F465332
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 574 | 341 | 518 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300046454|Ga0495592_0002925|Ga0495592_0002925_7757_8725 |
| Length | 307 |
| Sequence | MRAPSPITPEDRALPFASAVEHCRCIAPPLFNQSKATYPTRDILDLDTIRVFIMTRGIDLGTKVLIIGLLRKVLARNGRVDPTLAHYLGSILGGLLNXXXILAILQIFGVQTTSFAALLAGLGLAIGTAWGGLLAHFAAGVFMQVLRPFKVGDFVTAGGVTGTVSELGLFGTTIVTPDNVTTIVGNNKVFSDTISNFSVLPVRRVELTAKIANGVDPTDAMNRLRAAIVQIPNVAESPAPDIEVLSFTPEGPLLCVRPYTANDHYWQVYFDTNRAIVQTFKEAGYPTPETPLAPRAVGPGATGTAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 3 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 4 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 5 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 6 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 7 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 8 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 9 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 10 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 11 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 12 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 13 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 14 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 15 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 16 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 17 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 18 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 19 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 20 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 21 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 22 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 23 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 24 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 25 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 26 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 27 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 28 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 29 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 30 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 31 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 32 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 33 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 34 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 35 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 36 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 37 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 38 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 39 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 40 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 41 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 42 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 43 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 44 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 45 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 46 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 47 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 48 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 49 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 50 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 51 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 52 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 53 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 54 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 55 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 56 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 57 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 58 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 59 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 60 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 61 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 62 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 63 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 64 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 65 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 67 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 71 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 74 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 76 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 78 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 95 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 96 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 98 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 101 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 103 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 104 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 105 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 106 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 107 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 108 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 109 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 110 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 111 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 112 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 113 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 114 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 115 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 145 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 213 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 217 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 218 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 222 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 229 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 230 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 231 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 232 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 233 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 234 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 304 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 305 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 306 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 307 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 308 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 309 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 312 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 313 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 314 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 315 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 316 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 317 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 318 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 319 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 320 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 321 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 322 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 323 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 324 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 325 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 326 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 329 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 331 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 333 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 334 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 335 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 336 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 337 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 338 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 339 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 340 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 341 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.07 |
| Metatranscriptomes | 0 |
| Isolates | 9.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.88 |
| Nodule | 2.26 |
| Rhizoplane | 7.32 |
| Rhizosphere | 75.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_140113 | 2162886007 | Bacteria | 12908 |
| 2 | JGI24739J22299_10067103 | 3300001989 | Bacteria | 1122 |
| 3 | JGI25156J39149_1001801 | 3300002705 | Bacteria | 8400 |
| 4 | rootH1_10005951 | 3300003316 | Bacteria | 5860 |
| 5 | rootH1_10005951 | 3300003323 | Bacteria | 6736 |
| 6 | rootL2_10038338 | 3300003322 | Bacteria | 4984 |
| 7 | rootH1_10294715 | 3300003323 | Bacteria | 2224 |
| 8 | JGI25160J50197_1000130 | 3300003354 | Bacteria | 67851 |
| 9 | Ga0055532_1000158 | 3300003758 | Bacteria | 59310 |
| 10 | Ga0055525_1000031 | 3300003759 | Bacteria | 314909 |
| 11 | Ga0055527_1000151 | 3300003760 | Bacteria | 49117 |
| 12 | Ga0055535_1000269 | 3300003761 | Bacteria | 54490 |
| 13 | Ga0055542_1000282 | 3300003762 | Bacteria | 57045 |
| 14 | Ga0055529_1000320 | 3300003763 | Bacteria | 54572 |
| 15 | Ga0055528_1021356 | 3300003790 | Bacteria | 2058 |
| 16 | Ga0055531_10000647 | 3300003794 | Bacteria | 30060 |
| 17 | Ga0058692_1005128 | 3300003856 | Bacteria | 3771 |
| 18 | Ga0065165_1000424 | 3300005262 | Bacteria | 66582 |
| 19 | Ga0065704_10000235 | 3300005289 | Bacteria | 60501 |
| 20 | Ga0065712_10142885 | 3300005290 | Bacteria | 1434 |
| 21 | Ga0070658_10056599 | 3300005327 | Bacteria | 3188 |
| 22 | Ga0070676_10009755 | 3300005328 | Bacteria | 5193 |
| 23 | Ga0070683_100035538 | 3300005329 | Bacteria | 4555 |
| 24 | Ga0070690_100020928 | 3300005330 | Bacteria | 3990 |
| 25 | Ga0070690_100022261 | 3300005330 | Bacteria | 3876 |
| 26 | Ga0070670_100058879 | 3300005331 | Bacteria | 3297 |
| 27 | Ga0070670_100283969 | 3300005331 | Bacteria | 1445 |
| 28 | Ga0070677_10008720 | 3300005333 | Bacteria | 3421 |
| 29 | Ga0068869_100005703 | 3300005334 | Bacteria | 7855 |
| 30 | Ga0070666_10009873 | 3300005335 | Bacteria | 5961 |
| 31 | Ga0070666_10018615 | 3300005335 | Bacteria | 4470 |
| 32 | Ga0068868_100080665 | 3300005338 | Bacteria | 2608 |
| 33 | Ga0068868_100145003 | 3300005338 | Bacteria | 1952 |
| 34 | Ga0070660_100068769 | 3300005339 | Bacteria | 2761 |
| 35 | Ga0070660_100561983 | 3300005339 | Bacteria | 952 |
| 36 | Ga0070689_100079347 | 3300005340 | Bacteria | 2575 |
