ga0070671_100127083 Ga0070671_1001270832 270
412 3300005356 Ga0070674_100004162 Ga0070674_1000041624 270
413 3300005356 Ga0070674_100006354 Ga0070674_1000063542 270
414 3300005356 Ga0070674_100134052 Ga0070674_1001340522 270
415 3300005364 Ga0070673_100184820 Ga0070673_1001848202 270
416 3300005367 Ga0070667_100004808 Ga0070667_1000048082 270
417 3300005367 Ga0070667_100005256 Ga0070667_1000052562 270
418 3300005441 Ga0070700_100060289 Ga0070700_1000602892 270
419 3300005456 Ga0070678_100047942 Ga0070678_1000479423 270
420 3300005456 Ga0070678_100063579 Ga0070678_1000635791 270
421 3300005457 Ga0070662_100005485 Ga0070662_1000054856 270
422 3300005457 Ga0070662_100039264 Ga0070662_1000392644 270
423 3300005457 Ga0070662_100103287 Ga0070662_1001032872 270
424 3300005459 Ga0068867_100033237 Ga0068867_1000332372 270
425 3300005459 Ga0068867_100041953 Ga0068867_1000419533 270
426 3300005539 Ga0068853_100075441 Ga0068853_1000754412 270
427 3300005543 Ga0070672_100016946 Ga0070672_1000169466 270
428 3300005543 Ga0070672_100020624 Ga0070672_1000206242 270
429 3300005564 Ga0070664_100060253 Ga0070664_1000602533 270
430 3300005617 Ga0068859_100010559 Ga0068859_1000105595 270
431 3300005617 Ga0068859_100039722 Ga0068859_1000397223 270
432 3300005618 Ga0068864_100084098 Ga0068864_1000840983 270
433 3300005618 Ga0068864_100110833 Ga0068864_1001108333 270
434 3300005718 Ga0068866_10005722 Ga0068866_100057223 270
435 3300005718 Ga0068866_10022044 Ga0068866_100220444 270
436 3300005719 Ga0068861_100001379 Ga0068861_10000137910 270
437 3300005719 Ga0068861_100021917 Ga0068861_1000219175 270
438 3300005841 Ga0068863_100003342 Ga0068863_10000334214 270
439 3300005841 Ga0068863_100014771 Ga0068863_1000147718 270
440 3300005842 Ga0068858_100001135 Ga0068858_10000113514 270
441 3300005842 Ga0068858_100003538 Ga0068858_10000353814 270
442 3300005843 Ga0068860_100006027 Ga0068860_1000060275 270
443 3300005843 Ga0068860_100007280 Ga0068860_1000072803 270
444 3300005844 Ga0068862_100036016 Ga0068862_1000360164 270
445 3300005844 Ga0068862_100042288 Ga0068862_1000422883 270
446 3300006358 Ga0068871_100311410 Ga0068871_1003114102 270
447 3300006881 Ga0068865_100000981 Ga0068865_10000098117 270
448 3300006881 Ga0068865_100016791 Ga0068865_1000167913 270
449 3300006931 Ga0097620_100010559 Ga0097620_1000105595 270
450 3300006931 Ga0097620_100039722 Ga0097620_1000397223 270
451 3300007076 Ga0075435_100277002 Ga0075435_1002770022 270
452 3300009094 Ga0111539_10112024 Ga0111539_101120243 270
453 3300009094 Ga0111539_10416939 Ga0111539_104169392 270
454 3300009098 Ga0105245_10202609 Ga0105245_102026092 270
455 3300009148 Ga0105243_10002261 Ga0105243_1000226117 270
456 3300009148 Ga0105243_10014689 Ga0105243_100146896 270
457 3300009148 Ga0105243_10417778 Ga0105243_104177781 270
458 3300009177 Ga0105248_10004719 Ga0105248_100047192 270
459 3300009177 Ga0105248_10038950 Ga0105248_100389503 270
460 3300009553 Ga0105249_10019510 Ga0105249_100195101 270
461 3300009553 Ga0105249_10029450 Ga0105249_100294502 270
462 3300013297 Ga0157378_10167594 Ga0157378_101675941 270
463 3300013306 Ga0163162_10006993 Ga0163162_100069936 270
464 3300013306 Ga0163162_10018074 Ga0163162_100180744 270
465 3300013306 Ga0163162_10032370 Ga0163162_100323704 270
466 3300013307 Ga0157372_10182791 Ga0157372_101827912 270
467 3300013308 Ga0157375_10004351 Ga0157375_1000435111 270
468 3300013308 Ga0157375_10012298 Ga0157375_100122983 270
469 3300014326 Ga0157380_10010189 Ga0157380_100101894 270
470 3300014326 Ga0157380_10035252 Ga0157380_100352522 270
471 3300014968 Ga0157379_10011787 Ga0157379_100117873 270
472 3300014968 Ga0157379_10032167 Ga0157379_100321672 270
473 3300017792 Ga0163161_10007501 Ga0163161_100075017 270
474 3300017792 Ga0163161_10023841 Ga0163161_100238414 270
475 3300025303 Ga0209051_1009868 Ga0209051_10098682 270
476 3300025315 Ga0207697_10006014 Ga0207697_100060143 270
477 3300025315 Ga0207697_10053903 Ga0207697_100539032 270
478 3300025893 Ga0207682_10048774 Ga0207682_100487741 270
479 3300025901 Ga0207688_10024894 Ga0207688_100248941 270
480 3300025903 Ga0207680_10002693 Ga0207680_100026935 270
481 3300025907 Ga0207645_10001805 Ga0207645_1000180518 270
482 3300025907 Ga0207645_10011458 Ga0207645_100114583 270
483 3300025918 Ga0207662_10011430 Ga0207662_100114304 270
484 3300025923 Ga0207681_10000565 Ga0207681_100005659 270
485 3300025926 Ga0207659_10020679 Ga0207659_100206792 270
486 3300025926 Ga0207659_10046395 Ga0207659_100463953 270
487 3300025926 Ga0207659_10087034 Ga0207659_100870342 270
488 3300025931 Ga0207644_10061094 Ga0207644_100610942 270
489 3300025933 Ga0207706_10003299 Ga0207706_1000329912 270
490 3300025933 Ga0207706_10035409 Ga0207706_100354094 270
491 3300025933 Ga0207706_10148467 Ga0207706_101484672 270
492 3300025934 Ga0207686_10024667 Ga0207686_100246673 270
493 3300025935 Ga0207709_10017159 Ga0207709_100171594 270