| 37 | Ga0070687_100006238 | 3300005343 | Bacteria | 4877 |
| 38 | Ga0070687_100076210 | 3300005343 | Bacteria | 1816 |
| 39 | Ga0070661_100001117 | 3300005344 | Bacteria | 18832 |
| 40 | Ga0070661_100023174 | 3300005344 | Bacteria | 4448 |
| 41 | Ga0070668_100014171 | 3300005347 | Bacteria | 5955 |
| 42 | Ga0070668_100041014 | 3300005347 | Bacteria | 3545 |
| 43 | Ga0070669_100000933 | 3300005353 | Bacteria | 21303 |
| 44 | Ga0070669_100012526 | 3300005353 | Bacteria | 6017 |
| 45 | Ga0070675_100021566 | 3300005354 | Bacteria | 5148 |
| 46 | Ga0070671_100127083 | 3300005355 | Bacteria | 2147 |
| 47 | Ga0070674_100004162 | 3300005356 | Bacteria | 8219 |
| 48 | Ga0070674_100006354 | 3300005356 | Bacteria | 6890 |
| 49 | Ga0070674_100134052 | 3300005356 | Bacteria | 1851 |
| 50 | Ga0070673_100184820 | 3300005364 | Bacteria | 1786 |
| 51 | Ga0070659_100014990 | 3300005366 | Bacteria | 5798 |
| 52 | Ga0070667_100004808 | 3300005367 | Bacteria | 11316 |
| 53 | Ga0070667_100005256 | 3300005367 | Bacteria | 10826 |
| 54 | Ga0070667_100168882 | 3300005367 | Bacteria | 1930 |
| 55 | Ga0070714_100001578 | 3300005435 | Bacteria | 16557 |
| 56 | Ga0070713_100018003 | 3300005436 | Bacteria | 5363 |
| 57 | Ga0070700_100060289 | 3300005441 | Bacteria | 2391 |
| 58 | Ga0070663_100041256 | 3300005455 | Bacteria | 3236 |
| 59 | Ga0070663_100106863 | 3300005455 | Bacteria | 2097 |
| 60 | Ga0070678_100047942 | 3300005456 | Bacteria | 3073 |
| 61 | Ga0070678_100063579 | 3300005456 | Bacteria | 2731 |
| 62 | Ga0070662_100005485 | 3300005457 | Bacteria | 8108 |
| 63 | Ga0070662_100039264 | 3300005457 | Bacteria | 3367 |
| 64 | Ga0070662_100103287 | 3300005457 | Bacteria | 2161 |
| 65 | Ga0070681_10015999 | 3300005458 | Bacteria | 7479 |
| 66 | Ga0068867_100033237 | 3300005459 | Bacteria | 3733 |
| 67 | Ga0068867_100041953 | 3300005459 | Bacteria | 3344 |
| 68 | Ga0070684_100006951 | 3300005535 | Bacteria | 8790 |
| 69 | Ga0070684_100233292 | 3300005535 | Bacteria | 1680 |
| 70 | Ga0068853_100075441 | 3300005539 | Bacteria | 2943 |
| 71 | Ga0068853_100094127 | 3300005539 | Bacteria | 2639 |
| 72 | Ga0070672_100016946 | 3300005543 | Bacteria | 5230 |
| 73 | Ga0070672_100020624 | 3300005543 | Bacteria | 4810 |
| 74 | Ga0070704_100434554 | 3300005549 | Bacteria | 1127 |
| 75 | Ga0068855_100003881 | 3300005563 | Bacteria | 18269 |
| 76 | Ga0070664_100001653 | 3300005564 | Bacteria | 17820 |
| 77 | Ga0070664_100060253 | 3300005564 | Bacteria | 3231 |
| 78 | Ga0068857_100001618 | 3300005577 | Bacteria | 18074 |
| 79 | Ga0068854_100014974 | 3300005578 | Bacteria | 5125 |
| 80 | Ga0068856_100010244 | 3300005614 | Bacteria | 9112 |
| 81 | Ga0068852_100000773 | 3300005616 | Bacteria | 21097 |
| 82 | Ga0068859_100010559 | 3300005617 | Bacteria | 9296 |
| 83 | Ga0068859_100039722 | 3300005617 | Bacteria | 4721 |
| 84 | Ga0068859_100254400 | 3300005617 | Bacteria | 1847 |
| 85 | Ga0068859_100254957 | 3300005617 | Bacteria | 1845 |
| 86 | Ga0068864_100028260 | 3300005618 | Bacteria | 4738 |
| 87 | Ga0068864_100084098 | 3300005618 | Bacteria | 2796 |
| 88 | Ga0068864_100110833 | 3300005618 | Bacteria | 2444 |
| 89 | Ga0068866_10005722 | 3300005718 | Bacteria | 5152 |
| 90 | Ga0068866_10022044 | 3300005718 | Bacteria | 2943 |
| 91 | Ga0068861_100001379 | 3300005719 | Bacteria | 15247 |
| 92 | Ga0068861_100021917 | 3300005719 | Bacteria | 4596 |
| 93 | Ga0068851_10002990 | 3300005834 | Bacteria | 7468 |
| 94 | Ga0068851_10035817 | 3300005834 | Bacteria | 2483 |
| 95 | Ga0068863_100003342 | 3300005841 | Bacteria | 15840 |
| 96 | Ga0068863_100014771 | 3300005841 | Bacteria | 7510 |
| 97 | Ga0068858_100001135 | 3300005842 | Bacteria | 27560 |
| 98 | Ga0068858_100003538 | 3300005842 | Bacteria | 15470 |
| 99 | Ga0068860_100006027 | 3300005843 | Bacteria | 12202 |
| 100 | Ga0068860_100007280 | 3300005843 | Bacteria | 11070 |
| 101 | Ga0068862_100036016 | 3300005844 | Bacteria | 4192 |
| 102 | Ga0068862_100042288 | 3300005844 | Bacteria | 3882 |
| 103 | Ga0081540_1100749 | 3300005983 | Bacteria | 1245 |
| 104 | Ga0068871_100057272 | 3300006358 | Bacteria | 3170 |
| 105 | Ga0068871_100311410 | 3300006358 | Bacteria | 1384 |
| 106 | Ga0068865_100000981 | 3300006881 | Bacteria | 16322 |
| 107 | Ga0068865_100016791 | 3300006881 | Bacteria | 4692 |
| 108 | Ga0097620_100010559 | 3300006931 | Bacteria | 9296 |
| 109 | Ga0097620_100039722 | 3300006931 | Bacteria | 4721 |
| 110 | Ga0097620_100254410 | 3300006931 | Bacteria | 1847 |
| 111 | Ga0097620_100254944 | 3300006931 | Bacteria | 1845 |
| 112 | Ga0075435_100277002 | 3300007076 | Bacteria | 1432 |
| 113 | Ga0105240_10005275 | 3300009093 | Bacteria | 19294 |
| 114 | Ga0105240_10006454 | 3300009093 | Bacteria | 17236 |
| 115 | Ga0105240_10088858 | 3300009093 | Bacteria | 3780 |
| 116 | Ga0111539_10112024 | 3300009094 | Bacteria | 3201 |
| 117 | Ga0111539_10416939 | 3300009094 | Bacteria | 1564 |
| 118 | Ga0105245_10076976 | 3300009098 | Bacteria | 3040 |
| 119 | Ga0105245_10202609 | 3300009098 | Bacteria | 1906 |
| 120 | Ga0105243_10002261 | 3300009148 | Bacteria | 16188 |
| 121 | Ga0105243_10014689 | 3300009148 | Bacteria | 5924 |
| 122 | Ga0105243_10417778 | 3300009148 | Bacteria | 1250 |
| 123 | Ga0105241_10081879 | 3300009174 | Bacteria | 2529 |
| 124 | Ga0105248_10004719 | 3300009177 | Bacteria | 15086 |
| 125 | Ga0105248_10013178 | 3300009177 | Bacteria | 9103 |
| 126 | Ga0105248_10038950 | 3300009177 | Bacteria | 5322 |
| 127 | Ga0105248_10046617 | 3300009177 | Bacteria | 4858 |
| 128 | Ga0105248_10231403 | 3300009177 | Bacteria | 2081 |
| 129 | Ga0105248_10767162 | 3300009177 | Bacteria | 1088 |
| 130 | Ga0105238_10002047 | 3300009551 | Bacteria | 20346 |
| 131 | Ga0105238_10055412 | 3300009551 | Bacteria | 3980 |
| 132 | Ga0105249_10019510 | 3300009553 | Bacteria | 6050 |
| 133 | Ga0105249_10029450 | 3300009553 | Bacteria | 4958 |
| 134 | Ga0105249_10549917 | 3300009553 | Bacteria | 1205 |
| 135 | Ga0105239_10412881 | 3300010375 | Bacteria | 1529 |
| 136 | Ga0105246_10419254 | 3300011119 | Bacteria | 1117 |
| 137 | Ga0157373_10015002 | 3300013100 | Bacteria | 5667 |
| 138 | Ga0157371_10096481 | 3300013102 | Bacteria | 2095 |
| 139 | Ga0157371_10113590 | 3300013102 | Bacteria | 1923 |
| 140 | Ga0157370_10008140 | 3300013104 | Bacteria | 11344 |
| 141 | Ga0157370_10014058 | 3300013104 | Bacteria | 8214 |
| 142 | Ga0157369_10002386 | 3300013105 | Bacteria | 22557 |
| 143 | Ga0157369_10089712 | 3300013105 | Bacteria | 3282 |
| 144 | Ga0157374_10031714 | 3300013296 | Bacteria | 4806 |
| 145 | Ga0157378_10167594 | 3300013297 | Bacteria | 2058 |
| 146 | Ga0163162_10001279 | 3300013306 | Bacteria | 23543 |
| 147 | Ga0163162_10006993 | 3300013306 | Bacteria | 10945 |
| 148 | Ga0163162_10018074 | 3300013306 | Bacteria | 6900 |
| 149 | Ga0163162_10032370 | 3300013306 | Bacteria | 5193 |
| 150 | Ga0157372_10004036 | 3300013307 | Bacteria | 15742 |
| 151 | Ga0157372_10138558 | 3300013307 | Bacteria | 2803 |
| 152 | Ga0157372_10182791 | 3300013307 | Bacteria | 2427 |
| 153 | Ga0157375_10004351 | 3300013308 | Bacteria | 12296 |
| 154 | Ga0157375_10007629 | 3300013308 | Bacteria | 9464 |
| 155 | Ga0157375_10012298 | 3300013308 | Bacteria | 7589 |
| 156 | Ga0157375_10843834 | 3300013308 | Bacteria | 1063 |
| 157 | Ga0157380_10010189 | 3300014326 | Bacteria | 6754 |
| 158 | Ga0157380_10035252 | 3300014326 | Bacteria | 3864 |
| 159 | Ga0157380_10053918 | 3300014326 | Bacteria | 3189 |
| 160 | Ga0157380_10701381 | 3300014326 | Bacteria | 1017 |
| 161 | Ga0157379_10011787 | 3300014968 | Bacteria | 7635 |
| 162 | Ga0157379_10032167 | 3300014968 | Bacteria | 4676 |
| 163 | Ga0157379_10044522 | 3300014968 | Bacteria | 3962 |
| 164 | Ga0157376_10540693 | 3300014969 | Bacteria | 1151 |
| 165 | Ga0183361_10026 | 3300016635 | Bacteria | 62773 |
| 166 | Ga0163161_10007501 | 3300017792 | Bacteria | 7537 |
| 167 | Ga0163161_10023841 | 3300017792 | Bacteria | 4318 |
| 168 | Ga0213872_10000006 | 3300021361 | Bacteria | 249845 |
| 169 | Ga0213872_10001699 | 3300021361 | Bacteria | 13851 |
| 170 | Ga0209435_107255 | 3300025206 | Bacteria | 1228 |
| 171 | Ga0209566_100338 | 3300025225 | Bacteria | 41148 |
| 172 | Ga0209674_104932 | 3300025226 | Bacteria | 2071 |
| 173 | Ga0209672_100028 | 3300025228 | Bacteria | 341962 |
| 174 | Ga0209147_100117 | 3300025229 | Bacteria | 143852 |
| 175 | Ga0209147_100216 | 3300025229 | Bacteria | 59996 |
| 176 | Ga0209563_100044 | 3300025230 | Bacteria | 396812 |
| 177 | Ga0209258_100112 | 3300025242 | Bacteria | 192884 |
| 178 | Ga0209148_1000081 | 3300025254 | Bacteria | 273676 |
| 179 | Ga0209759_1000120 | 3300025256 | Bacteria | 138967 |
| 180 | Ga0209455_1000050 | 3300025272 | Bacteria | 373239 |
| 181 | Ga0209673_1000038 | 3300025273 | Bacteria | 312957 |
| 182 | Ga0209673_1032644 | 3300025273 | Bacteria | 1601 |
| 183 | Ga0209564_1014519 | 3300025295 | Bacteria | 3270 |
| 184 | Ga0207426_1000037 | 3300025302 | Bacteria | 442735 |
| 185 | Ga0209051_1000591 | 3300025303 | Bacteria | 42820 |
| 186 | Ga0209051_1009868 | 3300025303 | Bacteria | 4882 |
| 187 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 188 | Ga0207697_10006014 | 3300025315 | Bacteria | 5555 |
| 189 | Ga0207697_10053903 | 3300025315 | Bacteria | 1666 |
| 190 | Ga0207682_10048774 | 3300025893 | Bacteria | 1746 |
| 191 | Ga0207688_10024894 | 3300025901 | Bacteria | 3284 |
| 192 | Ga0207680_10002693 | 3300025903 | Bacteria | 8304 |
| 193 | Ga0207645_10001805 | 3300025907 | Bacteria | 17283 |
| 194 | Ga0207645_10011458 | 3300025907 | Bacteria | 6051 |
| 195 | Ga0207643_10112233 | 3300025908 | Bacteria | 1607 |
| 196 | Ga0207705_10227246 | 3300025909 | Bacteria | 1419 |
| 197 | Ga0207707_10007126 | 3300025912 | Bacteria | 9741 |
| 198 | Ga0207695_10001966 | 3300025913 | Bacteria | 31833 |
| 199 | Ga0207695_10038953 | 3300025913 | Bacteria | 5112 |
| 200 | Ga0207695_10405469 | 3300025913 | Bacteria | 1248 |
| 201 | Ga0207662_10011430 | 3300025918 | Bacteria | 4925 |
| 202 | Ga0207657_10077831 | 3300025919 | Bacteria | 2794 |
| 203 | Ga0207649_10009313 | 3300025920 | Bacteria | 5373 |
| 204 | Ga0207652_10057306 | 3300025921 | Bacteria | 3355 |
| 205 | Ga0207652_10229050 | 3300025921 | Bacteria | 1675 |
| 206 | Ga0207681_10000565 | 3300025923 | Bacteria | 25285 |
| 207 | Ga0207694_10001672 | 3300025924 | Bacteria | 18592 |
| 208 | Ga0207650_10355312 | 3300025925 | Bacteria | 1206 |
| 209 | Ga0207659_10020679 | 3300025926 | Bacteria | 4354 |
| 210 | Ga0207659_10046395 | 3300025926 | Bacteria | 3068 |
| 211 | Ga0207659_10087034 | 3300025926 | Bacteria | 2325 |
| 212 | Ga0207687_10011566 | 3300025927 | Bacteria | 5768 |
| 213 | Ga0207700_10049239 | 3300025928 | Bacteria | 3134 |
| 214 | Ga0207644_10061094 | 3300025931 | Bacteria | 2728 |
| 215 | Ga0207644_10083751 | 3300025931 | Bacteria | 2363 |
| 216 | Ga0207690_10006714 | 3300025932 | Bacteria | 6818 |
| 217 | Ga0207706_10003299 | 3300025933 | Bacteria | 15455 |
| 218 | Ga0207706_10035409 | 3300025933 | Bacteria | 4438 |
| 219 | Ga0207706_10148467 | 3300025933 | Bacteria | 2062 |
| 220 | Ga0207686_10024667 | 3300025934 | Bacteria | 3487 |
| 221 | Ga0207709_10017159 | 3300025935 | Bacteria | 4036 |
| 222 | Ga0207709_10036867 | 3300025935 | Bacteria | 2901 |
| 223 | Ga0207669_10006024 | 3300025937 | Bacteria | 5498 |
| 224 | Ga0207669_10006673 | 3300025937 | Bacteria | 5291 |
| 225 | Ga0207669_10144220 | 3300025937 | Bacteria | 1658 |
| 226 | Ga0207704_10006037 | 3300025938 | Bacteria | 5616 |
| 227 | Ga0207704_10009093 | 3300025938 | Bacteria | 4777 |
| 228 | Ga0207691_10025849 | 3300025940 | Bacteria | 5510 |
| 229 | Ga0207691_10033796 | 3300025940 | Bacteria | 4761 |
| 230 | Ga0207711_10007796 | 3300025941 | Bacteria | 8951 |
| 231 | Ga0207711_10017149 | 3300025941 | Bacteria | 6016 |
| 232 | Ga0207711_10033968 | 3300025941 | Bacteria | 4318 |
| 233 | Ga0207689_10010737 | 3300025942 | Bacteria | 7881 |
| 234 | Ga0207689_10108087 | 3300025942 | Bacteria | 2286 |
| 235 | Ga0207661_10096785 | 3300025944 | Bacteria | 2470 |
| 236 | Ga0207661_10160869 | 3300025944 | Bacteria | 1948 |
| 237 | Ga0207679_10016803 | 3300025945 | Bacteria | 4864 |
| 238 | Ga0207667_10012214 | 3300025949 | Bacteria | 9919 |
| 239 | Ga0207667_10398733 | 3300025949 | Bacteria | 1401 |
| 240 | Ga0207712_10002887 | 3300025961 | Bacteria | 10982 |
| 241 | Ga0207712_10118324 | 3300025961 | Bacteria | 2000 |
| 242 | Ga0207668_10045887 | 3300025972 | Bacteria | 2982 |
| 243 | Ga0207640_10016554 | 3300025981 | Bacteria | 4292 |
| 244 | Ga0207658_10002076 | 3300025986 | Bacteria | 14913 |
| 245 | Ga0207658_10036586 | 3300025986 | Bacteria | 3520 |
| 246 | Ga0207658_10143562 | 3300025986 | Bacteria | 1935 |
| 247 | Ga0207658_10195472 | 3300025986 | Bacteria | 1685 |
| 248 | Ga0207677_10043550 | 3300026023 | Bacteria | 2985 |
| 249 | Ga0207677_10158808 | 3300026023 | Bacteria | 1754 |
| 250 | Ga0207677_10217222 | 3300026023 | Bacteria | 1531 |
| 251 | Ga0207703_10001247 | 3300026035 | Bacteria | 23852 |
| 252 | Ga0207703_10004316 | 3300026035 | Bacteria | 11692 |
| 253 | Ga0207639_10018478 | 3300026041 | Bacteria | 4955 |
| 254 | Ga0207678_10063281 | 3300026067 | Bacteria | 3179 |
| 255 | Ga0207678_10116658 | 3300026067 | Bacteria | 2278 |
| 256 | Ga0207678_10217751 | 3300026067 | Bacteria | 1634 |
| 257 | Ga0207708_10078925 | 3300026075 | Bacteria | 2528 |
| 258 | Ga0207708_10087539 | 3300026075 | Bacteria | 2398 |
| 259 | Ga0207702_10002061 | 3300026078 | Bacteria | 19456 |
| 260 | Ga0207641_10005861 | 3300026088 | Bacteria | 10425 |
| 261 | Ga0207641_10010892 | 3300026088 | Bacteria | 7450 |
| 262 | Ga0207641_10232727 | 3300026088 | Bacteria | 1713 |
| 263 | Ga0207648_10003583 | 3300026089 | Bacteria | 16250 |
| 264 | Ga0207648_10019571 | 3300026089 | Bacteria | 6109 |
| 265 | Ga0207676_10039966 | 3300026095 | Bacteria | 3592 |
| 266 | Ga0207676_10061905 | 3300026095 | Bacteria | 2965 |
| 267 | Ga0207676_10195783 | 3300026095 | Bacteria | 1782 |
| 268 | Ga0207674_10001568 | 3300026116 | Bacteria | 29439 |
| 269 | Ga0207675_100002267 | 3300026118 | Bacteria | 19129 |
| 270 | Ga0207675_100013432 | 3300026118 | Bacteria | 7642 |
| 271 | Ga0207683_10024095 | 3300026121 | Bacteria | 5237 |
| 272 | Ga0207683_10049712 | 3300026121 | Bacteria | 3672 |
| 273 | Ga0207698_10018139 | 3300026142 | Bacteria | 4789 |
| 274 | Ga0207698_10083743 | 3300026142 | Bacteria | 2582 |
| 275 | Ga0209371_1000090 | 3300027312 | Bacteria | 173119 |
| 276 | Ga0207428_10435339 | 3300027907 | Bacteria | 957 |
| 277 | Ga0268264_10003528 | 3300028381 | Bacteria | 13474 |
| 278 | Ga0268264_10005666 | 3300028381 | Bacteria | 10587 |
| 279 | Ga0307515_10000062 | 3300028794 | Bacteria | 247284 |
| 280 | Ga0307515_10000398 | 3300028794 | Bacteria | 105087 |
| 281 | Ga0307515_10037057 | 3300028794 | Bacteria | 7859 |
| 282 | Ga0265338_10000251 | 3300028800 | Bacteria | 98343 |
| 283 | Ga0268256_1000115 | 3300030500 | Bacteria | 116918 |
| 284 | Ga0265331_10003815 | 3300031250 | Bacteria | 9557 |
| 285 | Ga0265327_10000328 | 3300031251 | Bacteria | 90489 |
| 286 | Ga0265327_10002520 | 3300031251 | Bacteria | 19081 |
| 287 | Ga0307513_10004318 | 3300031456 | Bacteria | 18996 |
| 288 | Ga0307509_10129547 | 3300031507 | Bacteria | 2482 |
| 289 | Ga0307408_100444037 | 3300031548 | Bacteria | 1124 |
| 290 | Ga0265342_10050003 | 3300031712 | Bacteria | 2499 |
| 291 | Ga0307516_10126562 | 3300031730 | Bacteria | 2339 |
| 292 | Ga0373925_0311782 | 3300037068 | Bacteria | 1272 |
| 293 | Ga0395900_0515712 | 3300037418 | Bacteria | 1144 |
| 294 | Ga0395905_0000168 | 3300037471 | Bacteria | 107034 |
| 295 | Ga0395905_0301092 | 3300037471 | Bacteria | 1491 |
| 296 | Ga0436364_0460366 | 3300037853 | Bacteria | 1545 |
| 297 | Ga0436365_0259972 | 3300039437 | Bacteria | 5547 |
| 298 | Ga0436361_0215868 | 3300039447 | Bacteria | 46672 |
| 299 | Ga0436361_0337087 | 3300039447 | Bacteria | 12820 |
| 300 | Ga0436361_0649532 | 3300039447 | Bacteria | 4198 |
| 301 | Ga0439464_0029405 | 3300042439 | Bacteria | 1535 |
| 302 | Ga0451577_0003537 | 3300042876 | Bacteria | 17284 |
| 303 | Ga0451577_0022587 | 3300042876 | Bacteria | 5744 |
| 304 | Ga0466966_0099138 | 3300044684 | Bacteria | 1803 |
| 305 | Ga0453684_0746722 | 3300044712 | Bacteria | 1059 |
| 306 | Ga0466960_0223848 | 3300044901 | Bacteria | 1036 |
| 307 | Ga0451576_0001177 | 3300045051 | Bacteria | 46919 |
| 308 | Ga0451576_0024364 | 3300045051 | Bacteria | 6537 |
| 309 | Ga0451576_0353942 | 3300045051 | Bacteria | 1537 |
| 310 | Ga0495592_0002925 | 3300046454 | Bacteria | 12151 |
| 311 | Ga0495603_0000456 | 3300046455 | Bacteria | 22437 |
| 312 | Ga0495590_0022150 | 3300046457 | Bacteria | 2248 |
| 313 | Ga0495590_0079707 | 3300046457 | Bacteria | 1153 |
| 314 | Ga0495590_0094266 | 3300046457 | Bacteria | 1060 |
| 315 | Ga0495591_007313 | 3300046458 | Bacteria | 4718 |
| 316 | Ga0495591_032160 | 3300046458 | Bacteria | 1565 |
| 317 | Ga0495629_0000184 | 3300046459 | Bacteria | 56265 |
| 318 | Ga0495629_0002636 | 3300046459 | Bacteria | 13746 |
| 319 | Ga0495629_0004848 | 3300046459 | Bacteria | 10088 |
| 320 | Ga0495638_0017619 | 3300046460 | Bacteria | 4757 |
| 321 | Ga0495638_0019691 | 3300046460 | Bacteria | 4462 |
| 322 | Ga0495651_0016428 | 3300046462 | Bacteria | 5732 |
| 323 | Ga0495651_0078993 | 3300046462 | Bacteria | 2488 |
| 324 | Ga0495653_0000402 | 3300046463 | Bacteria | 34782 |
| 325 | Ga0495653_0008595 | 3300046463 | Bacteria | 8369 |
| 326 | Ga0495653_0047405 | 3300046463 | Bacteria | 3323 |
| 327 | Ga0495653_0125288 | 3300046463 | Bacteria | 1825 |
| 328 | Ga0495650_0000155 | 3300046471 | Bacteria | 155947 |
| 329 | Ga0495650_0009654 | 3300046471 | Bacteria | 5469 |
| 330 | Ga0495650_0020598 | 3300046471 | Bacteria | 3211 |
| 331 | Ga0495650_0029175 | 3300046471 | Bacteria | 2519 |
| 332 | Ga0495580_0003240 | 3300046472 | Bacteria | 13917 |
| 333 | Ga0495580_0025967 | 3300046472 | Bacteria | 4275 |
| 334 | Ga0495580_0040154 | 3300046472 | Bacteria | 3345 |
| 335 | Ga0495580_0041866 | 3300046472 | Bacteria | 3264 |
| 336 | Ga0495582_0003942 | 3300046473 | Bacteria | 8340 |
| 337 | Ga0495582_0242830 | 3300046473 | Bacteria | 1032 |
| 338 | Ga0495605_0008788 | 3300046474 | Bacteria | 5700 |
| 339 | Ga0495605_0021288 | 3300046474 | Bacteria | 3437 |
| 340 | Ga0495664_0133377 | 3300046477 | Bacteria | 1504 |
| 341 | Ga0495585_0143917 | 3300046492 | Bacteria | 1247 |
| 342 | Ga0495596_0001350 | 3300046500 | Bacteria | 14138 |
| 343 | Ga0495596_0083992 | 3300046500 | Bacteria | 1236 |
| 344 | Ga0495583_0005616 | 3300046506 | Bacteria | 8452 |
| 345 | Ga0495606_0014382 | 3300046507 | Bacteria | 6182 |
| 346 | Ga0495606_0027698 | 3300046507 | Bacteria | 4011 |
| 347 | Ga0495606_0173896 | 3300046507 | Bacteria | 1247 |
| 348 | Ga0495606_0180729 | 3300046507 | Bacteria | 1216 |
| 349 | Ga0495608_0006589 | 3300046511 | Bacteria | 8241 |
| 350 | Ga0495608_0278773 | 3300046511 | Bacteria | 1038 |
| 351 | Ga0495618_0004205 | 3300046514 | Bacteria | 8886 |
| 352 | Ga0495620_0016431 | 3300046515 | Bacteria | 3713 |
| 353 | Ga0495628_0011566 | 3300046516 | Bacteria | 7461 |
| 354 | Ga0495628_0022364 | 3300046516 | Bacteria | 5194 |
| 355 | Ga0495628_0052783 | 3300046516 | Bacteria | 3210 |
| 356 | Ga0495630_0009093 | 3300046517 | Bacteria | 7141 |
| 357 | Ga0495630_0009338 | 3300046517 | Bacteria | 7052 |
| 358 | Ga0495630_0063910 | 3300046517 | Bacteria | 2764 |
| 359 | Ga0495630_0097561 | 3300046517 | Bacteria | 2223 |
| 360 | Ga0495644_0027424 | 3300046523 | Bacteria | 2158 |
| 361 | Ga0495648_0014937 | 3300046524 | Bacteria | 5656 |
| 362 | Ga0495666_0004021 | 3300046526 | Bacteria | 7435 |
| 363 | Ga0495666_0011718 | 3300046526 | Bacteria | 4371 |
| 364 | Ga0495666_0094716 | 3300046526 | Bacteria | 1408 |
| 365 | Ga0495666_0115666 | 3300046526 | Bacteria | 1258 |
| 366 | Ga0495642_0001828 | 3300046528 | Bacteria | 9115 |
| 367 | Ga0495642_0061547 | 3300046528 | Bacteria | 1558 |
| 368 | Ga0495652_0012413 | 3300046529 | Bacteria | 7684 |
| 369 | Ga0495652_0183129 | 3300046529 | Bacteria | 1605 |
| 370 | Ga0495665_0000096 | 3300046531 | Bacteria | 40491 |
| 371 | Ga0495665_0006625 | 3300046531 | Bacteria | 6250 |
| 372 | Ga0495665_0046254 | 3300046531 | Bacteria | 2311 |
| 373 | Ga0495640_0002389 | 3300046533 | Bacteria | 15068 |
| 374 | Ga0495586_0117494 | 3300046535 | Bacteria | 1484 |
| 375 | Ga0495587_0017477 | 3300046536 | Bacteria | 4455 |
| 376 | Ga0495609_0052878 | 3300046538 | Bacteria | 1807 |
| 377 | Ga0495645_0000102 | 3300046543 | Bacteria | 59126 |
| 378 | Ga0495645_0010907 | 3300046543 | Bacteria | 6384 |