494 3300025935 Ga0207709_10036867 Ga0207709_100368672 270
495 3300025937 Ga0207669_10006024 Ga0207669_100060244 270
496 3300025937 Ga0207669_10006673 Ga0207669_100066736 270
497 3300025937 Ga0207669_10144220 Ga0207669_101442202 270
498 3300025938 Ga0207704_10006037 Ga0207704_100060375 270
499 3300025938 Ga0207704_10009093 Ga0207704_100090932 270
500 3300025940 Ga0207691_10025849 Ga0207691_100258496 270
501 3300025940 Ga0207691_10033796 Ga0207691_100337963 270
502 3300025941 Ga0207711_10007796 Ga0207711_100077966 270
503 3300025941 Ga0207711_10017149 Ga0207711_100171492 270
504 3300025942 Ga0207689_10010737 Ga0207689_100107378 270
505 3300025961 Ga0207712_10002887 Ga0207712_1000288711 270
506 3300025961 Ga0207712_10118324 Ga0207712_101183242 270
507 3300025972 Ga0207668_10045887 Ga0207668_100458872 270
508 3300025986 Ga0207658_10002076 Ga0207658_1000207610 270
509 3300025986 Ga0207658_10036586 Ga0207658_100365863 270
510 3300026023 Ga0207677_10043550 Ga0207677_100435502 270
511 3300026035 Ga0207703_10001247 Ga0207703_100012477 270
512 3300026035 Ga0207703_10004316 Ga0207703_100043163 270
513 3300026067 Ga0207678_10063281 Ga0207678_100632811 270
514 3300026067 Ga0207678_10217751 Ga0207678_102177512 270
515 3300026075 Ga0207708_10078925 Ga0207708_100789252 270
516 3300026075 Ga0207708_10087539 Ga0207708_100875392 270
517 3300026088 Ga0207641_10005861 Ga0207641_100058619 270
518 3300026088 Ga0207641_10010892 Ga0207641_100108928 270
519 3300026089 Ga0207648_10003583 Ga0207648_100035832 270
520 3300026089 Ga0207648_10019571 Ga0207648_100195713 270
521 3300026095 Ga0207676_10039966 Ga0207676_100399662 270
522 3300026095 Ga0207676_10061905 Ga0207676_100619053 270
523 3300026118 Ga0207675_100002267 Ga0207675_1000022676 270
524 3300026118 Ga0207675_100013432 Ga0207675_1000134325 270
525 3300026121 Ga0207683_10024095 Ga0207683_100240953 270
526 3300026121 Ga0207683_10049712 Ga0207683_100497123 270
527 3300026142 Ga0207698_10083743 Ga0207698_100837433 270
528 3300028381 Ga0268264_10003528 Ga0268264_100035282 270
529 3300028381 Ga0268264_10005666 Ga0268264_100056663 270
530 3300028794 Ga0307515_10037057 Ga0307515_100370576 270
531 3300031456 Ga0307513_10004318 Ga0307513_1000431810 270
532 3300031507 Ga0307509_10129547 Ga0307509_101295472 270
533 3300037068 Ga0373925_0311782 Ga0373925_0311782_115_927 270
534 3300046517 Ga0495630_0097561 Ga0495630_0097561_129_941 270
535 3300048909 Ga0496106_0000031 Ga0496106_0000031_96533_97348 270
536 3300050493 nmdc:mga0k408_97728_c1 nmdc:mga0k408_97728_c1_654_1466 270
537 3300050513 nmdc:mga0rr50_264453_c1 nmdc:mga0rr50_264453_c1_270_1082 270
538 3300053117 Ga0500593_059476 Ga0500593_059476_508_1320 270
539 iso_pu_bacteria 2501025501 2501074563 270
540 iso_pu_bacteria 2501025504 2501408076 270
541 3300003794 Ga0055531_10000647 Ga0055531_1000064731 271
542 3300014969 Ga0157376_10540693 Ga0157376_105406932 271
543 3300025273 Ga0209673_1032644 Ga0209673_10326442 271
544 3300025303 Ga0209051_1000591 Ga0209051_100059134 271
545 3300025304 Ga0209257_1000015 Ga0209257_1000015873 271
546 3300025949 Ga0207667_10398733 Ga0207667_103987332 271
547 3300028794 Ga0307515_10000062 Ga0307515_10000062214 271
548 3300031251 Ga0265327_10002520 Ga0265327_100025206 271
549 3300042439 Ga0439464_0029405 Ga0439464_0029405_688_1503 271
550 3300005338 Ga0068868_100145003 Ga0068868_1001450033 272
551 3300009098 Ga0105245_10076976 Ga0105245_100769763 272
552 3300010375 Ga0105239_10412881 Ga0105239_104128812 272
553 3300025927 Ga0207687_10011566 Ga0207687_100115663 272
554 3300026023 Ga0207677_10158808 Ga0207677_101588082 272
555 3300031712 Ga0265342_10050003 Ga0265342_100500032 272
556 3300042876 Ga0451577_0022587 Ga0451577_0022587_3435_4253 272
557 3300044712 Ga0453684_0746722 Ga0453684_0746722_123_941 272
558 3300046463 Ga0495653_0047405 Ga0495653_0047405_271_1110 272
559 3300048907 Ga0496104_0073066 Ga0496104_0073066_462_1280 272
560 3300005331 Ga0070670_100058879 Ga0070670_1000588792 275
561 3300005344 Ga0070661_100023174 Ga0070661_1000231743 275
562 3300005455 Ga0070663_100041256 Ga0070663_1000412562 275
563 3300005834 Ga0068851_10002990 Ga0068851_100029905 275
564 3300006358 Ga0068871_100057272 Ga0068871_1000572722 275
565 3300013102 Ga0157371_10113590 Ga0157371_101135902 275
566 3300013296 Ga0157374_10031714 Ga0157374_100317142 275
567 3300025944 Ga0207661_10160869 Ga0207661_101608692 275
568 3300026023 Ga0207677_10217222 Ga0207677_102172221 275
569 3300037853 Ga0436364_0460366 Ga0436364_0460366_45_878 277
570 3300031548 Ga0307408_100444037 Ga0307408_1004440372 284
571 3300005331 Ga0070670_100283969 Ga0070670_1002839692 285
572 3300025925 Ga0207650_10355312 Ga0207650_103553122 285
573 2162886007 SwRhRL2b_contig_140113 SwRhRL2b_0212.00007990 287
574 3300005289 Ga0065704_10000235 Ga0065704_1000023527 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00924