| 379 | Ga0495645_0036931 | 3300046543 | Bacteria | 3560 |
| 380 | Ga0495622_0014385 | 3300046557 | Bacteria | 3675 |
| 381 | Ga0495668_0166421 | 3300046616 | Bacteria | 1208 |
| 382 | Ga0495634_0016770 | 3300046642 | Bacteria | 5232 |
| 383 | Ga0495634_0042500 | 3300046642 | Bacteria | 3083 |
| 384 | Ga0495634_0152308 | 3300046642 | Bacteria | 1462 |
| 385 | Ga0495625_0231045 | 3300046660 | Bacteria | 1208 |
| 386 | Ga0495635_0014329 | 3300046663 | Bacteria | 5547 |
| 387 | Ga0495661_0030024 | 3300046665 | Bacteria | 3463 |
| 388 | Ga0495661_0054042 | 3300046665 | Bacteria | 2413 |
| 389 | Ga0495588_0039512 | 3300046674 | Bacteria | 2404 |
| 390 | Ga0495657_0179828 | 3300046675 | Bacteria | 1299 |
| 391 | Ga0495599_0053718 | 3300046678 | Bacteria | 2524 |
| 392 | Ga0495599_0083242 | 3300046678 | Bacteria | 1998 |
| 393 | Ga0495599_0161723 | 3300046678 | Bacteria | 1383 |
| 394 | Ga0495599_0247203 | 3300046678 | Bacteria | 1086 |
| 395 | Ga0495623_0002769 | 3300046679 | Bacteria | 11585 |
| 396 | Ga0495623_0004393 | 3300046679 | Bacteria | 9264 |
| 397 | Ga0495623_0005756 | 3300046679 | Bacteria | 8091 |
| 398 | Ga0495646_0006924 | 3300046680 | Bacteria | 7197 |
| 399 | Ga0495646_0023644 | 3300046680 | Bacteria | 3868 |
| 400 | Ga0495646_0042708 | 3300046680 | Bacteria | 2780 |
| 401 | Ga0495613_0009898 | 3300046689 | Bacteria | 7087 |
| 402 | Ga0495613_0018646 | 3300046689 | Bacteria | 5175 |
| 403 | Ga0495613_0029819 | 3300046689 | Bacteria | 4055 |
| 404 | Ga0495624_0001277 | 3300046690 | Bacteria | 19837 |
| 405 | Ga0495624_0004770 | 3300046690 | Bacteria | 9858 |
| 406 | Ga0495624_0009933 | 3300046690 | Bacteria | 6577 |
| 407 | Ga0495670_0038332 | 3300046691 | Bacteria | 2389 |
| 408 | Ga0495671_0019964 | 3300046692 | Bacteria | 3536 |
| 409 | Ga0495671_0041267 | 3300046692 | Bacteria | 2324 |
| 410 | Ga0495649_0003577 | 3300046694 | Bacteria | 10421 |
| 411 | Ga0495649_0081965 | 3300046694 | Bacteria | 1724 |
| 412 | Ga0495589_0004735 | 3300046794 | Bacteria | 7222 |
| 413 | Ga0495589_0020228 | 3300046794 | Bacteria | 3405 |
| 414 | Ga0495589_0033080 | 3300046794 | Bacteria | 2598 |
| 415 | Ga0495589_0058620 | 3300046794 | Bacteria | 1893 |
| 416 | Ga0495600_0117325 | 3300046809 | Bacteria | 1732 |
| 417 | Ga0495600_0152748 | 3300046809 | Bacteria | 1494 |
| 418 | Ga0495581_0000479 | 3300047315 | Bacteria | 20370 |
| 419 | Ga0495604_0000954 | 3300047317 | Bacteria | 24110 |
| 420 | Ga0495604_0004275 | 3300047317 | Bacteria | 11309 |
| 421 | Ga0495604_0025251 | 3300047317 | Bacteria | 4736 |
| 422 | Ga0495674_0009120 | 3300047319 | Bacteria | 9425 |
| 423 | Ga0495674_0076699 | 3300047319 | Bacteria | 2874 |
| 424 | Ga0495674_0082408 | 3300047319 | Bacteria | 2758 |
| 425 | Ga0495676_0015747 | 3300047321 | Bacteria | 6721 |
| 426 | Ga0495680_0050863 | 3300047322 | Bacteria | 3238 |
| 427 | Ga0495680_0065708 | 3300047322 | Bacteria | 2777 |
| 428 | Ga0495680_0080161 | 3300047322 | Bacteria | 2467 |
| 429 | Ga0495683_0004330 | 3300047323 | Bacteria | 8091 |
| 430 | Ga0495683_0004782 | 3300047323 | Bacteria | 7607 |
| 431 | Ga0495683_0011517 | 3300047323 | Bacteria | 4651 |
| 432 | Ga0495687_011870 | 3300047443 | Bacteria | 4651 |
| 433 | Ga0495687_022047 | 3300047443 | Bacteria | 3066 |
| 434 | Ga0495675_0011856 | 3300047444 | Bacteria | 5479 |
| 435 | Ga0495675_0090124 | 3300047444 | Bacteria | 1925 |
| 436 | Ga0495679_000109 | 3300047446 | Bacteria | 74134 |
| 437 | Ga0495679_001087 | 3300047446 | Bacteria | 16478 |
| 438 | Ga0495679_036242 | 3300047446 | Bacteria | 1559 |
| 439 | Ga0495673_0010950 | 3300047469 | Bacteria | 4906 |
| 440 | Ga0495684_0136039 | 3300047471 | Bacteria | 1844 |
| 441 | Ga0495686_0096911 | 3300047472 | Bacteria | 1784 |
| 442 | Ga0495686_0105512 | 3300047472 | Bacteria | 1695 |
| 443 | Ga0495593_0001173 | 3300047673 | Bacteria | 15323 |
| 444 | Ga0495593_0011057 | 3300047673 | Bacteria | 5193 |
| 445 | Ga0495602_0006713 | 3300048088 | Bacteria | 12071 |
| 446 | Ga0495602_0043431 | 3300048088 | Bacteria | 4086 |
| 447 | Ga0495602_0056564 | 3300048088 | Bacteria | 3448 |
| 448 | Ga0495602_0150951 | 3300048088 | Bacteria | 1826 |
| 449 | Ga0495602_0464206 | 3300048088 | Bacteria | 891 |
| 450 | Ga0495614_0003519 | 3300048089 | Bacteria | 7016 |
| 451 | Ga0495614_0039057 | 3300048089 | Bacteria | 2037 |
| 452 | Ga0495626_0027419 | 3300048091 | Bacteria | 2770 |
| 453 | Ga0496100_0029880 | 3300048903 | Bacteria | 3375 |
| 454 | Ga0496100_0085191 | 3300048903 | Bacteria | 2144 |
| 455 | Ga0496101_0111864 | 3300048904 | Bacteria | 2056 |
| 456 | Ga0496101_0166672 | 3300048904 | Bacteria | 1691 |
| 457 | Ga0496102_0027064 | 3300048905 | Bacteria | 5120 |
| 458 | Ga0496102_0029234 | 3300048905 | Bacteria | 4930 |
| 459 | Ga0496102_0030639 | 3300048905 | Bacteria | 4816 |
| 460 | Ga0496102_0059029 | 3300048905 | Bacteria | 3507 |
| 461 | Ga0496103_0001142 | 3300048906 | Bacteria | 18385 |
| 462 | Ga0496103_0010223 | 3300048906 | Bacteria | 5551 |
| 463 | Ga0496103_0011242 | 3300048906 | Bacteria | 5303 |
| 464 | Ga0496103_0055676 | 3300048906 | Bacteria | 2453 |
| 465 | Ga0496103_0377427 | 3300048906 | Bacteria | 911 |
| 466 | Ga0496104_0073066 | 3300048907 | Bacteria | 3263 |
| 467 | Ga0496104_0090431 | 3300048907 | Bacteria | 2925 |
| 468 | Ga0496104_0115916 | 3300048907 | Bacteria | 2571 |
| 469 | Ga0496104_0125597 | 3300048907 | Bacteria | 2463 |
| 470 | Ga0496104_0132803 | 3300048907 | Bacteria | 2391 |
| 471 | Ga0496104_0168490 | 3300048907 | Bacteria | 2100 |
| 472 | Ga0496105_0091212 | 3300048908 | Bacteria | 2516 |
| 473 | Ga0496105_0114880 | 3300048908 | Bacteria | 2220 |
| 474 | Ga0496106_0000031 | 3300048909 | Bacteria | 135370 |
| 475 | Ga0496106_0003457 | 3300048909 | Bacteria | 11767 |
| 476 | Ga0496106_0069634 | 3300048909 | Bacteria | 2686 |
| 477 | Ga0496106_0168393 | 3300048909 | Bacteria | 1735 |
| 478 | Ga0496107_0013109 | 3300048910 | Bacteria | 5792 |
| 479 | Ga0496107_0110354 | 3300048910 | Bacteria | 2021 |
| 480 | Ga0496107_0167255 | 3300048910 | Bacteria | 1631 |
| 481 | Ga0496108_0326529 | 3300048911 | Bacteria | 1338 |
| 482 | Ga0496109_0366259 | 3300048912 | Bacteria | 1361 |
| 483 | Ga0496110_0084022 | 3300048913 | Bacteria | 2841 |
| 484 | Ga0496110_0142488 | 3300048913 | Bacteria | 2167 |
| 485 | Ga0496110_0395594 | 3300048913 | Bacteria | 1260 |
| 486 | Ga0496111_0202213 | 3300048914 | Bacteria | 1476 |
| 487 | Ga0496112_0277372 | 3300048915 | Bacteria | 1624 |
| 488 | Ga0496113_0065733 | 3300048916 | Bacteria | 2745 |
| 489 | Ga0496114_0001973 | 3300048917 | Bacteria | 15587 |
| 490 | Ga0496115_0181076 | 3300048918 | Bacteria | 1742 |
| 491 | Ga0496116_0058823 | 3300048919 | Bacteria | 2503 |
| 492 | Ga0496117_0013267 | 3300048920 | Bacteria | 7203 |
| 493 | Ga0496117_0029805 | 3300048920 | Bacteria | 4200 |
| 494 | Ga0496117_0054205 | 3300048920 | Bacteria | 2810 |
| 495 | Ga0496117_0217949 | 3300048920 | Bacteria | 1064 |
| 496 | Ga0496118_0013992 | 3300048921 | Bacteria | 7537 |
| 497 | Ga0496118_0018999 | 3300048921 | Bacteria | 6161 |
| 498 | Ga0496118_0064832 | 3300048921 | Bacteria | 2677 |
| 499 | Ga0496118_0117381 | 3300048921 | Bacteria | 1746 |
| 500 | Ga0496119_0133091 | 3300048922 | Bacteria | 1352 |
| 501 | Ga0496119_0179611 | 3300048922 | Bacteria | 1111 |
| 502 | Ga0496120_0052658 | 3300048923 | Bacteria | 2317 |
| 503 | Ga0496121_0001437 | 3300048924 | Bacteria | 40244 |
| 504 | Ga0496121_0006600 | 3300048924 | Bacteria | 14315 |
| 505 | Ga0496121_0015621 | 3300048924 | Bacteria | 7927 |
| 506 | Ga0496121_0075004 | 3300048924 | Bacteria | 2703 |
| 507 | Ga0496121_0366913 | 3300048924 | Bacteria | 954 |
| 508 | Ga0496122_0104313 | 3300048925 | Bacteria | 1884 |
| 509 | Ga0496125_0130818 | 3300048928 | Bacteria | 1767 |
| 510 | Ga0496126_0002517 | 3300048929 | Bacteria | 24555 |
| 511 | Ga0496126_0010004 | 3300048929 | Bacteria | 10008 |
| 512 | Ga0496126_0150610 | 3300048929 | Bacteria | 1994 |
| 513 | Ga0495682_0015051 | 3300049460 | Bacteria | 2932 |
| 514 | Ga0501081_0005668 | 3300049743 | Bacteria | 8081 |
| 515 | nmdc:mga0k408_97728_c1 | 3300050493 | Bacteria | 1729 |
| 516 | nmdc:mga0rr50_264453_c1 | 3300050513 | Bacteria | 1432 |
| 517 | Ga0500593_059476 | 3300053117 | Bacteria | 1681 |
| 518 | Ga0501082_0064484 | 3300060353 | Bacteria | 3155 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037418 | Ga0395900_0515712 | Ga0395900_0515712_38_817 | 242 |
| 2 | 3300047319 | Ga0495674_0082408 | Ga0495674_0082408_159_971 | 245 |
| 3 | 3300048907 | Ga0496104_0132803 | Ga0496104_0132803_84_896 | 245 |
| 4 | 3300048910 | Ga0496107_0167255 | Ga0496107_0167255_427_1239 | 245 |
| 5 | 3300009177 | Ga0105248_10013178 | Ga0105248_100131783 | 246 |
| 6 | 3300046557 | Ga0495622_0014385 | Ga0495622_0014385_543_1382 | 246 |
| 7 | 3300047472 | Ga0495686_0105512 | Ga0495686_0105512_704_1486 | 246 |
| 8 | 3300048919 | Ga0496116_0058823 | Ga0496116_0058823_878_1660 | 246 |
| 9 | 3300048924 | Ga0496121_0366913 | Ga0496121_0366913_61_843 | 246 |
| 10 | 3300037471 | Ga0395905_0000168 | Ga0395905_0000168_1007_1789 | 248 |
| 11 | 3300037471 | Ga0395905_0301092 | Ga0395905_0301092_694_1476 | 248 |
| 12 | 3300046526 | Ga0495666_0115666 | Ga0495666_0115666_491_1246 | 250 |
| 13 | 3300025931 | Ga0207644_10083751 | Ga0207644_100837512 | 251 |
| 14 | 3300003316 | rootH1_10005951 | rootH1_100059516 | 252 |
| 15 | 3300003322 | rootL2_10038338 | rootL2_100383387 | 252 |
| 16 | 3300003354 | JGI25160J50197_1000130 | JGI25160J50197_10001304 | 252 |
| 17 | 3300005262 | Ga0065165_1000424 | Ga0065165_100042457 | 252 |
| 18 | 3300005455 | Ga0070663_100106863 | Ga0070663_1001068633 | 252 |
| 19 | 3300005983 | Ga0081540_1100749 | Ga0081540_11007491 | 252 |
| 20 | 3300009093 | Ga0105240_10088858 | Ga0105240_100888584 | 252 |
| 21 | 3300025302 | Ga0207426_1000037 | Ga0207426_1000037211 | 252 |
| 22 | 3300026067 | Ga0207678_10116658 | Ga0207678_101166581 | 252 |
| 23 | 3300031730 | Ga0307516_10126562 | Ga0307516_101265622 | 252 |
| 24 | 3300046462 | Ga0495651_0078993 | Ga0495651_0078993_931_1743 | 252 |
| 25 | 3300046678 | Ga0495599_0161723 | Ga0495599_0161723_528_1340 | 252 |
| 26 | 3300046679 | Ga0495623_0002769 | Ga0495623_0002769_384_1196 | 252 |
| 27 | 3300047317 | Ga0495604_0004275 | Ga0495604_0004275_1075_1887 | 252 |