MS_channel_2nd

Mechanosensitive ion channel, beta-domain

132

199

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7raz-assembly1.cif.gz_D small conductance mechanosensitive channel mscs 0.8119 82 262
2xk0-assembly1.cif.gz_A solution structure of the tudor domain from drosophila polycomblike (pcl) 0.8035 120 160
4v42-assembly1.cif.gz_BD crystal structure of the ribosome at 5.5 a resolution. 0.7954 120 158
1kqs-assembly1.cif.gz_A the haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis 0.7819 120 158
3cc2-assembly1.cif.gz_A the refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins 0.7818 120 158
ID Description Score Start End Superfamily
af_P0C0S1_129_178_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.973 119 168 2.30.30.60
af_A0A0P0WDR2_370_418_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.966 119 167 2.30.30.60
af_Q58543_201_249_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.9547 119 167 2.30.30.60
af_P0C0S1_129_178_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.9545 119 168 2.30.30.60
af_A0A0P0WDR2_370_418_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.9473 119 167 2.30.30.60
ID Description Score Start End GO Terms
AF-A0A7S2PAS9-F1-model_v4 Mechanosensitive ion channel MscS C-terminal domain-containing protein 0.9203 145 249 GO:0008381
GO:0016020
AF-A0A838N6N7-F1-model_v4 deleted 0.9189 139 257
AF-A0A7M3WTM0-F1-model_v4 Mechanosensitive ion channel MscS C-terminal domain-containing protein 0.9079 172 264 GO:0016020
AF-A0A7S2PAS9-F1-model_v4 Mechanosensitive ion channel MscS C-terminal domain-containing protein 0.9039 145 249 GO:0008381
GO:0016020
AF-A0A2D7Y2H1-F1-model_v4 Small-conductance mechanosensitive channel 0.9019 168 264 GO:0005886
GO:0008381

Feature Viewer

pLDDT pTM Quality
86.4 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map