| 28 | 3300047322 | Ga0495680_0080161 | Ga0495680_0080161_802_1614 | 252 |
| 29 | 3300048088 | Ga0495602_0150951 | Ga0495602_0150951_429_1241 | 252 |
| 30 | 3300048903 | Ga0496100_0029880 | Ga0496100_0029880_448_1260 | 252 |
| 31 | 3300048904 | Ga0496101_0166672 | Ga0496101_0166672_717_1529 | 252 |
| 32 | 3300048905 | Ga0496102_0027064 | Ga0496102_0027064_2084_2896 | 252 |
| 33 | 3300048906 | Ga0496103_0001142 | Ga0496103_0001142_4244_5056 | 252 |
| 34 | 3300048907 | Ga0496104_0168490 | Ga0496104_0168490_504_1316 | 252 |
| 35 | 3300048920 | Ga0496117_0217949 | Ga0496117_0217949_36_848 | 252 |
| 36 | 3300048921 | Ga0496118_0018999 | Ga0496118_0018999_1995_2807 | 252 |
| 37 | 3300048923 | Ga0496120_0052658 | Ga0496120_0052658_1215_2027 | 252 |
| 38 | 3300048924 | Ga0496121_0075004 | Ga0496121_0075004_1001_1813 | 252 |
| 39 | 3300003759 | Ga0055525_1000031 | Ga0055525_1000031282 | 253 |
| 40 | 3300025230 | Ga0209563_100044 | Ga0209563_100044351 | 253 |
| 41 | 3300046462 | Ga0495651_0016428 | Ga0495651_0016428_1656_2468 | 253 |
| 42 | 3300046463 | Ga0495653_0125288 | Ga0495653_0125288_419_1231 | 253 |
| 43 | 3300046472 | Ga0495580_0003240 | Ga0495580_0003240_5763_6575 | 253 |
| 44 | 3300046516 | Ga0495628_0022364 | Ga0495628_0022364_4114_4926 | 253 |
| 45 | 3300046517 | Ga0495630_0063910 | Ga0495630_0063910_1441_2253 | 253 |
| 46 | 3300046526 | Ga0495666_0004021 | Ga0495666_0004021_5930_6742 | 253 |
| 47 | 3300046529 | Ga0495652_0183129 | Ga0495652_0183129_497_1309 | 253 |
| 48 | 3300046690 | Ga0495624_0009933 | Ga0495624_0009933_833_1645 | 253 |
| 49 | 3300047317 | Ga0495604_0025251 | Ga0495604_0025251_541_1353 | 253 |
| 50 | 3300047322 | Ga0495680_0065708 | Ga0495680_0065708_296_1108 | 253 |
| 51 | 3300047444 | Ga0495675_0011856 | Ga0495675_0011856_83_895 | 253 |
| 52 | 3300047471 | Ga0495684_0136039 | Ga0495684_0136039_866_1678 | 253 |
| 53 | 3300048929 | Ga0496126_0002517 | Ga0496126_0002517_827_1639 | 253 |
| 54 | 3300002705 | JGI25156J39149_1001801 | JGI25156J39149_10018016 | 254 |
| 55 | 3300016635 | Ga0183361_10026 | Ga0183361_100262 | 254 |
| 56 | 3300025256 | Ga0209759_1000120 | Ga0209759_100012015 | 254 |
| 57 | 3300044684 | Ga0466966_0099138 | Ga0466966_0099138_471_1283 | 254 |
| 58 | 3300046457 | Ga0495590_0022150 | Ga0495590_0022150_486_1298 | 254 |
| 59 | 3300046460 | Ga0495638_0017619 | Ga0495638_0017619_2846_3658 | 254 |
| 60 | 3300046463 | Ga0495653_0008595 | Ga0495653_0008595_4696_5508 | 254 |
| 61 | 3300046471 | Ga0495650_0009654 | Ga0495650_0009654_878_1690 | 254 |
| 62 | 3300046472 | Ga0495580_0041866 | Ga0495580_0041866_804_1616 | 254 |
| 63 | 3300046473 | Ga0495582_0242830 | Ga0495582_0242830_112_924 | 254 |
| 64 | 3300046474 | Ga0495605_0008788 | Ga0495605_0008788_1217_2029 | 254 |
| 65 | 3300046506 | Ga0495583_0005616 | Ga0495583_0005616_1850_2662 | 254 |
| 66 | 3300046507 | Ga0495606_0027698 | Ga0495606_0027698_1860_2672 | 254 |
| 67 | 3300046516 | Ga0495628_0052783 | Ga0495628_0052783_1199_2011 | 254 |
| 68 | 3300046526 | Ga0495666_0094716 | Ga0495666_0094716_570_1382 | 254 |
| 69 | 3300046528 | Ga0495642_0061547 | Ga0495642_0061547_577_1389 | 254 |
| 70 | 3300046538 | Ga0495609_0052878 | Ga0495609_0052878_979_1791 | 254 |
| 71 | 3300046642 | Ga0495634_0152308 | Ga0495634_0152308_24_836 | 254 |
| 72 | 3300046665 | Ga0495661_0054042 | Ga0495661_0054042_1103_1915 | 254 |
| 73 | 3300046680 | Ga0495646_0006924 | Ga0495646_0006924_1340_2152 | 254 |
| 74 | 3300046689 | Ga0495613_0018646 | Ga0495613_0018646_3886_4698 | 254 |
| 75 | 3300046690 | Ga0495624_0001277 | Ga0495624_0001277_10906_11718 | 254 |
| 76 | 3300046692 | Ga0495671_0041267 | Ga0495671_0041267_665_1477 | 254 |
| 77 | 3300047443 | Ga0495687_022047 | Ga0495687_022047_1065_1877 | 254 |
| 78 | 3300047446 | Ga0495679_000109 | Ga0495679_000109_6715_7527 | 254 |
| 79 | 3300047472 | Ga0495686_0096911 | Ga0495686_0096911_293_1105 | 254 |
| 80 | 3300047673 | Ga0495593_0011057 | Ga0495593_0011057_1636_2448 | 254 |
| 81 | 3300048088 | Ga0495602_0464206 | Ga0495602_0464206_54_866 | 254 |
| 82 | 3300048091 | Ga0495626_0027419 | Ga0495626_0027419_1280_2092 | 254 |
| 83 | 3300048920 | Ga0496117_0029805 | Ga0496117_0029805_2847_3659 | 254 |
| 84 | 3300048924 | Ga0496121_0015621 | Ga0496121_0015621_1191_2003 | 254 |
| 85 | 3300001989 | JGI24739J22299_10067103 | JGI24739J22299_100671031 | 257 |
| 86 | 3300003758 | Ga0055532_1000158 | Ga0055532_100015840 | 257 |
| 87 | 3300003760 | Ga0055527_1000151 | Ga0055527_10001513 | 257 |
| 88 | 3300003761 | Ga0055535_1000269 | Ga0055535_10002697 | 257 |
| 89 | 3300003762 | Ga0055542_1000282 | Ga0055542_100028241 | 257 |
| 90 | 3300003763 | Ga0055529_1000320 | Ga0055529_100032039 | 257 |
| 91 | 3300003790 | Ga0055528_1021356 | Ga0055528_10213562 | 257 |
| 92 | 3300003856 | Ga0058692_1005128 | Ga0058692_10051283 | 257 |
| 93 | 3300009093 | Ga0105240_10005275 | Ga0105240_1000527515 | 257 |
| 94 | 3300025225 | Ga0209566_100338 | Ga0209566_10033816 | 257 |
| 95 | 3300025226 | Ga0209674_104932 | Ga0209674_1049321 | 257 |
| 96 | 3300025228 | Ga0209672_100028 | Ga0209672_100028197 | 257 |
| 97 | 3300025229 | Ga0209147_100117 | Ga0209147_1001179 | 257 |
| 98 | 3300025229 | Ga0209147_100216 | Ga0209147_1002168 | 257 |
| 99 | 3300025242 | Ga0209258_100112 | Ga0209258_10011251 | 257 |
| 100 | 3300025254 | Ga0209148_1000081 | Ga0209148_100008141 | 257 |
| 101 | 3300025272 | Ga0209455_1000050 | Ga0209455_1000050123 | 257 |
| 102 | 3300025273 | Ga0209673_1000038 | Ga0209673_100003860 | 257 |
| 103 | 3300025913 | Ga0207695_10001966 | Ga0207695_1000196617 | 257 |
| 104 | 3300025913 | Ga0207695_10405469 | Ga0207695_104054692 | 257 |
| 105 | 3300027312 | Ga0209371_1000090 | Ga0209371_1000090114 | 257 |
| 106 | 3300030500 | Ga0268256_1000115 | Ga0268256_100011561 | 257 |
| 107 | 3300039437 | Ga0436365_0259972 | Ga0436365_0259972_125_937 | 257 |
| 108 | 3300048921 | Ga0496118_0064832 | Ga0496118_0064832_1181_2089 | 257 |
| 109 | 3300021361 | Ga0213872_10001699 | Ga0213872_100016994 | 258 |
| 110 | 3300027907 | Ga0207428_10435339 | Ga0207428_104353391 | 258 |
| 111 | 3300039447 | Ga0436361_0337087 | Ga0436361_0337087_3379_4191 | 258 |
| 112 | 3300048088 | Ga0495602_0056564 | Ga0495602_0056564_474_1286 | 258 |
| 113 | 3300005367 | Ga0070667_100168882 | Ga0070667_1001688824 | 259 |
| 114 | 3300009177 | Ga0105248_10046617 | Ga0105248_100466173 | 259 |
| 115 | 3300011119 | Ga0105246_10419254 | Ga0105246_104192542 | 259 |
| 116 | 3300013306 | Ga0163162_10001279 | Ga0163162_100012798 | 259 |
| 117 | 3300013308 | Ga0157375_10007629 | Ga0157375_100076294 | 259 |
| 118 | 3300025941 | Ga0207711_10033968 | Ga0207711_100339682 | 259 |
| 119 | 3300025986 | Ga0207658_10143562 | Ga0207658_101435622 | 259 |
| 120 | 3300045051 | Ga0451576_0024364 | Ga0451576_0024364_4404_5219 | 259 |
| 121 | 3300046460 | Ga0495638_0019691 | Ga0495638_0019691_2411_3226 | 259 |
| 122 | 3300046471 | Ga0495650_0029175 | Ga0495650_0029175_282_1097 | 259 |
| 123 | 3300046492 | Ga0495585_0143917 | Ga0495585_0143917_83_898 | 259 |
| 124 | 3300046500 | Ga0495596_0083992 | Ga0495596_0083992_402_1217 | 259 |
| 125 | 3300046523 | Ga0495644_0027424 | Ga0495644_0027424_836_1651 | 259 |
| 126 | 3300046616 | Ga0495668_0166421 | Ga0495668_0166421_22_858 | 259 |
| 127 | 3300046660 | Ga0495625_0231045 | Ga0495625_0231045_13_828 | 259 |
| 128 | 3300046678 | Ga0495599_0053718 | Ga0495599_0053718_13_795 | 259 |
| 129 | 3300046689 | Ga0495613_0029819 | Ga0495613_0029819_971_1753 | 259 |
| 130 | 3300046691 | Ga0495670_0038332 | Ga0495670_0038332_1540_2355 | 259 |
| 131 | 3300046794 | Ga0495589_0004735 | Ga0495589_0004735_605_1420 | 259 |
| 132 | 3300048905 | Ga0496102_0030639 | Ga0496102_0030639_1462_2277 | 259 |
| 133 | 3300048906 | Ga0496103_0011242 | Ga0496103_0011242_450_1265 | 259 |
| 134 | 3300048906 | Ga0496103_0377427 | Ga0496103_0377427_20_802 | 259 |
| 135 | 3300048907 | Ga0496104_0115916 | Ga0496104_0115916_1193_2008 | 259 |
| 136 | 3300048909 | Ga0496106_0069634 | Ga0496106_0069634_596_1411 | 259 |
| 137 | 3300048910 | Ga0496107_0013109 | Ga0496107_0013109_3605_4420 | 259 |
| 138 | 3300048922 | Ga0496119_0179611 | Ga0496119_0179611_120_935 | 259 |
| 139 | 3300048928 | Ga0496125_0130818 | Ga0496125_0130818_919_1755 | 259 |
| 140 | 3300047444 | Ga0495675_0090124 | Ga0495675_0090124_1066_1851 | 260 |
| 141 | 3300046471 | Ga0495650_0020598 | Ga0495650_0020598_498_1385 | 261 |
| 142 | 3300014326 | Ga0157380_10701381 | Ga0157380_107013811 | 262 |
| 143 | 3300046454 | Ga0495592_0002925 | Ga0495592_0002925_7757_8725 | 263 |
| 144 | 3300046458 | Ga0495591_007313 | Ga0495591_007313_541_1380 | 263 |
| 145 | 3300046459 | Ga0495629_0002636 | Ga0495629_0002636_8824_9792 | 263 |
| 146 | 3300046472 | Ga0495580_0040154 | Ga0495580_0040154_1887_2855 | 263 |
| 147 | 3300046500 | Ga0495596_0001350 | Ga0495596_0001350_8350_9189 | 263 |
| 148 | 3300046511 | Ga0495608_0006589 | Ga0495608_0006589_5270_6109 | 263 |
| 149 | 3300046514 | Ga0495618_0004205 | Ga0495618_0004205_6161_7000 | 263 |
| 150 | 3300046517 | Ga0495630_0009338 | Ga0495630_0009338_4076_5044 | 263 |
| 151 | 3300046524 | Ga0495648_0014937 | Ga0495648_0014937_2861_3829 | 263 |
| 152 | 3300046526 | Ga0495666_0011718 | Ga0495666_0011718_1972_2811 | 263 |
| 153 | 3300046531 | Ga0495665_0006625 | Ga0495665_0006625_4412_5380 | 263 |
| 154 | 3300046533 | Ga0495640_0002389 | Ga0495640_0002389_11006_11845 | 263 |
| 155 | 3300046535 | Ga0495586_0117494 | Ga0495586_0117494_124_963 | 263 |
| 156 | 3300046536 | Ga0495587_0017477 | Ga0495587_0017477_3153_3992 | 263 |
| 157 | 3300046642 | Ga0495634_0016770 | Ga0495634_0016770_3382_4350 | 263 |
| 158 | 3300046663 | Ga0495635_0014329 | Ga0495635_0014329_3686_4525 | 263 |
| 159 | 3300046665 | Ga0495661_0030024 | Ga0495661_0030024_2001_2969 | 263 |
| 160 | 3300046675 | Ga0495657_0179828 | Ga0495657_0179828_110_949 | 263 |
| 161 | 3300046678 | Ga0495599_0083242 | Ga0495599_0083242_1046_1885 | 263 |
| 162 | 3300046679 | Ga0495623_0005756 | Ga0495623_0005756_5119_6087 | 263 |
| 163 | 3300046680 | Ga0495646_0042708 | Ga0495646_0042708_1738_2577 | 263 |
| 164 | 3300046689 | Ga0495613_0009898 | Ga0495613_0009898_3062_4030 | 263 |
| 165 | 3300046692 | Ga0495671_0019964 | Ga0495671_0019964_918_1757 | 263 |
| 166 | 3300046794 | Ga0495589_0020228 | Ga0495589_0020228_592_1560 | 263 |
| 167 | 3300047319 | Ga0495674_0009120 | Ga0495674_0009120_7896_8735 | 263 |
| 168 | 3300047321 | Ga0495676_0015747 | Ga0495676_0015747_2113_2952 | 263 |
| 169 | 3300047323 | Ga0495683_0004782 | Ga0495683_0004782_4299_5138 | 263 |
| 170 | 3300047446 | Ga0495679_001087 | Ga0495679_001087_4773_5741 | 263 |
| 171 | 3300047469 | Ga0495673_0010950 | Ga0495673_0010950_3211_4179 | 263 |
| 172 | 3300047673 | Ga0495593_0001173 | Ga0495593_0001173_9760_10599 | 263 |
| 173 | 3300048088 | Ga0495602_0043431 | Ga0495602_0043431_190_1029 | 263 |
| 174 | 3300048089 | Ga0495614_0003519 | Ga0495614_0003519_1977_2945 | 263 |
| 175 | 3300048905 | Ga0496102_0059029 | Ga0496102_0059029_2201_3040 | 263 |
| 176 | 3300048906 | Ga0496103_0010223 | Ga0496103_0010223_2687_3526 | 263 |
| 177 | 3300048920 | Ga0496117_0013267 | Ga0496117_0013267_3282_4121 | 263 |
| 178 | 3300048921 | Ga0496118_0013992 | Ga0496118_0013992_2648_3487 | 263 |
| 179 | 3300048924 | Ga0496121_0001437 | Ga0496121_0001437_15469_16350 | 263 |
| 180 | 3300048929 | Ga0496126_0010004 | Ga0496126_0010004_2010_2891 | 263 |
| 181 | 3300049460 | Ga0495682_0015051 | Ga0495682_0015051_114_1082 | 263 |
| 182 | 3300060353 | Ga0501082_0064484 | Ga0501082_0064484_2336_3127 | 263 |
| 183 | 3300005327 | Ga0070658_10056599 | Ga0070658_100565992 | 264 |
| 184 | 3300005329 | Ga0070683_100035538 | Ga0070683_1000355385 | 264 |
| 185 | 3300005339 | Ga0070660_100068769 | Ga0070660_1000687691 | 264 |
| 186 | 3300005344 | Ga0070661_100001117 | Ga0070661_10000111710 | 264 |
| 187 | 3300005366 | Ga0070659_100014990 | Ga0070659_1000149906 | 264 |
| 188 | 3300005435 | Ga0070714_100001578 | Ga0070714_10000157812 | 264 |
| 189 | 3300005436 | Ga0070713_100018003 | Ga0070713_1000180035 | 264 |
| 190 | 3300005458 | Ga0070681_10015999 | Ga0070681_100159999 | 264 |
| 191 | 3300005535 | Ga0070684_100006951 | Ga0070684_1000069512 | 264 |
| 192 | 3300005539 | Ga0068853_100094127 | Ga0068853_1000941273 | 264 |
| 193 | 3300005563 | Ga0068855_100003881 | Ga0068855_10000388113 | 264 |
| 194 | 3300005564 | Ga0070664_100001653 | Ga0070664_10000165311 | 264 |
| 195 | 3300005577 | Ga0068857_100001618 | Ga0068857_1000016184 | 264 |
| 196 | 3300005578 | Ga0068854_100014974 | Ga0068854_1000149745 | 264 |
| 197 | 3300005614 | Ga0068856_100010244 | Ga0068856_10001024410 | 264 |
| 198 | 3300005616 | Ga0068852_100000773 | Ga0068852_10000077311 | 264 |
| 199 | 3300005834 | Ga0068851_10035817 | Ga0068851_100358172 | 264 |
| 200 | 3300009093 | Ga0105240_10006454 | Ga0105240_100064549 | 264 |
| 201 | 3300009174 | Ga0105241_10081879 | Ga0105241_100818793 | 264 |
| 202 | 3300009177 | Ga0105248_10767162 | Ga0105248_107671621 | 264 |
| 203 | 3300009551 | Ga0105238_10002047 | Ga0105238_1000204711 | 264 |
| 204 | 3300013100 | Ga0157373_10015002 | Ga0157373_100150022 | 264 |
| 205 | 3300013102 | Ga0157371_10096481 | Ga0157371_100964812 | 264 |
| 206 | 3300013104 | Ga0157370_10008140 | Ga0157370_100081405 | 264 |
| 207 | 3300013105 | Ga0157369_10002386 | Ga0157369_1000238618 | 264 |
| 208 | 3300013307 | Ga0157372_10004036 | Ga0157372_1000403610 | 264 |
| 209 | 3300014968 | Ga0157379_10044522 | Ga0157379_100445223 | 264 |
| 210 | 3300025909 | Ga0207705_10227246 | Ga0207705_102272462 | 264 |
| 211 | 3300025912 | Ga0207707_10007126 | Ga0207707_1000712610 | 264 |
| 212 | 3300025913 | Ga0207695_10038953 | Ga0207695_100389534 | 264 |
| 213 | 3300025919 | Ga0207657_10077831 | Ga0207657_100778314 | 264 |
| 214 | 3300025920 | Ga0207649_10009313 | Ga0207649_100093134 | 264 |
| 215 | 3300025921 | Ga0207652_10057306 | Ga0207652_100573062 | 264 |
| 216 | 3300025924 | Ga0207694_10001672 | Ga0207694_1000167210 | 264 |
| 217 | 3300025928 | Ga0207700_10049239 | Ga0207700_100492393 | 264 |
| 218 | 3300025932 | Ga0207690_10006714 | Ga0207690_100067146 | 264 |
| 219 | 3300025944 | Ga0207661_10096785 | Ga0207661_100967853 | 264 |
| 220 | 3300025945 | Ga0207679_10016803 | Ga0207679_100168034 | 264 |
| 221 | 3300025949 | Ga0207667_10012214 | Ga0207667_100122145 | 264 |
| 222 | 3300025981 | Ga0207640_10016554 | Ga0207640_100165545 | 264 |
| 223 | 3300026041 | Ga0207639_10018478 | Ga0207639_100184782 | 264 |
| 224 | 3300026078 | Ga0207702_10002061 | Ga0207702_100020618 | 264 |
| 225 | 3300026116 | Ga0207674_10001568 | Ga0207674_1000156813 | 264 |
| 226 | 3300026142 | Ga0207698_10018139 | Ga0207698_100181394 | 264 |
| 227 | iso_pu_bacteria | 2643221660 | 2644340769 | 264 |
| 228 | 3300005535 | Ga0070684_100233292 | Ga0070684_1002332921 | 265 |
| 229 | 3300005617 | Ga0068859_100254400 | Ga0068859_1002544002 | 265 |
| 230 | 3300005618 | Ga0068864_100028260 | Ga0068864_1000282604 | 265 |
| 231 | 3300006931 | Ga0097620_100254410 | Ga0097620_1002544102 | 265 |
| 232 | 3300009177 | Ga0105248_10231403 | Ga0105248_102314032 | 265 |
| 233 | 3300009553 | Ga0105249_10549917 | Ga0105249_105499172 | 265 |
| 234 | 3300013104 | Ga0157370_10014058 | Ga0157370_100140583 | 265 |
| 235 | 3300013307 | Ga0157372_10138558 | Ga0157372_101385582 | 265 |
| 236 | 3300025921 | Ga0207652_10229050 | Ga0207652_102290502 | 265 |
| 237 | 3300025986 | Ga0207658_10195472 | Ga0207658_101954722 | 265 |
| 238 | 3300026088 | Ga0207641_10232727 | Ga0207641_102327272 | 265 |
| 239 | 3300026095 | Ga0207676_10195783 | Ga0207676_101957832 | 265 |
| 240 | iso_pu_bacteria | 2513237082 | 2513554213 | 265 |
| 241 | iso_pu_bacteria | 2513237083 | 2513562491 | 265 |
| 242 | iso_pu_bacteria | 2513237166 | 2514046302 | 265 |
| 243 | iso_pu_bacteria | 2599185239 | 2599737044 | 265 |
| 244 | iso_pu_bacteria | 2599185240 | 2599742845 | 265 |
| 245 | iso_pu_bacteria | 2599185355 | 2600204963 | 265 |
| 246 | iso_pu_bacteria | 2675903129 | 2676741952 | 265 |
| 247 | iso_pu_bacteria | 2711768613 | 2713478244 | 265 |
| 248 | iso_pu_bacteria | 2744054900 | 2746092212 | 265 |
| 249 | iso_pu_bacteria | 2744054901 | 2746095253 | 265 |
| 250 | iso_pu_bacteria | 2751185846 | 2753568842 | 265 |
| 251 | iso_pu_bacteria | 2791355137 | 2792833031 | 265 |
| 252 | iso_pu_bacteria | 2818991452 | 2819632546 | 265 |
| 253 | iso_pu_bacteria | 2842324504 | 2842331315 | 265 |
| 254 | iso_pu_bacteria | 2842348783 | 2842355654 | 265 |
| 255 | iso_pu_bacteria | 2842454564 | 2842462042 | 265 |
| 256 | iso_pu_bacteria | 2863421361 | 2863421586 | 265 |
| 257 | iso_pu_bacteria | 2870068957 | 2870068987 | 265 |
| 258 | iso_pu_bacteria | 2900634093 | 2900636224 | 265 |
| 259 | iso_pu_bacteria | 2904564687 | 2904565769 | 265 |
| 260 | iso_pu_bacteria | 2904571731 | 2904572812 | 265 |
| 261 | iso_pu_bacteria | 2919527303 | 2919529933 | 265 |
| 262 | iso_pu_bacteria | 2921643360 | 2921643691 | 265 |
| 263 | iso_pu_bacteria | 2928163908 | 2928164125 | 265 |
| 264 | iso_pu_bacteria | 2928170801 | 2928173344 | 265 |
| 265 | iso_pu_bacteria | 2928536128 | 2928538664 | 265 |
| 266 | iso_pu_bacteria | 2981990288 | 2981994273 | 265 |
| 267 | iso_pu_bacteria | 641736154 | 642415354 | 265 |
| 268 | iso_pu_bacteria | 642555112 | 642594273 | 265 |
| 269 | iso_pu_bacteria | 642555113 | 642620316 | 265 |
| 270 | iso_pu_bacteria | 8003955200 | 8003959699 | 265 |
| 271 | iso_pu_bacteria | 8018845410 | 8018849004 | 265 |
| 272 | iso_pu_bacteria | 8020938398 | 8020944824 | 265 |
| 273 | iso_pu_bacteria | 8020945358 | 8020949697 | 265 |
| 274 | iso_pu_bacteria | 8020953355 | 8020959907 | 265 |
| 275 | iso_pu_bacteria | 8021120328 | 8021126709 | 265 |
| 276 | iso_pu_bacteria | 8039098773 | 8039099223 | 265 |
| 277 | iso_pu_bacteria | 2501025502 | 2501081751 | 266 |
| 278 | iso_pu_bacteria | 2510917013 | 2511085687 | 266 |
| 279 | iso_pu_bacteria | 2510917014 | 2511095816 | 266 |
| 280 | iso_pu_bacteria | 2510917015 | 2511103431 | 266 |
| 281 | iso_pu_bacteria | 2515154189 | 2516021514 | 266 |
| 282 | iso_pu_bacteria | 2808606384 | 2808971564 | 266 |
| 283 | iso_pu_bacteria | 2808606390 | 2809006393 | 266 |
| 284 | iso_pu_bacteria | 2808606391 | 2809013689 | 266 |
| 285 | iso_pu_bacteria | 2883087390 | 2883095194 | 266 |
| 286 | iso_pu_bacteria | 2510065045 | 2510249989 | 267 |
| 287 | iso_pu_bacteria | 2515154122 | 2515679405 | 267 |
| 288 | iso_pu_bacteria | 2718217991 | 2719639147 | 267 |
| 289 | iso_pu_bacteria | 2885270888 | 2885277284 | 267 |
| 290 | iso_pu_bacteria | 2902682994 | 2902683423 | 267 |
| 291 | 3300005290 | Ga0065712_10142885 | Ga0065712_101428852 | 268 |
| 292 | 3300005549 | Ga0070704_100434554 | Ga0070704_1004345541 | 268 |
| 293 | 3300005617 | Ga0068859_100254957 | Ga0068859_1002549572 | 268 |
| 294 | 3300006931 | Ga0097620_100254944 | Ga0097620_1002549442 | 268 |
| 295 | 3300014326 | Ga0157380_10053918 | Ga0157380_100539182 | 268 |
| 296 | 3300021361 | Ga0213872_10000006 | Ga0213872_10000006227 | 268 |
| 297 | 3300025908 | Ga0207643_10112233 | Ga0207643_101122332 | 268 |
| 298 | 3300025942 | Ga0207689_10108087 | Ga0207689_101080873 | 268 |
| 299 | 3300028794 | Ga0307515_10000398 | Ga0307515_1000039891 | 268 |
| 300 | 3300031250 | Ga0265331_10003815 | Ga0265331_100038156 | 268 |
| 301 | 3300031251 | Ga0265327_10000328 | Ga0265327_100003287 | 268 |
| 302 | 3300039447 | Ga0436361_0215868 | Ga0436361_0215868_3626_4447 | 268 |
| 303 | 3300039447 | Ga0436361_0649532 | Ga0436361_0649532_1316_2128 | 268 |
| 304 | 3300042876 | Ga0451577_0003537 | Ga0451577_0003537_5982_6791 | 268 |
| 305 | 3300044901 | Ga0466960_0223848 | Ga0466960_0223848_137_943 | 268 |
| 306 | 3300045051 | Ga0451576_0001177 | Ga0451576_0001177_40062_40868 | 268 |
| 307 | 3300045051 | Ga0451576_0353942 | Ga0451576_0353942_16_825 | 268 |
| 308 | 3300046543 | Ga0495645_0010907 | Ga0495645_0010907_1756_2565 | 268 |
| 309 | 3300046678 | Ga0495599_0247203 | Ga0495599_0247203_183_992 | 268 |
| 310 | 3300046809 | Ga0495600_0117325 | Ga0495600_0117325_856_1665 | 268 |
| 311 | 3300048909 | Ga0496106_0003457 | Ga0496106_0003457_10131_10943 | 268 |
| 312 | 3300048924 | Ga0496121_0006600 | Ga0496121_0006600_2996_3808 | 268 |
| 313 | 3300049743 | Ga0501081_0005668 | Ga0501081_0005668_2189_3010 | 268 |
| 314 | 3300003323 | rootH1_10294715 | rootH1_102947153 | 269 |
| 315 | 3300009551 | Ga0105238_10055412 | Ga0105238_100554125 | 269 |
| 316 | 3300013105 | Ga0157369_10089712 | Ga0157369_100897122 | 269 |
| 317 | 3300013308 | Ga0157375_10843834 | Ga0157375_108438342 | 269 |
| 318 | 3300025206 | Ga0209435_107255 | Ga0209435_1072552 | 269 |
| 319 | 3300025295 | Ga0209564_1014519 | Ga0209564_10145193 | 269 |
| 320 | 3300028800 | Ga0265338_10000251 | Ga0265338_1000025139 | 269 |
| 321 | 3300046455 | Ga0495603_0000456 | Ga0495603_0000456_1139_1951 | 269 |
| 322 | 3300046457 | Ga0495590_0079707 | Ga0495590_0079707_213_1025 | 269 |
| 323 | 3300046457 | Ga0495590_0094266 | Ga0495590_0094266_181_1047 | 269 |
| 324 | 3300046458 | Ga0495591_032160 | Ga0495591_032160_376_1188 | 269 |
| 325 | 3300046459 | Ga0495629_0000184 | Ga0495629_0000184_25458_26270 | 269 |
| 326 | 3300046459 | Ga0495629_0004848 | Ga0495629_0004848_3657_4469 | 269 |
| 327 | 3300046463 | Ga0495653_0000402 | Ga0495653_0000402_1985_2797 | 269 |
| 328 | 3300046471 | Ga0495650_0000155 | Ga0495650_0000155_105131_105943 | 269 |
| 329 | 3300046472 | Ga0495580_0025967 | Ga0495580_0025967_3396_4208 | 269 |
| 330 | 3300046473 | Ga0495582_0003942 | Ga0495582_0003942_5039_5851 | 269 |
| 331 | 3300046474 | Ga0495605_0021288 | Ga0495605_0021288_2118_2984 | 269 |
| 332 | 3300046477 | Ga0495664_0133377 | Ga0495664_0133377_403_1215 | 269 |
| 333 | 3300046507 | Ga0495606_0014382 | Ga0495606_0014382_3018_3830 | 269 |
| 334 | 3300046507 | Ga0495606_0173896 | Ga0495606_0173896_323_1135 | 269 |
| 335 | 3300046507 | Ga0495606_0180729 | Ga0495606_0180729_261_1157 | 269 |
| 336 | 3300046511 | Ga0495608_0278773 | Ga0495608_0278773_102_914 | 269 |
| 337 | 3300046515 | Ga0495620_0016431 | Ga0495620_0016431_1618_2514 | 269 |
| 338 | 3300046516 | Ga0495628_0011566 | Ga0495628_0011566_3003_3815 | 269 |
| 339 | 3300046517 | Ga0495630_0009093 | Ga0495630_0009093_3078_3890 | 269 |
| 340 | 3300046528 | Ga0495642_0001828 | Ga0495642_0001828_6096_6908 | 269 |
| 341 | 3300046529 | Ga0495652_0012413 | Ga0495652_0012413_1510_2322 | 269 |
| 342 | 3300046531 | Ga0495665_0000096 | Ga0495665_0000096_15818_16630 | 269 |
| 343 | 3300046531 | Ga0495665_0046254 | Ga0495665_0046254_650_1546 | 269 |
| 344 | 3300046543 | Ga0495645_0000102 | Ga0495645_0000102_51306_52118 | 269 |
| 345 | 3300046543 | Ga0495645_0036931 | Ga0495645_0036931_71_883 | 269 |
| 346 | 3300046642 | Ga0495634_0042500 | Ga0495634_0042500_2085_2894 | 269 |
| 347 | 3300046674 | Ga0495588_0039512 | Ga0495588_0039512_618_1430 | 269 |
| 348 | 3300046679 | Ga0495623_0004393 | Ga0495623_0004393_2752_3564 | 269 |
| 349 | 3300046680 | Ga0495646_0023644 | Ga0495646_0023644_2077_2889 | 269 |
| 350 | 3300046690 | Ga0495624_0004770 | Ga0495624_0004770_3507_4319 | 269 |
| 351 | 3300046694 | Ga0495649_0003577 | Ga0495649_0003577_1943_2755 | 269 |
| 352 | 3300046694 | Ga0495649_0081965 | Ga0495649_0081965_762_1658 | 269 |
| 353 | 3300046794 | Ga0495589_0033080 | Ga0495589_0033080_1330_2142 | 269 |
| 354 | 3300046794 | Ga0495589_0058620 | Ga0495589_0058620_31_843 | 269 |
| 355 | 3300046809 | Ga0495600_0152748 | Ga0495600_0152748_29_841 | 269 |
| 356 | 3300047315 | Ga0495581_0000479 | Ga0495581_0000479_6990_7802 | 269 |
| 357 | 3300047317 | Ga0495604_0000954 | Ga0495604_0000954_20867_21679 | 269 |
| 358 | 3300047319 | Ga0495674_0076699 | Ga0495674_0076699_1008_1874 | 269 |
| 359 | 3300047322 | Ga0495680_0050863 | Ga0495680_0050863_1414_2226 | 269 |
| 360 | 3300047323 | Ga0495683_0004330 | Ga0495683_0004330_3063_3959 | 269 |
| 361 | 3300047323 | Ga0495683_0011517 | Ga0495683_0011517_1089_1901 | 269 |
| 362 | 3300047443 | Ga0495687_011870 | Ga0495687_011870_1866_2678 | 269 |
| 363 | 3300047446 | Ga0495679_036242 | Ga0495679_036242_422_1234 | 269 |
| 364 | 3300048088 | Ga0495602_0006713 | Ga0495602_0006713_10897_11709 | 269 |
| 365 | 3300048089 | Ga0495614_0039057 | Ga0495614_0039057_198_1010 | 269 |
| 366 | 3300048903 | Ga0496100_0085191 | Ga0496100_0085191_1171_1983 | 269 |
| 367 | 3300048904 | Ga0496101_0111864 | Ga0496101_0111864_1141_1953 | 269 |
| 368 | 3300048905 | Ga0496102_0029234 | Ga0496102_0029234_3874_4770 | 269 |
| 369 | 3300048906 | Ga0496103_0055676 | Ga0496103_0055676_684_1580 | 269 |
| 370 | 3300048907 | Ga0496104_0090431 | Ga0496104_0090431_812_1678 | 269 |
| 371 | 3300048907 | Ga0496104_0125597 | Ga0496104_0125597_340_1152 | 269 |
| 372 | 3300048908 | Ga0496105_0091212 | Ga0496105_0091212_788_1654 | 269 |
| 373 | 3300048908 | Ga0496105_0114880 | Ga0496105_0114880_997_1809 | 269 |
| 374 | 3300048909 | Ga0496106_0168393 | Ga0496106_0168393_449_1315 | 269 |
| 375 | 3300048910 | Ga0496107_0110354 | Ga0496107_0110354_825_1721 | 269 |
| 376 | 3300048911 | Ga0496108_0326529 | Ga0496108_0326529_193_1059 | 269 |
| 377 | 3300048912 | Ga0496109_0366259 | Ga0496109_0366259_270_1166 | 269 |
| 378 | 3300048913 | Ga0496110_0084022 | Ga0496110_0084022_493_1389 | 269 |
| 379 | 3300048913 | Ga0496110_0142488 | Ga0496110_0142488_1225_2037 | 269 |
| 380 | 3300048913 | Ga0496110_0395594 | Ga0496110_0395594_104_916 | 269 |
| 381 | 3300048914 | Ga0496111_0202213 | Ga0496111_0202213_120_1016 | 269 |
| 382 | 3300048915 | Ga0496112_0277372 | Ga0496112_0277372_342_1238 | 269 |
| 383 | 3300048916 | Ga0496113_0065733 | Ga0496113_0065733_323_1219 | 269 |
| 384 | 3300048917 | Ga0496114_0001973 | Ga0496114_0001973_2772_3584 | 269 |
| 385 | 3300048918 | Ga0496115_0181076 | Ga0496115_0181076_367_1233 | 269 |
| 386 | 3300048920 | Ga0496117_0054205 | Ga0496117_0054205_1527_2423 | 269 |
| 387 | 3300048921 | Ga0496118_0117381 | Ga0496118_0117381_420_1316 | 269 |
| 388 | 3300048922 | Ga0496119_0133091 | Ga0496119_0133091_328_1224 | 269 |
| 389 | 3300048925 | Ga0496122_0104313 | Ga0496122_0104313_918_1814 | 269 |
| 390 | 3300048929 | Ga0496126_0150610 | Ga0496126_0150610_635_1447 | 269 |
| 391 | iso_pu_bacteria | 2512047030 | 2512347537 | 269 |
| 392 | iso_pu_bacteria | 2856287931 | 2856291980 | 269 |
| 393 | iso_pu_bacteria | 2857357740 | 2857360531 | 269 |
| 394 | 3300005328 | Ga0070676_10009755 | Ga0070676_100097554 | 270 |
| 395 | 3300005330 | Ga0070690_100020928 | Ga0070690_1000209281 | 270 |
| 396 | 3300005330 | Ga0070690_100022261 | Ga0070690_1000222614 | 270 |
| 397 | 3300005333 | Ga0070677_10008720 | Ga0070677_100087202 | 270 |
| 398 | 3300005334 | Ga0068869_100005703 | Ga0068869_1000057038 | 270 |
| 399 | 3300005335 | Ga0070666_10009873 | Ga0070666_100098733 | 270 |
| 400 | 3300005335 | Ga0070666_10018615 | Ga0070666_100186152 | 270 |
| 401 | 3300005338 | Ga0068868_100080665 | Ga0068868_1000806652 | 270 |
| 402 | 3300005339 | Ga0070660_100561983 | Ga0070660_1005619831 | 270 |
| 403 | 3300005340 | Ga0070689_100079347 | Ga0070689_1000793473 | 270 |
| 404 | 3300005343 | Ga0070687_100006238 | Ga0070687_1000062384 | 270 |
| 405 | 3300005343 | Ga0070687_100076210 | Ga0070687_1000762102 | 270 |
| 406 | 3300005347 | Ga0070668_100014171 | Ga0070668_1000141713 | 270 |
| 407 | 3300005347 | Ga0070668_100041014 | Ga0070668_1000410142 | 270 |
| 408 | 3300005353 | Ga0070669_100000933 | Ga0070669_10000093314 | 270 |
| 409 | 3300005353 | Ga0070669_100012526 | Ga0070669_1000125262 | 270 |
| 410 | 3300005354 | Ga0070675_100021566 | Ga0070675_1000215666 | 270 |
| 411 | 3300005355 | Ga0070671_100127083 | Ga0070671_1001270832 | 270 |
| 412 | 3300005356 | Ga0070674_100004162 | Ga0070674_1000041624 | 270 |
| 413 | 3300005356 | Ga0070674_100006354 | Ga0070674_1000063542 | 270 |
| 414 | 3300005356 | Ga0070674_100134052 | Ga0070674_1001340522 | 270 |
| 415 | 3300005364 | Ga0070673_100184820 | Ga0070673_1001848202 | 270 |
| 416 | 3300005367 | Ga0070667_100004808 | Ga0070667_1000048082 | 270 |
| 417 | 3300005367 | Ga0070667_100005256 | Ga0070667_1000052562 | 270 |
| 418 | 3300005441 | Ga0070700_100060289 | Ga0070700_1000602892 | 270 |
| 419 | 3300005456 | Ga0070678_100047942 | Ga0070678_1000479423 | 270 |
| 420 | 3300005456 | Ga0070678_100063579 | Ga0070678_1000635791 | 270 |
| 421 | 3300005457 | Ga0070662_100005485 | Ga0070662_1000054856 | 270 |
| 422 | 3300005457 | Ga0070662_100039264 | Ga0070662_1000392644 | 270 |
| 423 | 3300005457 | Ga0070662_100103287 | Ga0070662_1001032872 | 270 |
| 424 | 3300005459 | Ga0068867_100033237 | Ga0068867_1000332372 | 270 |
| 425 | 3300005459 | Ga0068867_100041953 | Ga0068867_1000419533 | 270 |
| 426 | 3300005539 | Ga0068853_100075441 | Ga0068853_1000754412 | 270 |
| 427 | 3300005543 | Ga0070672_100016946 | Ga0070672_1000169466 | 270 |
| 428 | 3300005543 | Ga0070672_100020624 | Ga0070672_1000206242 | 270 |
| 429 | 3300005564 | Ga0070664_100060253 | Ga0070664_1000602533 | 270 |
| 430 | 3300005617 | Ga0068859_100010559 | Ga0068859_1000105595 | 270 |
| 431 | 3300005617 | Ga0068859_100039722 | Ga0068859_1000397223 | 270 |
| 432 | 3300005618 | Ga0068864_100084098 | Ga0068864_1000840983 | 270 |
| 433 | 3300005618 | Ga0068864_100110833 | Ga0068864_1001108333 | 270 |
| 434 | 3300005718 | Ga0068866_10005722 | Ga0068866_100057223 | 270 |
| 435 | 3300005718 | Ga0068866_10022044 | Ga0068866_100220444 | 270 |
| 436 | 3300005719 | Ga0068861_100001379 | Ga0068861_10000137910 | 270 |
| 437 | 3300005719 | Ga0068861_100021917 | Ga0068861_1000219175 | 270 |
| 438 | 3300005841 | Ga0068863_100003342 | Ga0068863_10000334214 | 270 |
| 439 | 3300005841 | Ga0068863_100014771 | Ga0068863_1000147718 | 270 |
| 440 | 3300005842 | Ga0068858_100001135 | Ga0068858_10000113514 | 270 |
| 441 | 3300005842 | Ga0068858_100003538 | Ga0068858_10000353814 | 270 |
| 442 | 3300005843 | Ga0068860_100006027 | Ga0068860_1000060275 | 270 |
| 443 | 3300005843 | Ga0068860_100007280 | Ga0068860_1000072803 | 270 |
| 444 | 3300005844 | Ga0068862_100036016 | Ga0068862_1000360164 | 270 |
| 445 | 3300005844 | Ga0068862_100042288 | Ga0068862_1000422883 | 270 |
| 446 | 3300006358 | Ga0068871_100311410 | Ga0068871_1003114102 | 270 |
| 447 | 3300006881 | Ga0068865_100000981 | Ga0068865_10000098117 | 270 |
| 448 | 3300006881 | Ga0068865_100016791 | Ga0068865_1000167913 | 270 |
| 449 | 3300006931 | Ga0097620_100010559 | Ga0097620_1000105595 | 270 |
| 450 | 3300006931 | Ga0097620_100039722 | Ga0097620_1000397223 | 270 |
| 451 | 3300007076 | Ga0075435_100277002 | Ga0075435_1002770022 | 270 |
| 452 | 3300009094 | Ga0111539_10112024 | Ga0111539_101120243 | 270 |
| 453 | 3300009094 | Ga0111539_10416939 | Ga0111539_104169392 | 270 |
| 454 | 3300009098 | Ga0105245_10202609 | Ga0105245_102026092 | 270 |
| 455 | 3300009148 | Ga0105243_10002261 | Ga0105243_1000226117 | 270 |
| 456 | 3300009148 | Ga0105243_10014689 | Ga0105243_100146896 | 270 |
| 457 | 3300009148 | Ga0105243_10417778 | Ga0105243_104177781 | 270 |
| 458 | 3300009177 | Ga0105248_10004719 | Ga0105248_100047192 | 270 |
| 459 | 3300009177 | Ga0105248_10038950 | Ga0105248_100389503 | 270 |
| 460 | 3300009553 | Ga0105249_10019510 | Ga0105249_100195101 | 270 |
| 461 | 3300009553 | Ga0105249_10029450 | Ga0105249_100294502 | 270 |
| 462 | 3300013297 | Ga0157378_10167594 | Ga0157378_101675941 | 270 |
| 463 | 3300013306 | Ga0163162_10006993 | Ga0163162_100069936 | 270 |
| 464 | 3300013306 | Ga0163162_10018074 | Ga0163162_100180744 | 270 |
| 465 | 3300013306 | Ga0163162_10032370 | Ga0163162_100323704 | 270 |
| 466 | 3300013307 | Ga0157372_10182791 | Ga0157372_101827912 | 270 |
| 467 | 3300013308 | Ga0157375_10004351 | Ga0157375_1000435111 | 270 |
| 468 | 3300013308 | Ga0157375_10012298 | Ga0157375_100122983 | 270 |
| 469 | 3300014326 | Ga0157380_10010189 | Ga0157380_100101894 | 270 |
| 470 | 3300014326 | Ga0157380_10035252 | Ga0157380_100352522 | 270 |
| 471 | 3300014968 | Ga0157379_10011787 | Ga0157379_100117873 | 270 |
| 472 | 3300014968 | Ga0157379_10032167 | Ga0157379_100321672 | 270 |
| 473 | 3300017792 | Ga0163161_10007501 | Ga0163161_100075017 | 270 |
| 474 | 3300017792 | Ga0163161_10023841 | Ga0163161_100238414 | 270 |
| 475 | 3300025303 | Ga0209051_1009868 | Ga0209051_10098682 | 270 |
| 476 | 3300025315 | Ga0207697_10006014 | Ga0207697_100060143 | 270 |
| 477 | 3300025315 | Ga0207697_10053903 | Ga0207697_100539032 | 270 |
| 478 | 3300025893 | Ga0207682_10048774 | Ga0207682_100487741 | 270 |
| 479 | 3300025901 | Ga0207688_10024894 | Ga0207688_100248941 | 270 |
| 480 | 3300025903 | Ga0207680_10002693 | Ga0207680_100026935 | 270 |
| 481 | 3300025907 | Ga0207645_10001805 | Ga0207645_1000180518 | 270 |
| 482 | 3300025907 | Ga0207645_10011458 | Ga0207645_100114583 | 270 |
| 483 | 3300025918 | Ga0207662_10011430 | Ga0207662_100114304 | 270 |
| 484 | 3300025923 | Ga0207681_10000565 | Ga0207681_100005659 | 270 |
| 485 | 3300025926 | Ga0207659_10020679 | Ga0207659_100206792 | 270 |
| 486 | 3300025926 | Ga0207659_10046395 | Ga0207659_100463953 | 270 |
| 487 | 3300025926 | Ga0207659_10087034 | Ga0207659_100870342 | 270 |
| 488 | 3300025931 | Ga0207644_10061094 | Ga0207644_100610942 | 270 |
| 489 | 3300025933 | Ga0207706_10003299 | Ga0207706_1000329912 | 270 |
| 490 | 3300025933 | Ga0207706_10035409 | Ga0207706_100354094 | 270 |
| 491 | 3300025933 | Ga0207706_10148467 | Ga0207706_101484672 | 270 |
| 492 | 3300025934 | Ga0207686_10024667 | Ga0207686_100246673 | 270 |
| 493 | 3300025935 | Ga0207709_10017159 | Ga0207709_100171594 | 270 |
| 494 | 3300025935 | Ga0207709_10036867 | Ga0207709_100368672 | 270 |
| 495 | 3300025937 | Ga0207669_10006024 | Ga0207669_100060244 | 270 |
| 496 | 3300025937 | Ga0207669_10006673 | Ga0207669_100066736 | 270 |
| 497 | 3300025937 | Ga0207669_10144220 | Ga0207669_101442202 | 270 |
| 498 | 3300025938 | Ga0207704_10006037 | Ga0207704_100060375 | 270 |
| 499 | 3300025938 | Ga0207704_10009093 | Ga0207704_100090932 | 270 |
| 500 | 3300025940 | Ga0207691_10025849 | Ga0207691_100258496 | 270 |
| 501 | 3300025940 | Ga0207691_10033796 | Ga0207691_100337963 | 270 |
| 502 | 3300025941 | Ga0207711_10007796 | Ga0207711_100077966 | 270 |
| 503 | 3300025941 | Ga0207711_10017149 | Ga0207711_100171492 | 270 |
| 504 | 3300025942 | Ga0207689_10010737 | Ga0207689_100107378 | 270 |
| 505 | 3300025961 | Ga0207712_10002887 | Ga0207712_1000288711 | 270 |
| 506 | 3300025961 | Ga0207712_10118324 | Ga0207712_101183242 | 270 |
| 507 | 3300025972 | Ga0207668_10045887 | Ga0207668_100458872 | 270 |
| 508 | 3300025986 | Ga0207658_10002076 | Ga0207658_1000207610 | 270 |
| 509 | 3300025986 | Ga0207658_10036586 | Ga0207658_100365863 | 270 |
| 510 | 3300026023 | Ga0207677_10043550 | Ga0207677_100435502 | 270 |
| 511 | 3300026035 | Ga0207703_10001247 | Ga0207703_100012477 | 270 |
| 512 | 3300026035 | Ga0207703_10004316 | Ga0207703_100043163 | 270 |
| 513 | 3300026067 | Ga0207678_10063281 | Ga0207678_100632811 | 270 |
| 514 | 3300026067 | Ga0207678_10217751 | Ga0207678_102177512 | 270 |
| 515 | 3300026075 | Ga0207708_10078925 | Ga0207708_100789252 | 270 |
| 516 | 3300026075 | Ga0207708_10087539 | Ga0207708_100875392 | 270 |
| 517 | 3300026088 | Ga0207641_10005861 | Ga0207641_100058619 | 270 |
| 518 | 3300026088 | Ga0207641_10010892 | Ga0207641_100108928 | 270 |
| 519 | 3300026089 | Ga0207648_10003583 | Ga0207648_100035832 | 270 |
| 520 | 3300026089 | Ga0207648_10019571 | Ga0207648_100195713 | 270 |
| 521 | 3300026095 | Ga0207676_10039966 | Ga0207676_100399662 | 270 |
| 522 | 3300026095 | Ga0207676_10061905 | Ga0207676_100619053 | 270 |
| 523 | 3300026118 | Ga0207675_100002267 | Ga0207675_1000022676 | 270 |
| 524 | 3300026118 | Ga0207675_100013432 | Ga0207675_1000134325 | 270 |
| 525 | 3300026121 | Ga0207683_10024095 | Ga0207683_100240953 | 270 |
| 526 | 3300026121 | Ga0207683_10049712 | Ga0207683_100497123 | 270 |
| 527 | 3300026142 | Ga0207698_10083743 | Ga0207698_100837433 | 270 |
| 528 | 3300028381 | Ga0268264_10003528 | Ga0268264_100035282 | 270 |
| 529 | 3300028381 | Ga0268264_10005666 | Ga0268264_100056663 | 270 |
| 530 | 3300028794 | Ga0307515_10037057 | Ga0307515_100370576 | 270 |
| 531 | 3300031456 | Ga0307513_10004318 | Ga0307513_1000431810 | 270 |
| 532 | 3300031507 | Ga0307509_10129547 | Ga0307509_101295472 | 270 |
| 533 | 3300037068 | Ga0373925_0311782 | Ga0373925_0311782_115_927 | 270 |
| 534 | 3300046517 | Ga0495630_0097561 | Ga0495630_0097561_129_941 | 270 |
| 535 | 3300048909 | Ga0496106_0000031 | Ga0496106_0000031_96533_97348 | 270 |
| 536 | 3300050493 | nmdc:mga0k408_97728_c1 | nmdc:mga0k408_97728_c1_654_1466 | 270 |
| 537 | 3300050513 | nmdc:mga0rr50_264453_c1 | nmdc:mga0rr50_264453_c1_270_1082 | 270 |
| 538 | 3300053117 | Ga0500593_059476 | Ga0500593_059476_508_1320 | 270 |
| 539 | iso_pu_bacteria | 2501025501 | 2501074563 | 270 |
| 540 | iso_pu_bacteria | 2501025504 | 2501408076 | 270 |
| 541 | 3300003794 | Ga0055531_10000647 | Ga0055531_1000064731 | 271 |
| 542 | 3300014969 | Ga0157376_10540693 | Ga0157376_105406932 | 271 |
| 543 | 3300025273 | Ga0209673_1032644 | Ga0209673_10326442 | 271 |
| 544 | 3300025303 | Ga0209051_1000591 | Ga0209051_100059134 | 271 |
| 545 | 3300025304 | Ga0209257_1000015 | Ga0209257_1000015873 | 271 |
| 546 | 3300025949 | Ga0207667_10398733 | Ga0207667_103987332 | 271 |
| 547 | 3300028794 | Ga0307515_10000062 | Ga0307515_10000062214 | 271 |
| 548 | 3300031251 | Ga0265327_10002520 | Ga0265327_100025206 | 271 |
| 549 | 3300042439 | Ga0439464_0029405 | Ga0439464_0029405_688_1503 | 271 |
| 550 | 3300005338 | Ga0068868_100145003 | Ga0068868_1001450033 | 272 |
| 551 | 3300009098 | Ga0105245_10076976 | Ga0105245_100769763 | 272 |
| 552 | 3300010375 | Ga0105239_10412881 | Ga0105239_104128812 | 272 |
| 553 | 3300025927 | Ga0207687_10011566 | Ga0207687_100115663 | 272 |
| 554 | 3300026023 | Ga0207677_10158808 | Ga0207677_101588082 | 272 |
| 555 | 3300031712 | Ga0265342_10050003 | Ga0265342_100500032 | 272 |
| 556 | 3300042876 | Ga0451577_0022587 | Ga0451577_0022587_3435_4253 | 272 |
| 557 | 3300044712 | Ga0453684_0746722 | Ga0453684_0746722_123_941 | 272 |
| 558 | 3300046463 | Ga0495653_0047405 | Ga0495653_0047405_271_1110 | 272 |
| 559 | 3300048907 | Ga0496104_0073066 | Ga0496104_0073066_462_1280 | 272 |
| 560 | 3300005331 | Ga0070670_100058879 | Ga0070670_1000588792 | 275 |
| 561 | 3300005344 | Ga0070661_100023174 | Ga0070661_1000231743 | 275 |
| 562 | 3300005455 | Ga0070663_100041256 | Ga0070663_1000412562 | 275 |
| 563 | 3300005834 | Ga0068851_10002990 | Ga0068851_100029905 | 275 |
| 564 | 3300006358 | Ga0068871_100057272 | Ga0068871_1000572722 | 275 |
| 565 | 3300013102 | Ga0157371_10113590 | Ga0157371_101135902 | 275 |
| 566 | 3300013296 | Ga0157374_10031714 | Ga0157374_100317142 | 275 |
| 567 | 3300025944 | Ga0207661_10160869 | Ga0207661_101608692 | 275 |
| 568 | 3300026023 | Ga0207677_10217222 | Ga0207677_102172221 | 275 |
| 569 | 3300037853 | Ga0436364_0460366 | Ga0436364_0460366_45_878 | 277 |
| 570 | 3300031548 | Ga0307408_100444037 | Ga0307408_1004440372 | 284 |
| 571 | 3300005331 | Ga0070670_100283969 | Ga0070670_1002839692 | 285 |
| 572 | 3300025925 | Ga0207650_10355312 | Ga0207650_103553122 | 285 |
| 573 | 2162886007 | SwRhRL2b_contig_140113 | SwRhRL2b_0212.00007990 | 287 |
| 574 | 3300005289 | Ga0065704_10000235 | Ga0065704_1000023527 | 287 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7raz-assembly1.cif.gz_D | small conductance mechanosensitive channel mscs | 0.8119 | 82 | 262 |
| 2xk0-assembly1.cif.gz_A | solution structure of the tudor domain from drosophila polycomblike (pcl) | 0.8035 | 120 | 160 |
| 4v42-assembly1.cif.gz_BD | crystal structure of the ribosome at 5.5 a resolution. | 0.7954 | 120 | 158 |
| 1kqs-assembly1.cif.gz_A | the haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis | 0.7819 | 120 | 158 |
| 3cc2-assembly1.cif.gz_A | the refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins | 0.7818 | 120 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0C0S1_129_178_2.30.30.60 | Mainly Beta;Roll;SH3 type barrels.; | 0.973 | 119 | 168 | 2.30.30.60 |
| af_A0A0P0WDR2_370_418_2.30.30.60 | Mainly Beta;Roll;SH3 type barrels.; | 0.966 | 119 | 167 | 2.30.30.60 |
| af_Q58543_201_249_2.30.30.60 | Mainly Beta;Roll;SH3 type barrels.; | 0.9547 | 119 | 167 | 2.30.30.60 |
| af_P0C0S1_129_178_2.30.30.60 | Mainly Beta;Roll;SH3 type barrels.; | 0.9545 | 119 | 168 | 2.30.30.60 |
| af_A0A0P0WDR2_370_418_2.30.30.60 | Mainly Beta;Roll;SH3 type barrels.; | 0.9473 | 119 | 167 | 2.30.30.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S2PAS9-F1-model_v4 | Mechanosensitive ion channel MscS C-terminal domain-containing protein | 0.9203 | 145 | 249 |
GO:0008381
GO:0016020 |
| AF-A0A838N6N7-F1-model_v4 | deleted | 0.9189 | 139 | 257 |
|
| AF-A0A7M3WTM0-F1-model_v4 | Mechanosensitive ion channel MscS C-terminal domain-containing protein | 0.9079 | 172 | 264 |
GO:0016020
|
| AF-A0A7S2PAS9-F1-model_v4 | Mechanosensitive ion channel MscS C-terminal domain-containing protein | 0.9039 | 145 | 249 |
GO:0008381
GO:0016020 |
| AF-A0A2D7Y2H1-F1-model_v4 | Small-conductance mechanosensitive channel | 0.9019 | 168 | 264 |
GO:0005886
GO:0008381 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar