F465287
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 574 | 251 | 574 | 180 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100081435|Ga0070706_1000814352 |
| Length | 187 |
| Sequence | MKVLTAWIERMNRRERVLSLVIGGLIFGLLNLFIWNWLLGAISVARGELATRQATRKEQAIFMKERPLWAKRDEWLQRHQPVLKNSGEAQTGLLDELKQVASKYDILIENPAIGSGETTLNHQAVFASIETKSPWPPLVHFLYDVQQPDSFIVFEAVNLMIDSSDPTMMRGKFKIARWFAPAQRKKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 9 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 101 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 195 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 205 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 206 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 235 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 244 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 245 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 246 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 247 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.27 |
| Rhizosphere | 93.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_693613 | 2162886006 | Bacteria | 1082 |
| 2 | CNXas_1000045 | 3300000545 | Bacteria | 24810 |
| 3 | JGI24740J21852_10018550 | 3300001979 | Unclassified | 2465 |
| 4 | JGI24743J22301_10002352 | 3300001991 | Unclassified | 2830 |
| 5 | JGI24750J21931_1012519 | 3300002070 | Bacteria | 1126 |
| 6 | JGI24035J26624_1002889 | 3300002126 | Bacteria | 1605 |
| 7 | JGI24035J26624_1003259 | 3300002126 | Unclassified | 1525 |
| 8 | JGI25406J46586_10000001 | 3300003203 | Bacteria | 251772 |
| 9 | JGI25406J46586_10000007 | 3300003203 | Bacteria | 112227 |
| 10 | JGI25405J52794_10000331 | 3300003911 | Bacteria | 6556 |
| 11 | JGI25405J52794_10001309 | 3300003911 | Unclassified | 4059 |
| 12 | Ga0065703_1019677 | 3300005272 | Bacteria | 2562 |
| 13 | Ga0065704_10029589 | 3300005289 | Unclassified | 1125 |
| 14 | Ga0065712_10000743 | 3300005290 | Bacteria | 8391 |
| 15 | Ga0065712_10003030 | 3300005290 | Bacteria | 7040 |
| 16 | Ga0065712_10007741 | 3300005290 | Unclassified | 2344 |
| 17 | Ga0065715_10000207 | 3300005293 | Bacteria | 34609 |
| 18 | Ga0065715_10000498 | 3300005293 | Bacteria | 12786 |
| 19 | Ga0065715_10001221 | 3300005293 | Bacteria | 10495 |
| 20 | Ga0065715_10008852 | 3300005293 | Bacteria | 3636 |
| 21 | Ga0065715_10010129 | 3300005293 | Unclassified | 2726 |
| 22 | Ga0065715_10010802 | 3300005293 | Bacteria | 5534 |
| 23 | Ga0065715_10143106 | 3300005293 | Bacteria | 1808 |
| 24 | Ga0065715_10307833 | 3300005293 | Unclassified | 1008 |
| 25 | Ga0065715_10435794 | 3300005293 | Unclassified | 842 |
| 26 | Ga0065707_10022448 | 3300005295 | Bacteria | 1627 |
| 27 | Ga0065707_10186400 | 3300005295 | Unclassified | 1386 |
| 28 | Ga0070658_10181132 | 3300005327 | Unclassified | 1773 |
| 29 | Ga0070676_10015061 | 3300005328 | Unclassified | 4260 |
| 30 | Ga0070676_10077478 | 3300005328 | Bacteria | 2009 |
| 31 | Ga0070676_10480469 | 3300005328 | Unclassified | 879 |
| 32 | Ga0070683_100001160 | 3300005329 | Bacteria | 19949 |
| 33 | Ga0070683_100221816 | 3300005329 | Bacteria | 1797 |
| 34 | Ga0070690_100002449 | 3300005330 | Bacteria | 9973 |
| 35 | Ga0070690_100032220 | 3300005330 | Bacteria | 3272 |
| 36 | Ga0070677_10030267 | 3300005333 | Bacteria | 2060 |
| 37 | Ga0068869_100010782 | 3300005334 | Bacteria | 5970 |
| 38 | Ga0068869_100234661 | 3300005334 | Unclassified | 1459 |
| 39 | Ga0070666_10045106 | 3300005335 | Unclassified | 2955 |
| 40 | Ga0070666_10202014 | 3300005335 | Unclassified | 1398 |
| 41 | Ga0070680_100028050 | 3300005336 | Bacteria | 4514 |
| 42 | Ga0068868_100020457 | 3300005338 | Bacteria | 4974 |
| 43 | Ga0068868_100156181 | 3300005338 | Bacteria | 1882 |
| 44 | Ga0068868_100191396 | 3300005338 | Bacteria | 1701 |
| 45 | Ga0070660_100109381 | 3300005339 | Unclassified | 2198 |
| 46 | Ga0070689_100002648 | 3300005340 | Bacteria | 11738 |
| 47 | Ga0070689_100014684 | 3300005340 | Bacteria | 5695 |
| 48 | Ga0070689_100062492 | 3300005340 | Bacteria | 2898 |
| 49 | Ga0070689_101412422 | 3300005340 | Unclassified | 629 |
| 50 | Ga0070687_100015846 | 3300005343 | Bacteria | 3418 |
| 51 | Ga0070692_10169313 | 3300005345 | Unclassified | 1258 |
| 52 | Ga0070668_100013399 | 3300005347 | Bacteria | 6118 |
| 53 | Ga0070668_100019031 | 3300005347 | Bacteria | 5161 |
| 54 | Ga0070669_100016524 | 3300005353 | Bacteria | 5267 |
| 55 | Ga0070669_100017297 | 3300005353 | Bacteria | 5143 |
| 56 | Ga0070675_100007020 | 3300005354 | Bacteria | 8658 |
| 57 | Ga0070675_100009289 | 3300005354 | Bacteria | 7644 |
| 58 | Ga0070675_100060920 | 3300005354 | Bacteria | 3115 |
| 59 | Ga0070675_100141747 | 3300005354 | Unclassified | 2055 |
| 60 | Ga0070675_100195249 | 3300005354 | Bacteria | 1755 |
| 61 | Ga0070675_100514029 | 3300005354 | Unclassified | 1080 |
| 62 | Ga0070671_100380069 | 3300005355 | Unclassified | 1207 |
| 63 | Ga0070671_100462105 | 3300005355 | Unclassified | 1089 |
| 64 | Ga0070671_100674109 | 3300005355 | Bacteria | 896 |
| 65 | Ga0070671_100989732 | 3300005355 | Unclassified | 737 |
| 66 | Ga0070674_100000780 | 3300005356 | Bacteria | 16336 |
| 67 | Ga0070673_100014849 | 3300005364 | Bacteria | 5447 |
| 68 | Ga0070673_100072780 | 3300005364 | Bacteria | 2765 |
| 69 | Ga0070688_100003944 | 3300005365 | Bacteria | 7694 |
| 70 | Ga0070659_100017051 | 3300005366 | Bacteria | 5459 |
| 71 | Ga0070659_100146967 | 3300005366 | Bacteria | 1921 |
| 72 | Ga0070667_100018582 | 3300005367 | Bacteria | 5765 |
| 73 | Ga0070667_100026680 | 3300005367 | Bacteria | 4805 |
| 74 | Ga0070709_10009751 | 3300005434 | Bacteria | 5304 |
| 75 | Ga0070709_10301815 | 3300005434 | Unclassified | 1170 |
| 76 | Ga0070709_10602243 | 3300005434 | Unclassified | 846 |
| 77 | Ga0070714_100030203 | 3300005435 | Bacteria | 4509 |
| 78 | Ga0070714_100138478 | 3300005435 | Bacteria | 2182 |
| 79 | Ga0070714_100237878 | 3300005435 | Bacteria | 1680 |
| 80 | Ga0070713_100004806 | 3300005436 | Bacteria | 9151 |
| 81 | Ga0070713_100034708 | 3300005436 | Bacteria | 4055 |
| 82 | Ga0070713_100159196 | 3300005436 | Bacteria | 2014 |
| 83 | Ga0070713_100220092 | 3300005436 | Unclassified | 1722 |
| 84 | Ga0070713_100628440 | 3300005436 | Unclassified | 1022 |
| 85 | Ga0070713_101132471 | 3300005436 | Bacteria | 757 |
| 86 | Ga0070710_10047448 | 3300005437 | Unclassified | 2395 |
| 87 | Ga0070710_10050623 | 3300005437 | Bacteria | 2329 |
| 88 | Ga0070710_10091139 | 3300005437 | Bacteria | 1798 |
| 89 | Ga0070711_100012285 | 3300005439 | Bacteria | 5343 |
| 90 | Ga0070711_100136342 | 3300005439 | Bacteria | 1835 |
| 91 | Ga0070705_100024037 | 3300005440 | Bacteria | 3282 |
| 92 | Ga0070705_100037428 | 3300005440 | Bacteria | 2737 |
| 93 | Ga0070705_100055659 | 3300005440 | Bacteria | 2326 |
| 94 | Ga0070700_100192845 | 3300005441 | Unclassified | 1426 |
| 95 | Ga0070708_100029555 | 3300005445 | Bacteria | 4727 |
| 96 | Ga0070708_100088506 | 3300005445 | Unclassified | 2816 |
| 97 | Ga0070708_100120626 | 3300005445 | Unclassified | 2419 |
| 98 | Ga0070708_100158335 | 3300005445 | Bacteria | 2109 |
| 99 | Ga0070708_100167112 | 3300005445 | Bacteria | 2052 |
| 100 | Ga0070708_100274466 | 3300005445 | Bacteria | 1586 |
| 101 | Ga0070708_100305570 | 3300005445 | Unclassified | 1498 |
| 102 | Ga0070708_100516602 | 3300005445 | Unclassified | 1127 |
| 103 | Ga0070708_100853247 | 3300005445 | Unclassified | 855 |
| 104 | Ga0070663_100027336 | 3300005455 | Unclassified | 3874 |
| 105 | Ga0070663_100030086 | 3300005455 | Bacteria | 3718 |
| 106 | Ga0070678_100018503 | 3300005456 | Bacteria | 4516 |
| 107 | Ga0070662_100001847 | 3300005457 | Bacteria | 12981 |
| 108 | Ga0070662_100120079 | 3300005457 | Bacteria | 2013 |
| 109 | Ga0070662_100726232 | 3300005457 | Unclassified | 841 |
| 110 | Ga0070681_10007306 | 3300005458 | Bacteria | 10783 |
| 111 | Ga0070681_11092852 | 3300005458 | Bacteria | 718 |
| 112 | Ga0070685_10072563 | 3300005466 | Bacteria | 2044 |
| 113 | Ga0070685_10083892 | 3300005466 | Unclassified | 1915 |
| 114 | Ga0070706_100000339 | 3300005467 | Bacteria | 56563 |
| 115 | Ga0070706_100013001 | 3300005467 | Bacteria | 7703 |
| 116 | Ga0070706_100013153 | 3300005467 | Bacteria | 7658 |
| 117 | Ga0070706_100081435 | 3300005467 | Bacteria | 2998 |
| 118 | Ga0070706_100101407 | 3300005467 | Bacteria | 2675 |
| 119 | Ga0070706_100118702 | 3300005467 | Bacteria | 2464 |
| 120 | Ga0070706_100223200 | 3300005467 | Bacteria | 1759 |
| 121 | Ga0070706_100491390 | 3300005467 | Unclassified | 1142 |
| 122 | Ga0070706_100839690 | 3300005467 | Bacteria | 850 |
| 123 | Ga0070707_100002484 | 3300005468 | Bacteria | 17582 |
| 124 | Ga0070707_100006579 | 3300005468 | Bacteria | 10783 |
| 125 | Ga0070707_100011119 | 3300005468 | Bacteria | 8385 |
| 126 | Ga0070707_100014650 | 3300005468 | Bacteria | 7348 |
| 127 | Ga0070707_100016462 | 3300005468 | Bacteria | 6938 |
| 128 | Ga0070707_100185269 | 3300005468 | Bacteria | 2030 |
| 129 | Ga0070707_100186156 | 3300005468 | Bacteria | 2024 |
| 130 | Ga0070707_100232250 | 3300005468 | Bacteria | 1795 |
| 131 | Ga0070707_101086040 | 3300005468 | Bacteria | 766 |
| 132 | Ga0070698_100012903 | 3300005471 | Bacteria | 8849 |
| 133 | Ga0070698_100044664 | 3300005471 | Unclassified | 4535 |
| 134 | Ga0070698_100058377 | 3300005471 | Unclassified | 3901 |
| 135 | Ga0070698_100180108 | 3300005471 | Bacteria | 2052 |
| 136 | Ga0070698_100235273 | 3300005471 | Bacteria | 1765 |
| 137 | Ga0070698_100361636 | 3300005471 | Bacteria | 1383 |
| 138 | Ga0070698_100370848 | 3300005471 | Bacteria | 1363 |
| 139 | Ga0070698_101420691 | 3300005471 | Unclassified | 645 |
| 140 | Ga0070699_100017866 | 3300005518 | Bacteria | 6090 |
| 141 | Ga0070699_100111344 | 3300005518 | Unclassified | 2404 |
| 142 | Ga0070699_100265497 | 3300005518 | Unclassified | 1536 |
| 143 | Ga0070699_100415799 | 3300005518 | Bacteria | 1217 |
| 144 | Ga0070699_100544001 | 3300005518 | Unclassified | 1057 |
| 145 | Ga0070699_101103655 | 3300005518 | Unclassified | 728 |
| 146 | Ga0070679_100134560 | 3300005530 | Unclassified | 2453 |
| 147 | Ga0070684_100000906 | 3300005535 | Bacteria | 20999 |
| 148 | Ga0070684_100019429 | 3300005535 | Bacteria | 5620 |
| 149 | Ga0070684_100022922 | 3300005535 | Bacteria | 5214 |
| 150 | Ga0070684_100103646 | 3300005535 | Bacteria | 2545 |
| 151 | Ga0070697_100000889 | 3300005536 | Bacteria | 22458 |
| 152 | Ga0070697_100015146 | 3300005536 | Bacteria | 6055 |
| 153 | Ga0070697_100021041 | 3300005536 | Bacteria | 5165 |
| 154 | Ga0070697_100027961 | 3300005536 | Bacteria | 4514 |
| 155 | Ga0070697_100028727 | 3300005536 | Bacteria | 4454 |
| 156 | Ga0070697_100034881 | 3300005536 | Unclassified | 4058 |
| 157 | Ga0070697_100040378 | 3300005536 | Unclassified | 3775 |
| 158 | Ga0070697_100096273 | 3300005536 | Bacteria | 2455 |
| 159 | Ga0070697_100147317 | 3300005536 | Unclassified | 1983 |
| 160 | Ga0070697_100280190 | 3300005536 | Unclassified | 1430 |
| 161 | Ga0070697_100332579 | 3300005536 | Bacteria | 1310 |
| 162 | Ga0068853_101111876 | 3300005539 | Unclassified | 762 |
| 163 | Ga0070672_100074720 | 3300005543 | Unclassified | 2704 |
| 164 | Ga0070672_100223865 | 3300005543 | Unclassified | 1579 |
| 165 | Ga0070686_100139294 | 3300005544 | Unclassified | 1687 |
| 166 | Ga0070693_100439785 | 3300005547 | Unclassified | 913 |
| 167 | Ga0070665_100033252 | 3300005548 | Bacteria | 5189 |
| 168 | Ga0070665_100118510 | 3300005548 | Unclassified | 2649 |
| 169 | Ga0070665_100693235 | 3300005548 | Unclassified | 1032 |
| 170 | Ga0070704_100013053 | 3300005549 | Bacteria | 5144 |
| 171 | Ga0070704_100057908 | 3300005549 | Bacteria | 2758 |
| 172 | Ga0070664_100964762 | 3300005564 | Unclassified | 801 |
| 173 | Ga0068854_101200740 | 3300005578 | Unclassified | 680 |
| 174 | Ga0068856_100204964 | 3300005614 | Unclassified | 1987 |
| 175 | Ga0068856_100394941 | 3300005614 | Bacteria | 1403 |
| 176 | Ga0068852_100578260 | 3300005616 | Bacteria | 1126 |
| 177 | Ga0068864_100105926 | 3300005618 | Bacteria | 2500 |
| 178 | Ga0068866_10089768 | 3300005718 | Bacteria | 1671 |
| 179 | Ga0068858_100294132 | 3300005842 | Bacteria | 1548 |
| 180 | Ga0068858_100702051 | 3300005842 | Unclassified | 984 |
| 181 | Ga0068860_100012546 | 3300005843 | Bacteria | 8343 |
| 182 | Ga0068860_100023997 | 3300005843 | Bacteria | 5895 |
| 183 | Ga0068860_100242077 | 3300005843 | Bacteria | 1755 |
| 184 | Ga0068860_100676602 | 3300005843 | Unclassified | 1041 |
| 185 | Ga0068862_100051326 | 3300005844 | Bacteria | 3527 |
| 186 | Ga0068862_100633512 | 3300005844 | Unclassified | 1030 |
| 187 | Ga0081455_10000314 | 3300005937 | Bacteria | 63484 |
| 188 | Ga0081455_10000959 | 3300005937 | Bacteria | 36868 |
| 189 | Ga0081455_10005232 | 3300005937 | Bacteria | 14267 |
| 190 | Ga0081455_10015384 | 3300005937 | Bacteria | 7437 |
| 191 | Ga0081455_10041812 | 3300005937 | Unclassified | 4026 |
| 192 | Ga0081455_10049009 | 3300005937 | Unclassified | 3644 |
| 193 | Ga0081540_1000016 | 3300005983 | Bacteria | 165370 |
| 194 | Ga0081540_1024398 | 3300005983 | Unclassified | 3510 |
| 195 | Ga0081540_1105686 | 3300005983 | Unclassified | 1202 |
| 196 | Ga0081539_10000014 | 3300005985 | Bacteria | 411270 |
| 197 | Ga0081539_10036270 | 3300005985 | Bacteria | 2954 |
| 198 | Ga0070717_10002989 | 3300006028 | Bacteria | 12038 |
| 199 | Ga0070717_10007985 | 3300006028 | Bacteria | 7882 |
| 200 | Ga0070717_10028994 | 3300006028 | Bacteria | 4436 |
| 201 | Ga0070717_10037682 | 3300006028 | Bacteria | 3927 |
| 202 | Ga0070717_10154153 | 3300006028 | Bacteria | 1989 |
| 203 | Ga0070717_10247184 | 3300006028 | Unclassified | 1575 |
| 204 | Ga0070717_10294897 | 3300006028 | Unclassified | 1440 |
| 205 | Ga0070717_10827050 | 3300006028 | Unclassified | 843 |
| 206 | Ga0070715_10017096 | 3300006163 | Bacteria | 2739 |
| 207 | Ga0070715_10214124 | 3300006163 | Bacteria | 986 |
| 208 | Ga0070715_10298201 | 3300006163 | Unclassified | 861 |
| 209 | Ga0070716_100039273 | 3300006173 | Bacteria | 2626 |
| 210 | Ga0070716_100071576 | 3300006173 | Bacteria | 2039 |
| 211 | Ga0070716_100375522 | 3300006173 | Bacteria | 1014 |
| 212 | Ga0070716_101183426 | 3300006173 | Unclassified | 613 |
| 213 | Ga0070712_100030859 | 3300006175 | Bacteria | 3606 |
| 214 | Ga0070712_100040418 | 3300006175 | Bacteria | 3197 |
| 215 | Ga0070712_100063004 | 3300006175 | Bacteria | 2624 |
| 216 | Ga0070712_100070560 | 3300006175 | Unclassified | 2497 |
| 217 | Ga0070712_100081693 | 3300006175 | Bacteria | 2342 |
| 218 | Ga0070712_100130567 | 3300006175 | Bacteria | 1903 |
| 219 | Ga0070712_100393987 | 3300006175 | Unclassified | 1142 |
| 220 | Ga0070712_101009824 | 3300006175 | Unclassified | 720 |
| 221 | Ga0070712_101074313 | 3300006175 | Bacteria | 698 |
| 222 | Ga0070712_101132725 | 3300006175 | Unclassified | 680 |
| 223 | Ga0097621_100035590 | 3300006237 | Unclassified | 3980 |
| 224 | Ga0068871_100083945 | 3300006358 | Unclassified | 2643 |
| 225 | Ga0075433_10892098 | 3300006852 | Unclassified | 776 |
| 226 | Ga0075434_100315802 | 3300006871 | Bacteria | 1583 |
| 227 | Ga0068865_100034788 | 3300006881 | Unclassified | 3383 |
| 228 | Ga0068865_100257833 | 3300006881 | Unclassified | 1379 |
| 229 | Ga0075436_100134397 | 3300006914 | Bacteria | 1736 |
| 230 | Ga0099794_10186454 | 3300007265 | Bacteria | 1060 |
| 231 | Ga0099795_10002031 | 3300007788 | Bacteria | 4635 |
| 232 | Ga0099795_10007257 | 3300007788 | Unclassified | 3081 |
| 233 | Ga0105240_10808136 | 3300009093 | Bacteria | 1015 |
| 234 | Ga0111539_10104757 | 3300009094 | Bacteria | 3319 |
| 235 | Ga0105245_10094451 | 3300009098 | Bacteria | 2756 |
| 236 | Ga0105245_10296930 | 3300009098 | Unclassified | 1584 |
| 237 | Ga0105245_10531666 | 3300009098 | Unclassified | 1196 |
| 238 | Ga0105245_10966590 | 3300009098 | Bacteria | 895 |
| 239 | Ga0105245_11406218 | 3300009098 | Unclassified | 748 |
| 240 | Ga0105247_10481337 | 3300009101 | Unclassified | 901 |
| 241 | Ga0114129_10826009 | 3300009147 | Bacteria | 1180 |
| 242 | Ga0105243_10637500 | 3300009148 | Unclassified | 1031 |
| 243 | Ga0105243_10893895 | 3300009148 | Unclassified | 883 |
| 244 | Ga0105241_10112915 | 3300009174 | Bacteria | 2177 |
| 245 | Ga0105242_10116091 | 3300009176 | Bacteria | 2289 |
| 246 | Ga0105242_10136501 | 3300009176 | Unclassified | 2124 |
| 247 | Ga0105248_10676437 | 3300009177 | Unclassified | 1164 |
| 248 | Ga0105237_10122402 | 3300009545 | Unclassified | 2595 |
| 249 | Ga0105237_10889363 | 3300009545 | Unclassified | 898 |
| 250 | Ga0105237_10951825 | 3300009545 | Bacteria | 866 |
| 251 | Ga0105249_10030100 | 3300009553 | Bacteria | 4905 |
| 252 | Ga0105249_10362235 | 3300009553 | Bacteria | 1472 |
| 253 | Ga0099796_10002908 | 3300010159 | Unclassified | 3864 |
| 254 | Ga0099796_10111074 | 3300010159 | Bacteria | 1043 |
| 255 | Ga0105239_10011346 | 3300010375 | Bacteria | 9941 |
| 256 | Ga0105246_10070808 | 3300011119 | Unclassified | 2454 |
| 257 | Ga0157327_1004405 | 3300012512 | Bacteria | 1088 |
| 258 | Ga0157338_1010564 | 3300012515 | Bacteria | 934 |
| 259 | Ga0157373_10793866 | 3300013100 | Unclassified | 698 |
| 260 | Ga0157371_10120829 | 3300013102 | Unclassified | 1862 |
| 261 | Ga0157371_10615544 | 3300013102 | Unclassified | 808 |
| 262 | Ga0157370_10138585 | 3300013104 | Bacteria | 2267 |
| 263 | Ga0157369_10029470 | 3300013105 | Bacteria | 6064 |
| 264 | Ga0157369_10515238 | 3300013105 | Bacteria | 1237 |
| 265 | Ga0157374_10018203 | 3300013296 | Bacteria | 6197 |
| 266 | Ga0157374_10043729 | 3300013296 | Bacteria | 4139 |
| 267 | Ga0157374_10124964 | 3300013296 | Bacteria | 2486 |
| 268 | Ga0157374_10130760 | 3300013296 | Bacteria | 2429 |
| 269 | Ga0157374_10176130 | 3300013296 | Bacteria | 2088 |
| 270 | Ga0157374_11219120 | 3300013296 | Unclassified | 774 |
| 271 | Ga0157374_11293480 | 3300013296 | Bacteria | 751 |
| 272 | Ga0157378_10008313 | 3300013297 | Bacteria | 9043 |
| 273 | Ga0157378_10052801 | 3300013297 | Bacteria | 3617 |
| 274 | Ga0157378_10197829 | 3300013297 | Bacteria | 1899 |
| 275 | Ga0157378_10831336 | 3300013297 | Unclassified | 951 |
| 276 | Ga0157378_10849896 | 3300013297 | Unclassified | 941 |
| 277 | Ga0157378_11786480 | 3300013297 | Unclassified | 663 |
| 278 | Ga0163162_10010679 | 3300013306 | Bacteria | 8930 |
| 279 | Ga0163162_10043125 | 3300013306 | Bacteria | 4516 |
| 280 | Ga0163162_10202920 | 3300013306 | Bacteria | 2112 |
| 281 | Ga0163162_10228506 | 3300013306 | Bacteria | 1991 |
| 282 | Ga0157372_10084908 | 3300013307 | Unclassified | 3590 |
| 283 | Ga0157372_10146547 | 3300013307 | Bacteria | 2723 |
| 284 | Ga0157372_10152490 | 3300013307 | Bacteria | 2668 |
| 285 | Ga0157375_10018938 | 3300013308 | Bacteria | 6250 |
| 286 | Ga0157375_10233657 | 3300013308 | Bacteria | 1998 |
| 287 | Ga0157375_10321922 | 3300013308 | Bacteria | 1711 |
| 288 | Ga0157375_10571852 | 3300013308 | Unclassified | 1291 |
| 289 | Ga0157375_11078286 | 3300013308 | Bacteria | 940 |
| 290 | Ga0163163_10231397 | 3300014325 | Unclassified | 1897 |
| 291 | Ga0163163_10311040 | 3300014325 | Unclassified | 1628 |
| 292 | Ga0163163_10413183 | 3300014325 | Unclassified | 1408 |
| 293 | Ga0163163_10414470 | 3300014325 | Bacteria | 1406 |
| 294 | Ga0182008_10026360 | 3300014497 | Unclassified | 2948 |
| 295 | Ga0157377_10338359 | 3300014745 | Bacteria | 1006 |
| 296 | Ga0157379_10145567 | 3300014968 | Bacteria | 2137 |
| 297 | Ga0157376_10031020 | 3300014969 | Bacteria | 4275 |
| 298 | Ga0157376_10087782 | 3300014969 | Bacteria | 2685 |
| 299 | Ga0157376_10478669 | 3300014969 | Bacteria | 1220 |
| 300 | Ga0157376_10898592 | 3300014969 | Unclassified | 904 |
| 301 | Ga0182005_1010277 | 3300015265 | Unclassified | 2697 |
| 302 | Ga0163161_10111116 | 3300017792 | Bacteria | 2049 |
| 303 | Ga0163161_10530323 | 3300017792 | Unclassified | 962 |
| 304 | Ga0207666_1002361 | 3300025271 | Bacteria | 2270 |
| 305 | Ga0207666_1036648 | 3300025271 | Unclassified | 762 |
| 306 | Ga0207673_1004308 | 3300025290 | Unclassified | 1696 |
| 307 | Ga0207673_1006416 | 3300025290 | Bacteria | 1455 |
| 308 | Ga0207697_10000283 | 3300025315 | Bacteria | 28184 |
| 309 | Ga0207697_10000681 | 3300025315 | Bacteria | 19317 |
| 310 | Ga0207697_10002609 | 3300025315 | Bacteria | 9267 |
| 311 | Ga0207697_10006249 | 3300025315 | Bacteria | 5415 |
| 312 | Ga0207697_10007405 | 3300025315 | Bacteria | 4899 |
| 313 | Ga0207697_10028652 | 3300025315 | Unclassified | 2278 |
| 314 | Ga0207697_10322936 | 3300025315 | Unclassified | 685 |
| 315 | Ga0207653_10015114 | 3300025885 | Bacteria | 2422 |
| 316 | Ga0207682_10016117 | 3300025893 | Bacteria | 2913 |
| 317 | Ga0207692_10124997 | 3300025898 | Bacteria | 1445 |
| 318 | Ga0207710_10170959 | 3300025900 | Unclassified | 1062 |
| 319 | Ga0207688_10002322 | 3300025901 | Bacteria | 10225 |
| 320 | Ga0207688_10115308 | 3300025901 | Bacteria | 1563 |
| 321 | Ga0207688_10207565 | 3300025901 | Bacteria | 1176 |
| 322 | Ga0207680_10176824 | 3300025903 | Unclassified | 1441 |
| 323 | Ga0207647_10005474 | 3300025904 | Bacteria | 9294 |
| 324 | Ga0207647_10150291 | 3300025904 | Bacteria | 1361 |
| 325 | Ga0207685_10006553 | 3300025905 | Bacteria | 3180 |
| 326 | Ga0207685_10027122 | 3300025905 | Unclassified | 2001 |
| 327 | Ga0207699_10027500 | 3300025906 | Bacteria | 3150 |
| 328 | Ga0207645_10001228 | 3300025907 | Bacteria | 21121 |
| 329 | Ga0207645_10007044 | 3300025907 | Bacteria | 8005 |
| 330 | Ga0207705_10426776 | 3300025909 | Unclassified | 1027 |
| 331 | Ga0207684_10000276 | 3300025910 | Bacteria | 75551 |
| 332 | Ga0207684_10011637 | 3300025910 | Bacteria | 7683 |
| 333 | Ga0207684_10015808 | 3300025910 | Bacteria | 6490 |
| 334 | Ga0207684_10019577 | 3300025910 | Bacteria | 5789 |
| 335 | Ga0207684_10047164 | 3300025910 | Bacteria | 3655 |
| 336 | Ga0207684_10069067 | 3300025910 | Bacteria | 3003 |
| 337 | Ga0207684_10082108 | 3300025910 | Bacteria | 2744 |
| 338 | Ga0207684_10159963 | 3300025910 | Bacteria | 1939 |
| 339 | Ga0207684_10286517 | 3300025910 | Bacteria | 1420 |
| 340 | Ga0207654_10056090 | 3300025911 | Bacteria | 2284 |
| 341 | Ga0207707_10048004 | 3300025912 | Unclassified | 3719 |
| 342 | Ga0207671_10533735 | 3300025914 | Bacteria | 935 |
| 343 | Ga0207693_10004040 | 3300025915 | Bacteria | 12470 |
| 344 | Ga0207693_10033901 | 3300025915 | Unclassified | 4028 |
| 345 | Ga0207693_10040626 | 3300025915 | Bacteria | 3663 |
| 346 | Ga0207693_10050893 | 3300025915 | Bacteria | 3252 |
| 347 | Ga0207693_10057166 | 3300025915 | Bacteria | 3058 |
| 348 | Ga0207693_10080040 | 3300025915 | Unclassified | 2558 |
| 349 | Ga0207693_10127633 | 3300025915 | Bacteria | 1999 |
| 350 | Ga0207693_10142275 | 3300025915 | Bacteria | 1886 |
| 351 | Ga0207663_10011079 | 3300025916 | Bacteria | 4826 |
| 352 | Ga0207663_10040250 | 3300025916 | Bacteria | 2839 |
| 353 | Ga0207663_10630892 | 3300025916 | Unclassified | 844 |
| 354 | Ga0207660_10104664 | 3300025917 | Unclassified | 2119 |
| 355 | Ga0207662_10006705 | 3300025918 | Bacteria | 6225 |
| 356 | Ga0207662_10081717 | 3300025918 | Bacteria | 1973 |
| 357 | Ga0207657_10043454 | 3300025919 | Bacteria | 3958 |
| 358 | Ga0207657_10382983 | 3300025919 | Unclassified | 1107 |
| 359 | Ga0207649_10019808 | 3300025920 | Unclassified | 3850 |
| 360 | Ga0207649_10369416 | 3300025920 | Unclassified | 1066 |
| 361 | Ga0207652_10018051 | 3300025921 | Bacteria | 5784 |
| 362 | Ga0207646_10003213 | 3300025922 | Bacteria | 18658 |
| 363 | Ga0207646_10005702 | 3300025922 | Bacteria | 13058 |
| 364 | Ga0207646_10021461 | 3300025922 | Bacteria | 5966 |
| 365 | Ga0207646_10048382 | 3300025922 | Bacteria | 3811 |
| 366 | Ga0207646_10067553 | 3300025922 | Bacteria | 3192 |
| 367 | Ga0207646_10072396 | 3300025922 | Unclassified | 3078 |
| 368 | Ga0207646_10179174 | 3300025922 | Unclassified | 1914 |
| 369 | Ga0207646_10275548 | 3300025922 | Bacteria | 1520 |
| 370 | Ga0207646_10781003 | 3300025922 | Bacteria | 851 |
| 371 | Ga0207646_10824631 | 3300025922 | Unclassified | 825 |
| 372 | Ga0207681_10004121 | 3300025923 | Bacteria | 9010 |
| 373 | Ga0207681_10367123 | 3300025923 | Unclassified | 1156 |
| 374 | Ga0207681_11095656 | 3300025923 | Unclassified | 669 |
| 375 | Ga0207694_11139538 | 3300025924 | Unclassified | 660 |
| 376 | Ga0207650_10651867 | 3300025925 | Bacteria | 888 |
| 377 | Ga0207659_10005770 | 3300025926 | Bacteria | 7544 |
| 378 | Ga0207659_10005985 | 3300025926 | Bacteria | 7420 |
| 379 | Ga0207659_10147386 | 3300025926 | Bacteria | 1834 |
| 380 | Ga0207659_10157156 | 3300025926 | Unclassified | 1781 |
| 381 | Ga0207659_10227596 | 3300025926 | Unclassified | 1502 |
| 382 | Ga0207687_10169395 | 3300025927 | Unclassified | 1683 |
| 383 | Ga0207687_10204868 | 3300025927 | Bacteria | 1544 |
| 384 | Ga0207700_10096336 | 3300025928 | Bacteria | 2349 |
| 385 | Ga0207700_10238363 | 3300025928 | Bacteria | 1549 |
| 386 | Ga0207700_10342903 | 3300025928 | Unclassified | 1299 |
| 387 | Ga0207700_10744610 | 3300025928 | Bacteria | 876 |
| 388 | Ga0207664_10126294 | 3300025929 | Unclassified | 2148 |
| 389 | Ga0207664_10129312 | 3300025929 | Bacteria | 2124 |
| 390 | Ga0207664_10153692 | 3300025929 | Bacteria | 1957 |
| 391 | Ga0207664_10216193 | 3300025929 | Bacteria | 1660 |
| 392 | Ga0207664_10311419 | 3300025929 | Bacteria | 1387 |
| 393 | Ga0207644_10065887 | 3300025931 | Bacteria | 2635 |
| 394 | Ga0207644_10155407 | 3300025931 | Unclassified | 1773 |
| 395 | Ga0207644_10330899 | 3300025931 | Unclassified | 1233 |
| 396 | Ga0207644_10754296 | 3300025931 | Unclassified | 813 |
| 397 | Ga0207690_10091569 | 3300025932 | Bacteria | 2149 |
| 398 | Ga0207706_10002099 | 3300025933 | Bacteria | 19504 |
| 399 | Ga0207706_10056139 | 3300025933 | Bacteria | 3472 |
| 400 | Ga0207706_10123205 | 3300025933 | Bacteria | 2281 |
| 401 | Ga0207706_10124287 | 3300025933 | Unclassified | 2270 |
| 402 | Ga0207706_10262968 | 3300025933 | Bacteria | 1506 |
| 403 | Ga0207686_10081096 | 3300025934 | Unclassified | 2117 |
| 404 | Ga0207670_10005975 | 3300025936 | Bacteria | 6723 |
| 405 | Ga0207670_10209018 | 3300025936 | Bacteria | 1487 |
| 406 | Ga0207670_10333096 | 3300025936 | Unclassified | 1197 |
| 407 | Ga0207669_10095655 | 3300025937 | Bacteria | 1947 |
| 408 | Ga0207669_10651924 | 3300025937 | Unclassified | 861 |
| 409 | Ga0207704_10109564 | 3300025938 | Unclassified | 1863 |
| 410 | Ga0207665_10004405 | 3300025939 | Bacteria | 9357 |
| 411 | Ga0207665_10033284 | 3300025939 | Unclassified | 3415 |
| 412 | Ga0207665_10126526 | 3300025939 | Bacteria | 1810 |
| 413 | Ga0207665_10160231 | 3300025939 | Bacteria | 1618 |
| 414 | Ga0207665_10242195 | 3300025939 | Bacteria | 1329 |
| 415 | Ga0207665_10267526 | 3300025939 | Bacteria | 1268 |
| 416 | Ga0207665_10751627 | 3300025939 | Unclassified | 769 |
| 417 | Ga0207665_10956523 | 3300025939 | Unclassified | 681 |
| 418 | Ga0207691_10001630 | 3300025940 | Bacteria | 22283 |
| 419 | Ga0207711_10739115 | 3300025941 | Unclassified | 917 |
| 420 | Ga0207689_10038227 | 3300025942 | Bacteria | 3977 |
| 421 | Ga0207689_10147016 | 3300025942 | Bacteria | 1942 |
| 422 | Ga0207689_10241008 | 3300025942 | Unclassified | 1495 |
| 423 | Ga0207661_10016865 | 3300025944 | Bacteria | 5394 |
| 424 | Ga0207661_10431376 | 3300025944 | Bacteria | 1198 |
| 425 | Ga0207679_10274705 | 3300025945 | Bacteria | 1443 |
| 426 | Ga0207679_10410843 | 3300025945 | Unclassified | 1193 |
| 427 | Ga0207679_11120282 | 3300025945 | Unclassified | 722 |
| 428 | Ga0207651_10032291 | 3300025960 | Bacteria | 3361 |
| 429 | Ga0207651_10032847 | 3300025960 | Unclassified | 3338 |
| 430 | Ga0207651_10118809 | 3300025960 | Bacteria | 2000 |
| 431 | Ga0207712_10026166 | 3300025961 | Bacteria | 3884 |
| 432 | Ga0207668_10009977 | 3300025972 | Bacteria | 5714 |
| 433 | Ga0207668_10124106 | 3300025972 | Bacteria | 1960 |
| 434 | Ga0207668_10573047 | 3300025972 | Bacteria | 980 |
| 435 | Ga0207658_10017925 | 3300025986 | Bacteria | 4880 |
| 436 | Ga0207658_10130796 | 3300025986 | Bacteria | 2016 |
| 437 | Ga0207658_10277751 | 3300025986 | Bacteria | 1435 |
| 438 | Ga0207677_10011998 | 3300026023 | Bacteria | 4963 |
| 439 | Ga0207677_10132978 | 3300026023 | Bacteria | 1892 |
| 440 | Ga0207703_10399611 | 3300026035 | Bacteria | 1275 |
| 441 | Ga0207703_10810343 | 3300026035 | Unclassified | 894 |
| 442 | Ga0207678_10021102 | 3300026067 | Bacteria | 5708 |
| 443 | Ga0207678_10651110 | 3300026067 | Bacteria | 926 |
| 444 | Ga0207708_10051341 | 3300026075 | Bacteria | 3139 |
| 445 | Ga0207702_10135196 | 3300026078 | Unclassified | 2224 |
| 446 | Ga0207641_10158525 | 3300026088 | Bacteria | 2055 |
| 447 | Ga0207648_10131171 | 3300026089 | Bacteria | 2206 |
| 448 | Ga0207676_10525297 | 3300026095 | Unclassified | 1127 |
| 449 | Ga0207674_10510817 | 3300026116 | Bacteria | 1161 |
| 450 | Ga0207675_100118653 | 3300026118 | Bacteria | 2502 |
| 451 | Ga0207683_10018640 | 3300026121 | Bacteria | 5924 |
| 452 | Ga0207683_10062891 | 3300026121 | Unclassified | 3269 |
| 453 | Ga0207683_10240052 | 3300026121 | Unclassified | 1653 |
| 454 | Ga0207683_10266044 | 3300026121 | Bacteria | 1566 |
| 455 | Ga0207698_10326781 | 3300026142 | Unclassified | 1439 |
| 456 | Ga0209973_1019799 | 3300027252 | Unclassified | 884 |
| 457 | Ga0209179_1012944 | 3300027512 | Unclassified | 1507 |
| 458 | Ga0210002_1004868 | 3300027617 | Unclassified | 2004 |
| 459 | Ga0209971_1021268 | 3300027682 | Unclassified | 1543 |
| 460 | Ga0209998_10011390 | 3300027717 | Unclassified | 1843 |
| 461 | Ga0268266_10031046 | 3300028379 | Bacteria | 4537 |
| 462 | Ga0268266_10046725 | 3300028379 | Unclassified | 3706 |
| 463 | Ga0268266_10068131 | 3300028379 | Bacteria | 3081 |
| 464 | Ga0268266_10111515 | 3300028379 | Bacteria | 2424 |
| 465 | Ga0268264_10009325 | 3300028381 | Bacteria | 8127 |
| 466 | Ga0268264_10119843 | 3300028381 | Bacteria | 2318 |
| 467 | Ga0268264_10353569 | 3300028381 | Bacteria | 1399 |
| 468 | Ga0373944_0052727 | 3300035089 | Bacteria | 1286 |
| 469 | Ga0373944_0079782 | 3300035089 | Unclassified | 1079 |
| 470 | Ga0373936_0303549 | 3300035113 | Unclassified | 721 |
| 471 | Ga0373943_0249618 | 3300035170 | Bacteria | 996 |
| 472 | Ga0373943_0267870 | 3300035170 | Unclassified | 963 |
| 473 | Ga0373946_0015546 | 3300035171 | Bacteria | 2888 |
| 474 | Ga0373946_0094934 | 3300035171 | Unclassified | 1328 |
| 475 | Ga0373946_0479729 | 3300035171 | Unclassified | 636 |
| 476 | Ga0373955_0628350 | 3300035172 | Unclassified | 658 |
| 477 | Ga0373931_0146795 | 3300035691 | Bacteria | 1372 |
| 478 | Ga0373935_0031307 | 3300035692 | Unclassified | 3301 |
| 479 | Ga0373927_0215533 | 3300035695 | Bacteria | 1261 |
| 480 | Ga0373927_0285902 | 3300035695 | Unclassified | 1085 |
| 481 | Ga0373933_0082349 | 3300035724 | Bacteria | 1975 |
| 482 | Ga0373947_0019989 | 3300035725 | Unclassified | 3865 |
| 483 | Ga0373947_0132783 | 3300035725 | Unclassified | 1591 |
| 484 | Ga0373947_0186010 | 3300035725 | Bacteria | 1354 |
| 485 | Ga0373947_0437293 | 3300035725 | Unclassified | 885 |
| 486 | Ga0373947_0476840 | 3300035725 | Bacteria | 846 |
| 487 | Ga0373925_0027165 | 3300037068 | Unclassified | 4191 |
| 488 | Ga0373925_0062700 | 3300037068 | Unclassified | 2796 |
| 489 | Ga0373925_0087360 | 3300037068 | Bacteria | 2380 |
| 490 | Ga0373925_0122764 | 3300037068 | Bacteria | 2018 |
| 491 | Ga0373925_0629881 | 3300037068 | Unclassified | 884 |
| 492 | Ga0395899_0068396 | 3300037312 | Bacteria | 2604 |
| 493 | Ga0395899_0845924 | 3300037312 | Unclassified | 562 |
| 494 | Ga0395900_1018914 | 3300037418 | Bacteria | 747 |
| 495 | Ga0395900_1043134 | 3300037418 | Unclassified | 736 |
| 496 | Ga0395898_0026578 | 3300037466 | Bacteria | 5821 |
| 497 | Ga0395905_0136986 | 3300037471 | Unclassified | 2303 |
| 498 | Ga0436364_1130765 | 3300037853 | Unclassified | 901 |
| 499 | Ga0395901_0001233 | 3300038443 | Bacteria | 27296 |
| 500 | Ga0395901_0166012 | 3300038443 | Bacteria | 2318 |
| 501 | Ga0395901_0957845 | 3300038443 | Unclassified | 834 |
| 502 | Ga0436363_1341675 | 3300039450 | Bacteria | 1261 |
| 503 | Ga0451839_0929501 | 3300041496 | Unclassified | 1208 |
| 504 | Ga0451853_3717991 | 3300041512 | Unclassified | 1613 |
| 505 | Ga0451576_0025769 | 3300045051 | Bacteria | 6334 |
| 506 | Ga0495629_0268043 | 3300046459 | Bacteria | 1173 |
| 507 | Ga0495653_0250399 | 3300046463 | Bacteria | 1176 |
| 508 | Ga0495653_0389325 | 3300046463 | Unclassified | 888 |
| 509 | Ga0495582_0038820 | 3300046473 | Bacteria | 2621 |
| 510 | Ga0495639_0092171 | 3300046475 | Bacteria | 1423 |
| 511 | Ga0495662_0060765 | 3300046476 | Bacteria | 1825 |
| 512 | Ga0495594_0025738 | 3300046499 | Bacteria | 3164 |
| 513 | Ga0495618_0153917 | 3300046514 | Unclassified | 1468 |
| 514 | Ga0495630_0078442 | 3300046517 | Unclassified | 2490 |
| 515 | Ga0495644_0121506 | 3300046523 | Unclassified | 994 |
| 516 | Ga0495598_0065016 | 3300046537 | Bacteria | 1135 |
| 517 | Ga0495656_0173897 | 3300046615 | Unclassified | 1055 |
| 518 | Ga0495634_0334744 | 3300046642 | Unclassified | 909 |
| 519 | Ga0495634_0619095 | 3300046642 | Unclassified | 627 |
| 520 | Ga0495588_0540922 | 3300046674 | Unclassified | 610 |
| 521 | Ga0495657_0365481 | 3300046675 | Bacteria | 852 |
| 522 | Ga0495623_0185280 | 3300046679 | Unclassified | 1206 |
| 523 | Ga0495647_0096680 | 3300046681 | Bacteria | 1218 |
| 524 | Ga0495658_0052907 | 3300046683 | Unclassified | 2304 |
| 525 | Ga0495669_0046049 | 3300046684 | Bacteria | 1946 |
| 526 | Ga0495624_0176822 | 3300046690 | Bacteria | 1301 |
| 527 | Ga0495600_0578329 | 3300046809 | Unclassified | 684 |
| 528 | Ga0495581_0065519 | 3300047315 | Bacteria | 2100 |
| 529 | Ga0495674_0226158 | 3300047319 | Unclassified | 1545 |
| 530 | Ga0495676_0910583 | 3300047321 | Unclassified | 563 |
| 531 | Ga0495593_0126960 | 3300047673 | Bacteria | 1296 |
| 532 | Ga0496100_0013450 | 3300048903 | Bacteria | 4720 |
| 533 | Ga0496100_0205696 | 3300048903 | Unclassified | 1437 |
| 534 | Ga0496101_0030095 | 3300048904 | Unclassified | 3803 |
| 535 | Ga0496101_0329202 | 3300048904 | Unclassified | 1199 |
| 536 | Ga0496102_0028285 | 3300048905 | Bacteria | 5006 |
| 537 | Ga0496102_0103744 | 3300048905 | Bacteria | 2644 |
| 538 | Ga0496103_0016087 | 3300048906 | Unclassified | 4463 |
| 539 | Ga0496103_0080463 | 3300048906 | Bacteria | 2049 |
| 540 | Ga0496104_0064037 | 3300048907 | Bacteria | 3488 |
| 541 | Ga0496104_0186408 | 3300048907 | Bacteria | 1985 |
| 542 | Ga0496105_0175184 | 3300048908 | Unclassified | 1757 |
| 543 | Ga0496105_0202510 | 3300048908 | Bacteria | 1620 |
| 544 | Ga0496105_0852123 | 3300048908 | Unclassified | 690 |
| 545 | Ga0496106_0003614 | 3300048909 | Bacteria | 11532 |
| 546 | Ga0496107_0273656 | 3300048910 | Unclassified | 1257 |
| 547 | Ga0496108_0025515 | 3300048911 | Unclassified | 4870 |
| 548 | Ga0496108_0248321 | 3300048911 | Bacteria | 1548 |
| 549 | Ga0496109_0007567 | 3300048912 | Bacteria | 9206 |
| 550 | Ga0496110_0022586 | 3300048913 | Bacteria | 5344 |
| 551 | Ga0496110_0206993 | 3300048913 | Bacteria | 1783 |
| 552 | Ga0496110_0558374 | 3300048913 | Bacteria | 1040 |
| 553 | Ga0496111_0652138 | 3300048914 | Bacteria | 768 |
| 554 | Ga0496111_0900615 | 3300048914 | Bacteria | 637 |
| 555 | Ga0496112_0023116 | 3300048915 | Bacteria | 5934 |
| 556 | Ga0496112_0034175 | 3300048915 | Unclassified | 4947 |
| 557 | Ga0496112_0265788 | 3300048915 | Bacteria | 1664 |
| 558 | Ga0496112_0305463 | 3300048915 | Bacteria | 1536 |
| 559 | Ga0496112_0334221 | 3300048915 | Bacteria | 1459 |
| 560 | Ga0496112_0527272 | 3300048915 | Unclassified | 1116 |
| 561 | Ga0496112_0605150 | 3300048915 | Unclassified | 1028 |
| 562 | Ga0496114_0070039 | 3300048917 | Unclassified | 2945 |
| 563 | Ga0496114_0180199 | 3300048917 | Bacteria | 1845 |
| 564 | Ga0496114_0514507 | 3300048917 | Unclassified | 1059 |
| 565 | Ga0496115_0034988 | 3300048918 | Bacteria | 3972 |
| 566 | Ga0496115_0075949 | 3300048918 | Unclassified | 2731 |
| 567 | Ga0496115_0206830 | 3300048918 | Unclassified | 1621 |
| 568 | nmdc:mga05p37_38407_c1 | 3300050507 | Bacteria | 5872 |
| 569 | nmdc:mga05p37_740629_c1 | 3300050507 | Unclassified | 1085 |
| 570 | nmdc:mga08y16_423464_c1 | 3300050511 | Unclassified | 1360 |
| 571 | nmdc:mga0n895_314015_c1 | 3300050512 | Bacteria | 1588 |
| 572 | nmdc:mga08x19_80221_c1 | 3300050514 | Bacteria | 2141 |
| 573 | Ga0495595_0076554 | 3300053084 | Bacteria | 1588 |
| 574 | Ga0495595_0607315 | 3300053084 | Unclassified | 559 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025939 | Ga0207665_10126526 | Ga0207665_101265262 | 150 |
| 2 | 3300005434 | Ga0070709_10301815 | Ga0070709_103018152 | 151 |
| 3 | 3300005536 | Ga0070697_100280190 | Ga0070697_1002801902 | 151 |
| 4 | 3300006028 | Ga0070717_10294897 | Ga0070717_102948972 | 151 |
| 5 | 3300047321 | Ga0495676_0910583 | Ga0495676_0910583_11_466 | 151 |
| 6 | 3300006175 | Ga0070712_100393987 | Ga0070712_1003939872 | 152 |
| 7 | 3300025915 | Ga0207693_10080040 | Ga0207693_100800402 | 152 |
| 8 | 3300025928 | Ga0207700_10238363 | Ga0207700_102383632 | 152 |
| 9 | 3300038443 | Ga0395901_0166012 | Ga0395901_0166012_239_790 | 152 |
| 10 | 3300025915 | Ga0207693_10127633 | Ga0207693_101276332 | 153 |
| 11 | 3300006163 | Ga0070715_10017096 | Ga0070715_100170963 | 154 |
| 12 | 3300006175 | Ga0070712_100030859 | Ga0070712_1000308593 | 154 |
| 13 | 3300025905 | Ga0207685_10027122 | Ga0207685_100271222 | 154 |
| 14 | 3300025915 | Ga0207693_10033901 | Ga0207693_100339013 | 154 |
| 15 | 3300005471 | Ga0070698_101420691 | Ga0070698_1014206911 | 156 |
| 16 | 3300005436 | Ga0070713_101132471 | Ga0070713_1011324711 | 157 |
| 17 | 3300005467 | Ga0070706_100118702 | Ga0070706_1001187022 | 157 |
| 18 | 3300006028 | Ga0070717_10007985 | Ga0070717_100079854 | 157 |
| 19 | 3300025910 | Ga0207684_10015808 | Ga0207684_100158087 | 157 |
| 20 | 3300005468 | Ga0070707_100014650 | Ga0070707_1000146505 | 158 |
| 21 | 3300005471 | Ga0070698_100235273 | Ga0070698_1002352732 | 158 |
| 22 | 3300005536 | Ga0070697_100000889 | Ga0070697_1000008899 | 158 |
| 23 | 3300006028 | Ga0070717_10247184 | Ga0070717_102471841 | 158 |
| 24 | 3300025922 | Ga0207646_10072396 | Ga0207646_100723962 | 158 |
| 25 | 3300025929 | Ga0207664_10153692 | Ga0207664_101536922 | 158 |
| 26 | 3300046675 | Ga0495657_0365481 | Ga0495657_0365481_331_807 | 158 |
| 27 | 3300048917 | Ga0496114_0514507 | Ga0496114_0514507_561_1037 | 158 |
| 28 | 3300053084 | Ga0495595_0607315 | Ga0495595_0607315_31_507 | 158 |
| 29 | 3300025928 | Ga0207700_10744610 | Ga0207700_107446101 | 161 |
| 30 | 3300048913 | Ga0496110_0558374 | Ga0496110_0558374_391_918 | 163 |
| 31 | 3300048914 | Ga0496111_0652138 | Ga0496111_0652138_221_748 | 163 |
| 32 | 3300048918 | Ga0496115_0034988 | Ga0496115_0034988_2461_2988 | 163 |
| 33 | 3300035172 | Ga0373955_0628350 | Ga0373955_0628350_23_517 | 164 |
| 34 | 3300005468 | Ga0070707_100185269 | Ga0070707_1001852692 | 169 |
| 35 | 3300025922 | Ga0207646_10179174 | Ga0207646_101791742 | 169 |
| 36 | 3300037312 | Ga0395899_0068396 | Ga0395899_0068396_1893_2420 | 170 |
| 37 | 3300037466 | Ga0395898_0026578 | Ga0395898_0026578_5251_5778 | 170 |
| 38 | 3300037471 | Ga0395905_0136986 | Ga0395905_0136986_595_1122 | 170 |
| 39 | 3300038443 | Ga0395901_0001233 | Ga0395901_0001233_25738_26265 | 170 |
| 40 | 3300005518 | Ga0070699_100111344 | Ga0070699_1001113442 | 171 |
| 41 | 3300005293 | Ga0065715_10000207 | Ga0065715_1000020728 | 172 |
| 42 | 3300005440 | Ga0070705_100037428 | Ga0070705_1000374284 | 172 |
| 43 | 3300005937 | Ga0081455_10041812 | Ga0081455_100418125 | 172 |
| 44 | 3300013296 | Ga0157374_11293480 | Ga0157374_112934802 | 172 |
| 45 | 3300005436 | Ga0070713_100220092 | Ga0070713_1002200922 | 173 |
| 46 | 3300005290 | Ga0065712_10000743 | Ga0065712_100007438 | 174 |
| 47 | 3300005293 | Ga0065715_10000498 | Ga0065715_1000049810 | 174 |
| 48 | 3300005340 | Ga0070689_100062492 | Ga0070689_1000624923 | 174 |
| 49 | 3300005445 | Ga0070708_100088506 | Ga0070708_1000885063 | 174 |
| 50 | 3300005467 | Ga0070706_100000339 | Ga0070706_10000033936 | 174 |
| 51 | 3300005467 | Ga0070706_100013153 | Ga0070706_1000131535 | 174 |
| 52 | 3300005468 | Ga0070707_100186156 | Ga0070707_1001861562 | 174 |
| 53 | 3300005471 | Ga0070698_100180108 | Ga0070698_1001801082 | 174 |
| 54 | 3300005471 | Ga0070698_100361636 | Ga0070698_1003616362 | 174 |
| 55 | 3300005518 | Ga0070699_100544001 | Ga0070699_1005440012 | 174 |
| 56 | 3300006175 | Ga0070712_100063004 | Ga0070712_1000630042 | 174 |
| 57 | 3300014325 | Ga0163163_10311040 | Ga0163163_103110402 | 174 |
| 58 | 3300014968 | Ga0157379_10145567 | Ga0157379_101455672 | 174 |
| 59 | 3300025900 | Ga0207710_10170959 | Ga0207710_101709591 | 174 |
| 60 | 3300025910 | Ga0207684_10000276 | Ga0207684_1000027623 | 174 |
| 61 | 3300025910 | Ga0207684_10011637 | Ga0207684_100116376 | 174 |
| 62 | 3300025915 | Ga0207693_10057166 | Ga0207693_100571663 | 174 |
| 63 | 3300025922 | Ga0207646_10067553 | Ga0207646_100675534 | 174 |
| 64 | 3300025936 | Ga0207670_10333096 | Ga0207670_103330962 | 174 |
| 65 | 3300025939 | Ga0207665_10033284 | Ga0207665_100332842 | 174 |
| 66 | 3300048904 | Ga0496101_0329202 | Ga0496101_0329202_339_890 | 174 |
| 67 | 3300048905 | Ga0496102_0028285 | Ga0496102_0028285_1436_1987 | 174 |
| 68 | 3300048907 | Ga0496104_0064037 | Ga0496104_0064037_1702_2253 | 174 |
| 69 | 3300048908 | Ga0496105_0852123 | Ga0496105_0852123_78_629 | 174 |
| 70 | 3300048911 | Ga0496108_0025515 | Ga0496108_0025515_4043_4594 | 174 |
| 71 | 3300048912 | Ga0496109_0007567 | Ga0496109_0007567_5072_5623 | 174 |
| 72 | 3300048915 | Ga0496112_0034175 | Ga0496112_0034175_2901_3452 | 174 |
| 73 | 3300048918 | Ga0496115_0206830 | Ga0496115_0206830_1040_1591 | 174 |
| 74 | 3300005334 | Ga0068869_100234661 | Ga0068869_1002346612 | 175 |
| 75 | 3300005354 | Ga0070675_100514029 | Ga0070675_1005140291 | 175 |
| 76 | 3300005467 | Ga0070706_100223200 | Ga0070706_1002232002 | 175 |
| 77 | 3300009553 | Ga0105249_10362235 | Ga0105249_103622353 | 175 |
| 78 | 3300013297 | Ga0157378_10052801 | Ga0157378_100528015 | 175 |
| 79 | 3300025911 | Ga0207654_10056090 | Ga0207654_100560902 | 175 |
| 80 | 3300035089 | Ga0373944_0052727 | Ga0373944_0052727_578_1105 | 175 |
| 81 | 3300035170 | Ga0373943_0267870 | Ga0373943_0267870_33_560 | 175 |
| 82 | 3300035171 | Ga0373946_0094934 | Ga0373946_0094934_622_1149 | 175 |
| 83 | 3300035171 | Ga0373946_0479729 | Ga0373946_0479729_17_544 | 175 |
| 84 | 3300035692 | Ga0373935_0031307 | Ga0373935_0031307_2549_3076 | 175 |
| 85 | 3300035695 | Ga0373927_0215533 | Ga0373927_0215533_226_753 | 175 |
| 86 | 3300035724 | Ga0373933_0082349 | Ga0373933_0082349_227_754 | 175 |
| 87 | 3300035725 | Ga0373947_0132783 | Ga0373947_0132783_227_754 | 175 |
| 88 | 3300035725 | Ga0373947_0186010 | Ga0373947_0186010_351_878 | 175 |
| 89 | 3300035725 | Ga0373947_0476840 | Ga0373947_0476840_128_655 | 175 |
| 90 | 3300037068 | Ga0373925_0027165 | Ga0373925_0027165_2857_3384 | 175 |
| 91 | 3300037068 | Ga0373925_0122764 | Ga0373925_0122764_445_972 | 175 |
| 92 | 3300037312 | Ga0395899_0845924 | Ga0395899_0845924_17_547 | 175 |
| 93 | 3300037418 | Ga0395900_1018914 | Ga0395900_1018914_156_683 | 175 |
| 94 | 3300041496 | Ga0451839_0929501 | Ga0451839_0929501_459_986 | 175 |
| 95 | 3300046459 | Ga0495629_0268043 | Ga0495629_0268043_550_1077 | 175 |
| 96 | 3300046463 | Ga0495653_0250399 | Ga0495653_0250399_478_1005 | 175 |
| 97 | 3300046475 | Ga0495639_0092171 | Ga0495639_0092171_645_1172 | 175 |
| 98 | 3300046499 | Ga0495594_0025738 | Ga0495594_0025738_1489_2016 | 175 |
| 99 | 3300046514 | Ga0495618_0153917 | Ga0495618_0153917_849_1376 | 175 |
| 100 | 3300046537 | Ga0495598_0065016 | Ga0495598_0065016_592_1119 | 175 |
| 101 | 3300046642 | Ga0495634_0619095 | Ga0495634_0619095_37_564 | 175 |
| 102 | 3300046679 | Ga0495623_0185280 | Ga0495623_0185280_489_1016 | 175 |
| 103 | 3300046681 | Ga0495647_0096680 | Ga0495647_0096680_259_786 | 175 |
| 104 | 3300046683 | Ga0495658_0052907 | Ga0495658_0052907_1695_2222 | 175 |
| 105 | 3300046684 | Ga0495669_0046049 | Ga0495669_0046049_102_629 | 175 |
| 106 | 3300046690 | Ga0495624_0176822 | Ga0495624_0176822_324_851 | 175 |
| 107 | 3300046809 | Ga0495600_0578329 | Ga0495600_0578329_22_549 | 175 |
| 108 | 3300047315 | Ga0495581_0065519 | Ga0495581_0065519_1308_1835 | 175 |
| 109 | 3300047319 | Ga0495674_0226158 | Ga0495674_0226158_18_545 | 175 |
| 110 | 3300047673 | Ga0495593_0126960 | Ga0495593_0126960_214_741 | 175 |
| 111 | 3300048906 | Ga0496103_0080463 | Ga0496103_0080463_1420_1947 | 175 |
| 112 | 3300048914 | Ga0496111_0900615 | Ga0496111_0900615_17_544 | 175 |
| 113 | 3300048915 | Ga0496112_0334221 | Ga0496112_0334221_151_678 | 175 |
| 114 | 3300048915 | Ga0496112_0527272 | Ga0496112_0527272_350_877 | 175 |
| 115 | 3300048915 | Ga0496112_0605150 | Ga0496112_0605150_417_944 | 175 |
| 116 | 3300053084 | Ga0495595_0076554 | Ga0495595_0076554_1043_1570 | 175 |
| 117 | 3300005445 | Ga0070708_100305570 | Ga0070708_1003055702 | 176 |
| 118 | 3300017792 | Ga0163161_10530323 | Ga0163161_105303231 | 176 |
| 119 | 3300002070 | JGI24750J21931_1012519 | JGI24750J21931_10125192 | 177 |
| 120 | 3300002126 | JGI24035J26624_1002889 | JGI24035J26624_10028892 | 177 |
| 121 | 3300005328 | Ga0070676_10015061 | Ga0070676_100150611 | 177 |
| 122 | 3300005334 | Ga0068869_100010782 | Ga0068869_1000107823 | 177 |
| 123 | 3300005338 | Ga0068868_100156181 | Ga0068868_1001561812 | 177 |
| 124 | 3300005339 | Ga0070660_100109381 | Ga0070660_1001093812 | 177 |
| 125 | 3300005340 | Ga0070689_100014684 | Ga0070689_1000146846 | 177 |
| 126 | 3300005343 | Ga0070687_100015846 | Ga0070687_1000158462 | 177 |
| 127 | 3300005347 | Ga0070668_100013399 | Ga0070668_1000133992 | 177 |
| 128 | 3300005353 | Ga0070669_100016524 | Ga0070669_1000165242 | 177 |
| 129 | 3300005354 | Ga0070675_100007020 | Ga0070675_1000070206 | 177 |
| 130 | 3300005366 | Ga0070659_100017051 | Ga0070659_1000170516 | 177 |
| 131 | 3300005367 | Ga0070667_100018582 | Ga0070667_1000185826 | 177 |
| 132 | 3300005437 | Ga0070710_10091139 | Ga0070710_100911392 | 177 |
| 133 | 3300005439 | Ga0070711_100136342 | Ga0070711_1001363423 | 177 |
| 134 | 3300005445 | Ga0070708_100853247 | Ga0070708_1008532471 | 177 |
| 135 | 3300005455 | Ga0070663_100027336 | Ga0070663_1000273364 | 177 |
| 136 | 3300005457 | Ga0070662_100001847 | Ga0070662_1000018475 | 177 |
| 137 | 3300005535 | Ga0070684_100019429 | Ga0070684_1000194295 | 177 |
| 138 | 3300005539 | Ga0068853_101111876 | Ga0068853_1011118761 | 177 |
| 139 | 3300005564 | Ga0070664_100964762 | Ga0070664_1009647621 | 177 |
| 140 | 3300005843 | Ga0068860_100023997 | Ga0068860_1000239972 | 177 |
| 141 | 3300005844 | Ga0068862_100051326 | Ga0068862_1000513265 | 177 |
| 142 | 3300005983 | Ga0081540_1105686 | Ga0081540_11056862 | 177 |
| 143 | 3300006163 | Ga0070715_10298201 | Ga0070715_102982012 | 177 |
| 144 | 3300006175 | Ga0070712_100040418 | Ga0070712_1000404183 | 177 |
| 145 | 3300006852 | Ga0075433_10892098 | Ga0075433_108920981 | 177 |
| 146 | 3300009093 | Ga0105240_10808136 | Ga0105240_108081362 | 177 |
| 147 | 3300009098 | Ga0105245_10094451 | Ga0105245_100944512 | 177 |
| 148 | 3300009148 | Ga0105243_10893895 | Ga0105243_108938951 | 177 |
| 149 | 3300009545 | Ga0105237_10951825 | Ga0105237_109518252 | 177 |
| 150 | 3300009553 | Ga0105249_10030100 | Ga0105249_100301005 | 177 |
| 151 | 3300010375 | Ga0105239_10011346 | Ga0105239_100113467 | 177 |
| 152 | 3300011119 | Ga0105246_10070808 | Ga0105246_100708082 | 177 |
| 153 | 3300013296 | Ga0157374_10018203 | Ga0157374_100182035 | 177 |
| 154 | 3300013297 | Ga0157378_10197829 | Ga0157378_101978294 | 177 |
| 155 | 3300013306 | Ga0163162_10010679 | Ga0163162_100106796 | 177 |
| 156 | 3300013308 | Ga0157375_11078286 | Ga0157375_110782862 | 177 |
| 157 | 3300014325 | Ga0163163_10231397 | Ga0163163_102313972 | 177 |
| 158 | 3300025315 | Ga0207697_10002609 | Ga0207697_100026096 | 177 |
| 159 | 3300025901 | Ga0207688_10207565 | Ga0207688_102075652 | 177 |
| 160 | 3300025904 | Ga0207647_10150291 | Ga0207647_101502912 | 177 |
| 161 | 3300025907 | Ga0207645_10007044 | Ga0207645_100070446 | 177 |
| 162 | 3300025914 | Ga0207671_10533735 | Ga0207671_105337352 | 177 |
| 163 | 3300025915 | Ga0207693_10004040 | Ga0207693_100040409 | 177 |
| 164 | 3300025915 | Ga0207693_10142275 | Ga0207693_101422751 | 177 |
| 165 | 3300025916 | Ga0207663_10630892 | Ga0207663_106308922 | 177 |
| 166 | 3300025918 | Ga0207662_10006705 | Ga0207662_100067052 | 177 |
| 167 | 3300025919 | Ga0207657_10043454 | Ga0207657_100434544 | 177 |
| 168 | 3300025920 | Ga0207649_10019808 | Ga0207649_100198083 | 177 |
| 169 | 3300025923 | Ga0207681_10004121 | Ga0207681_100041217 | 177 |
| 170 | 3300025926 | Ga0207659_10147386 | Ga0207659_101473863 | 177 |
| 171 | 3300025927 | Ga0207687_10204868 | Ga0207687_102048682 | 177 |
| 172 | 3300025933 | Ga0207706_10002099 | Ga0207706_1000209914 | 177 |
| 173 | 3300025936 | Ga0207670_10209018 | Ga0207670_102090181 | 177 |
| 174 | 3300025942 | Ga0207689_10038227 | Ga0207689_100382274 | 177 |
| 175 | 3300025945 | Ga0207679_11120282 | Ga0207679_111202821 | 177 |
| 176 | 3300025961 | Ga0207712_10026166 | Ga0207712_100261662 | 177 |
| 177 | 3300025972 | Ga0207668_10009977 | Ga0207668_100099776 | 177 |
| 178 | 3300025986 | Ga0207658_10017925 | Ga0207658_100179255 | 177 |
| 179 | 3300026023 | Ga0207677_10132978 | Ga0207677_101329782 | 177 |
| 180 | 3300026067 | Ga0207678_10021102 | Ga0207678_100211025 | 177 |
| 181 | 3300028381 | Ga0268264_10119843 | Ga0268264_101198431 | 177 |
| 182 | 3300045051 | Ga0451576_0025769 | Ga0451576_0025769_532_1083 | 177 |
| 183 | 3300014745 | Ga0157377_10338359 | Ga0157377_103383592 | 178 |
| 184 | 3300050512 | nmdc:mga0n895_314015_c1 | nmdc:mga0n895_314015_c1_638_1195 | 178 |
| 185 | 3300005272 | Ga0065703_1019677 | Ga0065703_10196773 | 179 |
| 186 | 3300006175 | Ga0070712_101009824 | Ga0070712_1010098242 | 179 |
| 187 | 3300013100 | Ga0157373_10793866 | Ga0157373_107938662 | 179 |
| 188 | 3300035170 | Ga0373943_0249618 | Ga0373943_0249618_17_559 | 179 |
| 189 | 3300046674 | Ga0495588_0540922 | Ga0495588_0540922_16_558 | 179 |
| 190 | 3300048915 | Ga0496112_0305463 | Ga0496112_0305463_531_1073 | 179 |
| 191 | 3300039450 | Ga0436363_1341675 | Ga0436363_1341675_307_849 | 180 |
| 192 | 3300000545 | CNXas_1000045 | CNXas_10000453 | 181 |
| 193 | 3300005340 | Ga0070689_101412422 | Ga0070689_1014124221 | 181 |
| 194 | 3300005457 | Ga0070662_100726232 | Ga0070662_1007262322 | 181 |
| 195 | 3300006881 | Ga0068865_100257833 | Ga0068865_1002578332 | 181 |
| 196 | 3300009098 | Ga0105245_11406218 | Ga0105245_114062181 | 181 |
| 197 | 3300014969 | Ga0157376_10087782 | Ga0157376_100877824 | 181 |
| 198 | 3300037068 | Ga0373925_0629881 | Ga0373925_0629881_80_628 | 181 |
| 199 | 3300001979 | JGI24740J21852_10018550 | JGI24740J21852_100185501 | 182 |
| 200 | 3300001991 | JGI24743J22301_10002352 | JGI24743J22301_100023523 | 182 |
| 201 | 3300005290 | Ga0065712_10003030 | Ga0065712_100030308 | 182 |
| 202 | 3300005293 | Ga0065715_10001221 | Ga0065715_100012218 | 182 |
| 203 | 3300005329 | Ga0070683_100001160 | Ga0070683_1000011603 | 182 |
| 204 | 3300005335 | Ga0070666_10045106 | Ga0070666_100451063 | 182 |
| 205 | 3300005336 | Ga0070680_100028050 | Ga0070680_1000280504 | 182 |
| 206 | 3300005338 | Ga0068868_100020457 | Ga0068868_1000204575 | 182 |
| 207 | 3300005354 | Ga0070675_100141747 | Ga0070675_1001417474 | 182 |
| 208 | 3300005355 | Ga0070671_100380069 | Ga0070671_1003800692 | 182 |
| 209 | 3300005364 | Ga0070673_100072780 | Ga0070673_1000727804 | 182 |
| 210 | 3300005436 | Ga0070713_100034708 | Ga0070713_1000347085 | 182 |
| 211 | 3300005437 | Ga0070710_10047448 | Ga0070710_100474482 | 182 |
| 212 | 3300005455 | Ga0070663_100030086 | Ga0070663_1000300862 | 182 |
| 213 | 3300005456 | Ga0070678_100018503 | Ga0070678_1000185032 | 182 |
| 214 | 3300005458 | Ga0070681_10007306 | Ga0070681_100073068 | 182 |
| 215 | 3300005466 | Ga0070685_10083892 | Ga0070685_100838922 | 182 |
| 216 | 3300005468 | Ga0070707_101086040 | Ga0070707_1010860402 | 182 |
| 217 | 3300005530 | Ga0070679_100134560 | Ga0070679_1001345604 | 182 |
| 218 | 3300005535 | Ga0070684_100022922 | Ga0070684_1000229221 | 182 |
| 219 | 3300005547 | Ga0070693_100439785 | Ga0070693_1004397852 | 182 |
| 220 | 3300005548 | Ga0070665_100033252 | Ga0070665_1000332521 | 182 |
| 221 | 3300005614 | Ga0068856_100204964 | Ga0068856_1002049642 | 182 |
| 222 | 3300005843 | Ga0068860_100676602 | Ga0068860_1006766022 | 182 |
| 223 | 3300006028 | Ga0070717_10002989 | Ga0070717_100029896 | 182 |
| 224 | 3300006028 | Ga0070717_10028994 | Ga0070717_100289945 | 182 |
| 225 | 3300006237 | Ga0097621_100035590 | Ga0097621_1000355902 | 182 |
| 226 | 3300006358 | Ga0068871_100083945 | Ga0068871_1000839453 | 182 |
| 227 | 3300009098 | Ga0105245_10296930 | Ga0105245_102969302 | 182 |
| 228 | 3300009101 | Ga0105247_10481337 | Ga0105247_104813372 | 182 |
| 229 | 3300009174 | Ga0105241_10112915 | Ga0105241_101129152 | 182 |
| 230 | 3300009177 | Ga0105248_10676437 | Ga0105248_106764371 | 182 |
| 231 | 3300013102 | Ga0157371_10120829 | Ga0157371_101208292 | 182 |
| 232 | 3300013104 | Ga0157370_10138585 | Ga0157370_101385852 | 182 |
| 233 | 3300013105 | Ga0157369_10029470 | Ga0157369_1002947010 | 182 |
| 234 | 3300013296 | Ga0157374_10043729 | Ga0157374_100437293 | 182 |
| 235 | 3300013297 | Ga0157378_10831336 | Ga0157378_108313362 | 182 |
| 236 | 3300013307 | Ga0157372_10146547 | Ga0157372_101465472 | 182 |
| 237 | 3300013308 | Ga0157375_10018938 | Ga0157375_100189385 | 182 |
| 238 | 3300014969 | Ga0157376_10898592 | Ga0157376_108985922 | 182 |
| 239 | 3300025315 | Ga0207697_10007405 | Ga0207697_100074055 | 182 |
| 240 | 3300025901 | Ga0207688_10115308 | Ga0207688_101153082 | 182 |
| 241 | 3300025903 | Ga0207680_10176824 | Ga0207680_101768242 | 182 |
| 242 | 3300025912 | Ga0207707_10048004 | Ga0207707_100480043 | 182 |
| 243 | 3300025917 | Ga0207660_10104664 | Ga0207660_101046643 | 182 |
| 244 | 3300025921 | Ga0207652_10018051 | Ga0207652_100180514 | 182 |
| 245 | 3300025922 | Ga0207646_10781003 | Ga0207646_107810032 | 182 |
| 246 | 3300025926 | Ga0207659_10157156 | Ga0207659_101571562 | 182 |
| 247 | 3300025927 | Ga0207687_10169395 | Ga0207687_101693952 | 182 |
| 248 | 3300025928 | Ga0207700_10342903 | Ga0207700_103429032 | 182 |
| 249 | 3300025929 | Ga0207664_10216193 | Ga0207664_102161932 | 182 |
| 250 | 3300025931 | Ga0207644_10065887 | Ga0207644_100658872 | 182 |
| 251 | 3300025941 | Ga0207711_10739115 | Ga0207711_107391152 | 182 |
| 252 | 3300025942 | Ga0207689_10241008 | Ga0207689_102410082 | 182 |
| 253 | 3300025944 | Ga0207661_10016865 | Ga0207661_100168656 | 182 |
| 254 | 3300025945 | Ga0207679_10410843 | Ga0207679_104108432 | 182 |
| 255 | 3300025960 | Ga0207651_10032291 | Ga0207651_100322914 | 182 |
| 256 | 3300026023 | Ga0207677_10011998 | Ga0207677_100119985 | 182 |
| 257 | 3300026078 | Ga0207702_10135196 | Ga0207702_101351963 | 182 |
| 258 | 3300026121 | Ga0207683_10240052 | Ga0207683_102400522 | 182 |
| 259 | 3300028379 | Ga0268266_10046725 | Ga0268266_100467253 | 182 |
| 260 | 3300046463 | Ga0495653_0389325 | Ga0495653_0389325_118_666 | 182 |
| 261 | 3300046517 | Ga0495630_0078442 | Ga0495630_0078442_318_866 | 182 |
| 262 | 3300046642 | Ga0495634_0334744 | Ga0495634_0334744_21_569 | 182 |
| 263 | 3300048903 | Ga0496100_0205696 | Ga0496100_0205696_809_1357 | 182 |
| 264 | 3300048908 | Ga0496105_0175184 | Ga0496105_0175184_117_665 | 182 |
| 265 | 3300048917 | Ga0496114_0070039 | Ga0496114_0070039_1033_1581 | 182 |
| 266 | 3300048918 | Ga0496115_0075949 | Ga0496115_0075949_1104_1652 | 182 |
| 267 | 2162886006 | SwRhRL3b_contig_693613 | SwRhRL3b_0949.00000280 | 183 |
| 268 | 3300002126 | JGI24035J26624_1003259 | JGI24035J26624_10032592 | 183 |
| 269 | 3300003203 | JGI25406J46586_10000001 | JGI25406J46586_10000001168 | 183 |
| 270 | 3300003203 | JGI25406J46586_10000007 | JGI25406J46586_10000007105 | 183 |
| 271 | 3300003911 | JGI25405J52794_10000331 | JGI25405J52794_100003319 | 183 |
| 272 | 3300003911 | JGI25405J52794_10001309 | JGI25405J52794_100013095 | 183 |
| 273 | 3300005289 | Ga0065704_10029589 | Ga0065704_100295891 | 183 |
| 274 | 3300005290 | Ga0065712_10007741 | Ga0065712_100077412 | 183 |
| 275 | 3300005293 | Ga0065715_10008852 | Ga0065715_100088524 | 183 |
| 276 | 3300005293 | Ga0065715_10010129 | Ga0065715_100101292 | 183 |
| 277 | 3300005293 | Ga0065715_10010802 | Ga0065715_100108024 | 183 |
| 278 | 3300005293 | Ga0065715_10143106 | Ga0065715_101431062 | 183 |
| 279 | 3300005293 | Ga0065715_10307833 | Ga0065715_103078332 | 183 |
| 280 | 3300005293 | Ga0065715_10435794 | Ga0065715_104357941 | 183 |
| 281 | 3300005295 | Ga0065707_10022448 | Ga0065707_100224483 | 183 |
| 282 | 3300005295 | Ga0065707_10186400 | Ga0065707_101864002 | 183 |
| 283 | 3300005327 | Ga0070658_10181132 | Ga0070658_101811322 | 183 |
| 284 | 3300005328 | Ga0070676_10077478 | Ga0070676_100774782 | 183 |
| 285 | 3300005328 | Ga0070676_10480469 | Ga0070676_104804691 | 183 |
| 286 | 3300005329 | Ga0070683_100221816 | Ga0070683_1002218162 | 183 |
| 287 | 3300005330 | Ga0070690_100002449 | Ga0070690_1000024495 | 183 |
| 288 | 3300005330 | Ga0070690_100032220 | Ga0070690_1000322203 | 183 |
| 289 | 3300005333 | Ga0070677_10030267 | Ga0070677_100302672 | 183 |
| 290 | 3300005335 | Ga0070666_10202014 | Ga0070666_102020142 | 183 |
| 291 | 3300005338 | Ga0068868_100191396 | Ga0068868_1001913961 | 183 |
| 292 | 3300005340 | Ga0070689_100002648 | Ga0070689_10000264813 | 183 |
| 293 | 3300005345 | Ga0070692_10169313 | Ga0070692_101693132 | 183 |
| 294 | 3300005347 | Ga0070668_100019031 | Ga0070668_1000190312 | 183 |
| 295 | 3300005353 | Ga0070669_100017297 | Ga0070669_1000172976 | 183 |
| 296 | 3300005354 | Ga0070675_100009289 | Ga0070675_1000092895 | 183 |
| 297 | 3300005354 | Ga0070675_100060920 | Ga0070675_1000609204 | 183 |
| 298 | 3300005354 | Ga0070675_100195249 | Ga0070675_1001952492 | 183 |
| 299 | 3300005355 | Ga0070671_100462105 | Ga0070671_1004621052 | 183 |
| 300 | 3300005355 | Ga0070671_100674109 | Ga0070671_1006741091 | 183 |
| 301 | 3300005355 | Ga0070671_100989732 | Ga0070671_1009897321 | 183 |
| 302 | 3300005356 | Ga0070674_100000780 | Ga0070674_1000007805 | 183 |
| 303 | 3300005364 | Ga0070673_100014849 | Ga0070673_1000148493 | 183 |
| 304 | 3300005365 | Ga0070688_100003944 | Ga0070688_1000039446 | 183 |
| 305 | 3300005366 | Ga0070659_100146967 | Ga0070659_1001469673 | 183 |
| 306 | 3300005367 | Ga0070667_100026680 | Ga0070667_1000266804 | 183 |
| 307 | 3300005434 | Ga0070709_10009751 | Ga0070709_100097515 | 183 |
| 308 | 3300005434 | Ga0070709_10602243 | Ga0070709_106022431 | 183 |
| 309 | 3300005435 | Ga0070714_100030203 | Ga0070714_1000302032 | 183 |
| 310 | 3300005435 | Ga0070714_100138478 | Ga0070714_1001384782 | 183 |
| 311 | 3300005435 | Ga0070714_100237878 | Ga0070714_1002378783 | 183 |
| 312 | 3300005436 | Ga0070713_100004806 | Ga0070713_1000048063 | 183 |
| 313 | 3300005436 | Ga0070713_100159196 | Ga0070713_1001591962 | 183 |
| 314 | 3300005436 | Ga0070713_100628440 | Ga0070713_1006284402 | 183 |
| 315 | 3300005437 | Ga0070710_10050623 | Ga0070710_100506233 | 183 |
| 316 | 3300005439 | Ga0070711_100012285 | Ga0070711_1000122852 | 183 |
| 317 | 3300005440 | Ga0070705_100024037 | Ga0070705_1000240373 | 183 |
| 318 | 3300005440 | Ga0070705_100055659 | Ga0070705_1000556594 | 183 |
| 319 | 3300005441 | Ga0070700_100192845 | Ga0070700_1001928452 | 183 |
| 320 | 3300005445 | Ga0070708_100029555 | Ga0070708_1000295553 | 183 |
| 321 | 3300005445 | Ga0070708_100120626 | Ga0070708_1001206262 | 183 |
| 322 | 3300005445 | Ga0070708_100158335 | Ga0070708_1001583353 | 183 |
| 323 | 3300005445 | Ga0070708_100167112 | Ga0070708_1001671122 | 183 |
| 324 | 3300005445 | Ga0070708_100274466 | Ga0070708_1002744662 | 183 |
| 325 | 3300005445 | Ga0070708_100516602 | Ga0070708_1005166022 | 183 |
| 326 | 3300005457 | Ga0070662_100120079 | Ga0070662_1001200793 | 183 |
| 327 | 3300005458 | Ga0070681_11092852 | Ga0070681_110928522 | 183 |
| 328 | 3300005466 | Ga0070685_10072563 | Ga0070685_100725632 | 183 |
| 329 | 3300005467 | Ga0070706_100013001 | Ga0070706_1000130014 | 183 |
| 330 | 3300005467 | Ga0070706_100081435 | Ga0070706_1000814352 | 183 |
| 331 | 3300005467 | Ga0070706_100101407 | Ga0070706_1001014072 | 183 |
| 332 | 3300005467 | Ga0070706_100491390 | Ga0070706_1004913901 | 183 |
| 333 | 3300005467 | Ga0070706_100839690 | Ga0070706_1008396902 | 183 |
| 334 | 3300005468 | Ga0070707_100002484 | Ga0070707_1000024845 | 183 |
| 335 | 3300005468 | Ga0070707_100006579 | Ga0070707_1000065793 | 183 |
| 336 | 3300005468 | Ga0070707_100011119 | Ga0070707_1000111195 | 183 |
| 337 | 3300005468 | Ga0070707_100016462 | Ga0070707_1000164627 | 183 |
| 338 | 3300005468 | Ga0070707_100232250 | Ga0070707_1002322501 | 183 |
| 339 | 3300005471 | Ga0070698_100012903 | Ga0070698_1000129034 | 183 |
| 340 | 3300005471 | Ga0070698_100044664 | Ga0070698_1000446642 | 183 |
| 341 | 3300005471 | Ga0070698_100058377 | Ga0070698_1000583774 | 183 |
| 342 | 3300005471 | Ga0070698_100370848 | Ga0070698_1003708483 | 183 |
| 343 | 3300005518 | Ga0070699_100017866 | Ga0070699_1000178663 | 183 |
| 344 | 3300005518 | Ga0070699_100265497 | Ga0070699_1002654972 | 183 |
| 345 | 3300005518 | Ga0070699_100415799 | Ga0070699_1004157992 | 183 |
| 346 | 3300005518 | Ga0070699_101103655 | Ga0070699_1011036551 | 183 |
| 347 | 3300005535 | Ga0070684_100000906 | Ga0070684_10000090610 | 183 |
| 348 | 3300005535 | Ga0070684_100103646 | Ga0070684_1001036462 | 183 |
| 349 | 3300005536 | Ga0070697_100015146 | Ga0070697_1000151462 | 183 |
| 350 | 3300005536 | Ga0070697_100021041 | Ga0070697_1000210414 | 183 |
| 351 | 3300005536 | Ga0070697_100027961 | Ga0070697_1000279615 | 183 |
| 352 | 3300005536 | Ga0070697_100028727 | Ga0070697_1000287275 | 183 |
| 353 | 3300005536 | Ga0070697_100034881 | Ga0070697_1000348816 | 183 |
| 354 | 3300005536 | Ga0070697_100040378 | Ga0070697_1000403785 | 183 |
| 355 | 3300005536 | Ga0070697_100096273 | Ga0070697_1000962732 | 183 |
| 356 | 3300005536 | Ga0070697_100147317 | Ga0070697_1001473172 | 183 |
| 357 | 3300005536 | Ga0070697_100332579 | Ga0070697_1003325792 | 183 |
| 358 | 3300005543 | Ga0070672_100074720 | Ga0070672_1000747201 | 183 |
| 359 | 3300005543 | Ga0070672_100223865 | Ga0070672_1002238652 | 183 |
| 360 | 3300005544 | Ga0070686_100139294 | Ga0070686_1001392942 | 183 |
| 361 | 3300005548 | Ga0070665_100118510 | Ga0070665_1001185102 | 183 |
| 362 | 3300005548 | Ga0070665_100693235 | Ga0070665_1006932352 | 183 |
| 363 | 3300005549 | Ga0070704_100013053 | Ga0070704_1000130532 | 183 |
| 364 | 3300005549 | Ga0070704_100057908 | Ga0070704_1000579082 | 183 |
| 365 | 3300005578 | Ga0068854_101200740 | Ga0068854_1012007402 | 183 |
| 366 | 3300005614 | Ga0068856_100394941 | Ga0068856_1003949412 | 183 |
| 367 | 3300005616 | Ga0068852_100578260 | Ga0068852_1005782601 | 183 |
| 368 | 3300005618 | Ga0068864_100105926 | Ga0068864_1001059263 | 183 |
| 369 | 3300005718 | Ga0068866_10089768 | Ga0068866_100897682 | 183 |
| 370 | 3300005842 | Ga0068858_100294132 | Ga0068858_1002941322 | 183 |
| 371 | 3300005842 | Ga0068858_100702051 | Ga0068858_1007020512 | 183 |
| 372 | 3300005843 | Ga0068860_100012546 | Ga0068860_1000125464 | 183 |
| 373 | 3300005843 | Ga0068860_100242077 | Ga0068860_1002420772 | 183 |
| 374 | 3300005844 | Ga0068862_100633512 | Ga0068862_1006335122 | 183 |
| 375 | 3300005937 | Ga0081455_10000314 | Ga0081455_1000031447 | 183 |
| 376 | 3300005937 | Ga0081455_10000959 | Ga0081455_1000095915 | 183 |
| 377 | 3300005937 | Ga0081455_10005232 | Ga0081455_1000523214 | 183 |
| 378 | 3300005937 | Ga0081455_10015384 | Ga0081455_100153844 | 183 |
| 379 | 3300005937 | Ga0081455_10049009 | Ga0081455_100490092 | 183 |
| 380 | 3300005983 | Ga0081540_1000016 | Ga0081540_100001611 | 183 |
| 381 | 3300005983 | Ga0081540_1024398 | Ga0081540_10243982 | 183 |
| 382 | 3300005985 | Ga0081539_10000014 | Ga0081539_10000014274 | 183 |
| 383 | 3300005985 | Ga0081539_10036270 | Ga0081539_100362702 | 183 |
| 384 | 3300006028 | Ga0070717_10037682 | Ga0070717_100376822 | 183 |
| 385 | 3300006028 | Ga0070717_10154153 | Ga0070717_101541532 | 183 |
| 386 | 3300006028 | Ga0070717_10827050 | Ga0070717_108270502 | 183 |
| 387 | 3300006163 | Ga0070715_10214124 | Ga0070715_102141241 | 183 |
| 388 | 3300006173 | Ga0070716_100039273 | Ga0070716_1000392732 | 183 |
| 389 | 3300006173 | Ga0070716_100071576 | Ga0070716_1000715762 | 183 |
| 390 | 3300006173 | Ga0070716_100375522 | Ga0070716_1003755222 | 183 |
| 391 | 3300006173 | Ga0070716_101183426 | Ga0070716_1011834261 | 183 |
| 392 | 3300006175 | Ga0070712_100070560 | Ga0070712_1000705602 | 183 |
| 393 | 3300006175 | Ga0070712_100081693 | Ga0070712_1000816932 | 183 |
| 394 | 3300006175 | Ga0070712_100130567 | Ga0070712_1001305673 | 183 |
| 395 | 3300006175 | Ga0070712_101074313 | Ga0070712_1010743132 | 183 |
| 396 | 3300006175 | Ga0070712_101132725 | Ga0070712_1011327252 | 183 |
| 397 | 3300006871 | Ga0075434_100315802 | Ga0075434_1003158022 | 183 |
| 398 | 3300006881 | Ga0068865_100034788 | Ga0068865_1000347882 | 183 |
| 399 | 3300006914 | Ga0075436_100134397 | Ga0075436_1001343972 | 183 |
| 400 | 3300007265 | Ga0099794_10186454 | Ga0099794_101864542 | 183 |
| 401 | 3300007788 | Ga0099795_10002031 | Ga0099795_100020315 | 183 |
| 402 | 3300007788 | Ga0099795_10007257 | Ga0099795_100072574 | 183 |
| 403 | 3300009094 | Ga0111539_10104757 | Ga0111539_101047572 | 183 |
| 404 | 3300009098 | Ga0105245_10531666 | Ga0105245_105316662 | 183 |
| 405 | 3300009098 | Ga0105245_10966590 | Ga0105245_109665902 | 183 |
| 406 | 3300009147 | Ga0114129_10826009 | Ga0114129_108260092 | 183 |
| 407 | 3300009148 | Ga0105243_10637500 | Ga0105243_106375002 | 183 |
| 408 | 3300009176 | Ga0105242_10116091 | Ga0105242_101160912 | 183 |
| 409 | 3300009176 | Ga0105242_10136501 | Ga0105242_101365011 | 183 |
| 410 | 3300009545 | Ga0105237_10122402 | Ga0105237_101224022 | 183 |
| 411 | 3300009545 | Ga0105237_10889363 | Ga0105237_108893631 | 183 |
| 412 | 3300010159 | Ga0099796_10002908 | Ga0099796_100029082 | 183 |
| 413 | 3300010159 | Ga0099796_10111074 | Ga0099796_101110742 | 183 |
| 414 | 3300012512 | Ga0157327_1004405 | Ga0157327_10044052 | 183 |
| 415 | 3300012515 | Ga0157338_1010564 | Ga0157338_10105642 | 183 |
| 416 | 3300013102 | Ga0157371_10615544 | Ga0157371_106155441 | 183 |
| 417 | 3300013105 | Ga0157369_10515238 | Ga0157369_105152382 | 183 |
| 418 | 3300013296 | Ga0157374_10124964 | Ga0157374_101249643 | 183 |
| 419 | 3300013296 | Ga0157374_10130760 | Ga0157374_101307602 | 183 |
| 420 | 3300013296 | Ga0157374_10176130 | Ga0157374_101761302 | 183 |
| 421 | 3300013296 | Ga0157374_11219120 | Ga0157374_112191202 | 183 |
| 422 | 3300013297 | Ga0157378_10008313 | Ga0157378_100083137 | 183 |
| 423 | 3300013297 | Ga0157378_10849896 | Ga0157378_108498962 | 183 |
| 424 | 3300013297 | Ga0157378_11786480 | Ga0157378_117864801 | 183 |
| 425 | 3300013306 | Ga0163162_10043125 | Ga0163162_100431253 | 183 |
| 426 | 3300013306 | Ga0163162_10202920 | Ga0163162_102029202 | 183 |
| 427 | 3300013306 | Ga0163162_10228506 | Ga0163162_102285062 | 183 |
| 428 | 3300013307 | Ga0157372_10084908 | Ga0157372_100849082 | 183 |
| 429 | 3300013307 | Ga0157372_10152490 | Ga0157372_101524902 | 183 |
| 430 | 3300013308 | Ga0157375_10233657 | Ga0157375_102336573 | 183 |
| 431 | 3300013308 | Ga0157375_10321922 | Ga0157375_103219222 | 183 |
| 432 | 3300013308 | Ga0157375_10571852 | Ga0157375_105718522 | 183 |
| 433 | 3300014325 | Ga0163163_10413183 | Ga0163163_104131832 | 183 |
| 434 | 3300014325 | Ga0163163_10414470 | Ga0163163_104144702 | 183 |
| 435 | 3300014497 | Ga0182008_10026360 | Ga0182008_100263603 | 183 |
| 436 | 3300014969 | Ga0157376_10031020 | Ga0157376_100310205 | 183 |
| 437 | 3300014969 | Ga0157376_10478669 | Ga0157376_104786692 | 183 |
| 438 | 3300015265 | Ga0182005_1010277 | Ga0182005_10102772 | 183 |
| 439 | 3300017792 | Ga0163161_10111116 | Ga0163161_101111164 | 183 |
| 440 | 3300025271 | Ga0207666_1002361 | Ga0207666_10023612 | 183 |
| 441 | 3300025271 | Ga0207666_1036648 | Ga0207666_10366482 | 183 |
| 442 | 3300025290 | Ga0207673_1004308 | Ga0207673_10043082 | 183 |
| 443 | 3300025290 | Ga0207673_1006416 | Ga0207673_10064162 | 183 |
| 444 | 3300025315 | Ga0207697_10000283 | Ga0207697_1000028312 | 183 |
| 445 | 3300025315 | Ga0207697_10000681 | Ga0207697_1000068117 | 183 |
| 446 | 3300025315 | Ga0207697_10006249 | Ga0207697_100062495 | 183 |
| 447 | 3300025315 | Ga0207697_10028652 | Ga0207697_100286522 | 183 |
| 448 | 3300025315 | Ga0207697_10322936 | Ga0207697_103229361 | 183 |
| 449 | 3300025885 | Ga0207653_10015114 | Ga0207653_100151144 | 183 |
| 450 | 3300025893 | Ga0207682_10016117 | Ga0207682_100161174 | 183 |
| 451 | 3300025898 | Ga0207692_10124997 | Ga0207692_101249972 | 183 |
| 452 | 3300025901 | Ga0207688_10002322 | Ga0207688_100023229 | 183 |
| 453 | 3300025904 | Ga0207647_10005474 | Ga0207647_100054745 | 183 |
| 454 | 3300025905 | Ga0207685_10006553 | Ga0207685_100065534 | 183 |
| 455 | 3300025906 | Ga0207699_10027500 | Ga0207699_100275002 | 183 |
| 456 | 3300025907 | Ga0207645_10001228 | Ga0207645_100012285 | 183 |
| 457 | 3300025909 | Ga0207705_10426776 | Ga0207705_104267761 | 183 |
| 458 | 3300025910 | Ga0207684_10019577 | Ga0207684_100195779 | 183 |
| 459 | 3300025910 | Ga0207684_10047164 | Ga0207684_100471642 | 183 |
| 460 | 3300025910 | Ga0207684_10069067 | Ga0207684_100690672 | 183 |
| 461 | 3300025910 | Ga0207684_10082108 | Ga0207684_100821083 | 183 |
| 462 | 3300025910 | Ga0207684_10159963 | Ga0207684_101599634 | 183 |
| 463 | 3300025910 | Ga0207684_10286517 | Ga0207684_102865172 | 183 |
| 464 | 3300025915 | Ga0207693_10040626 | Ga0207693_100406263 | 183 |
| 465 | 3300025915 | Ga0207693_10050893 | Ga0207693_100508932 | 183 |
| 466 | 3300025916 | Ga0207663_10011079 | Ga0207663_100110794 | 183 |
| 467 | 3300025916 | Ga0207663_10040250 | Ga0207663_100402503 | 183 |
| 468 | 3300025918 | Ga0207662_10081717 | Ga0207662_100817172 | 183 |
| 469 | 3300025919 | Ga0207657_10382983 | Ga0207657_103829832 | 183 |
| 470 | 3300025920 | Ga0207649_10369416 | Ga0207649_103694162 | 183 |
| 471 | 3300025922 | Ga0207646_10003213 | Ga0207646_100032135 | 183 |
| 472 | 3300025922 | Ga0207646_10005702 | Ga0207646_100057023 | 183 |
| 473 | 3300025922 | Ga0207646_10021461 | Ga0207646_100214615 | 183 |
| 474 | 3300025922 | Ga0207646_10048382 | Ga0207646_100483822 | 183 |
| 475 | 3300025922 | Ga0207646_10275548 | Ga0207646_102755482 | 183 |
| 476 | 3300025922 | Ga0207646_10824631 | Ga0207646_108246311 | 183 |
| 477 | 3300025923 | Ga0207681_10367123 | Ga0207681_103671232 | 183 |
| 478 | 3300025923 | Ga0207681_11095656 | Ga0207681_110956561 | 183 |
| 479 | 3300025924 | Ga0207694_11139538 | Ga0207694_111395381 | 183 |
| 480 | 3300025925 | Ga0207650_10651867 | Ga0207650_106518672 | 183 |
| 481 | 3300025926 | Ga0207659_10005770 | Ga0207659_100057708 | 183 |
| 482 | 3300025926 | Ga0207659_10005985 | Ga0207659_100059853 | 183 |
| 483 | 3300025926 | Ga0207659_10227596 | Ga0207659_102275962 | 183 |
| 484 | 3300025928 | Ga0207700_10096336 | Ga0207700_100963362 | 183 |
| 485 | 3300025929 | Ga0207664_10126294 | Ga0207664_101262942 | 183 |
| 486 | 3300025929 | Ga0207664_10129312 | Ga0207664_101293122 | 183 |
| 487 | 3300025929 | Ga0207664_10311419 | Ga0207664_103114192 | 183 |
| 488 | 3300025931 | Ga0207644_10155407 | Ga0207644_101554073 | 183 |
| 489 | 3300025931 | Ga0207644_10330899 | Ga0207644_103308992 | 183 |
| 490 | 3300025931 | Ga0207644_10754296 | Ga0207644_107542961 | 183 |
| 491 | 3300025932 | Ga0207690_10091569 | Ga0207690_100915693 | 183 |
| 492 | 3300025933 | Ga0207706_10056139 | Ga0207706_100561394 | 183 |
| 493 | 3300025933 | Ga0207706_10123205 | Ga0207706_101232052 | 183 |
| 494 | 3300025933 | Ga0207706_10124287 | Ga0207706_101242872 | 183 |
| 495 | 3300025933 | Ga0207706_10262968 | Ga0207706_102629683 | 183 |
| 496 | 3300025934 | Ga0207686_10081096 | Ga0207686_100810961 | 183 |
| 497 | 3300025936 | Ga0207670_10005975 | Ga0207670_100059752 | 183 |
| 498 | 3300025937 | Ga0207669_10095655 | Ga0207669_100956552 | 183 |
| 499 | 3300025937 | Ga0207669_10651924 | Ga0207669_106519241 | 183 |
| 500 | 3300025938 | Ga0207704_10109564 | Ga0207704_101095643 | 183 |
| 501 | 3300025939 | Ga0207665_10004405 | Ga0207665_100044058 | 183 |
| 502 | 3300025939 | Ga0207665_10160231 | Ga0207665_101602312 | 183 |
| 503 | 3300025939 | Ga0207665_10242195 | Ga0207665_102421952 | 183 |
| 504 | 3300025939 | Ga0207665_10267526 | Ga0207665_102675262 | 183 |
| 505 | 3300025939 | Ga0207665_10751627 | Ga0207665_107516271 | 183 |
| 506 | 3300025939 | Ga0207665_10956523 | Ga0207665_109565232 | 183 |
| 507 | 3300025940 | Ga0207691_10001630 | Ga0207691_100016305 | 183 |
| 508 | 3300025942 | Ga0207689_10147016 | Ga0207689_101470162 | 183 |
| 509 | 3300025944 | Ga0207661_10431376 | Ga0207661_104313762 | 183 |
| 510 | 3300025945 | Ga0207679_10274705 | Ga0207679_102747052 | 183 |
| 511 | 3300025960 | Ga0207651_10032847 | Ga0207651_100328471 | 183 |
| 512 | 3300025960 | Ga0207651_10118809 | Ga0207651_101188092 | 183 |
| 513 | 3300025972 | Ga0207668_10124106 | Ga0207668_101241062 | 183 |
| 514 | 3300025972 | Ga0207668_10573047 | Ga0207668_105730471 | 183 |
| 515 | 3300025986 | Ga0207658_10130796 | Ga0207658_101307962 | 183 |
| 516 | 3300025986 | Ga0207658_10277751 | Ga0207658_102777512 | 183 |
| 517 | 3300026035 | Ga0207703_10399611 | Ga0207703_103996112 | 183 |
| 518 | 3300026035 | Ga0207703_10810343 | Ga0207703_108103432 | 183 |
| 519 | 3300026067 | Ga0207678_10651110 | Ga0207678_106511102 | 183 |
| 520 | 3300026075 | Ga0207708_10051341 | Ga0207708_100513413 | 183 |
| 521 | 3300026088 | Ga0207641_10158525 | Ga0207641_101585254 | 183 |
| 522 | 3300026089 | Ga0207648_10131171 | Ga0207648_101311711 | 183 |
| 523 | 3300026095 | Ga0207676_10525297 | Ga0207676_105252972 | 183 |
| 524 | 3300026116 | Ga0207674_10510817 | Ga0207674_105108172 | 183 |
| 525 | 3300026118 | Ga0207675_100118653 | Ga0207675_1001186532 | 183 |
| 526 | 3300026121 | Ga0207683_10018640 | Ga0207683_100186407 | 183 |
| 527 | 3300026121 | Ga0207683_10062891 | Ga0207683_100628913 | 183 |
| 528 | 3300026121 | Ga0207683_10266044 | Ga0207683_102660442 | 183 |
| 529 | 3300026142 | Ga0207698_10326781 | Ga0207698_103267812 | 183 |
| 530 | 3300027252 | Ga0209973_1019799 | Ga0209973_10197992 | 183 |
| 531 | 3300027512 | Ga0209179_1012944 | Ga0209179_10129442 | 183 |
| 532 | 3300027617 | Ga0210002_1004868 | Ga0210002_10048682 | 183 |
| 533 | 3300027682 | Ga0209971_1021268 | Ga0209971_10212682 | 183 |
| 534 | 3300027717 | Ga0209998_10011390 | Ga0209998_100113902 | 183 |
| 535 | 3300028379 | Ga0268266_10031046 | Ga0268266_100310462 | 183 |
| 536 | 3300028379 | Ga0268266_10068131 | Ga0268266_100681312 | 183 |
| 537 | 3300028379 | Ga0268266_10111515 | Ga0268266_101115152 | 183 |
| 538 | 3300028381 | Ga0268264_10009325 | Ga0268264_100093254 | 183 |
| 539 | 3300028381 | Ga0268264_10353569 | Ga0268264_103535692 | 183 |
| 540 | 3300035089 | Ga0373944_0079782 | Ga0373944_0079782_89_640 | 183 |
| 541 | 3300035113 | Ga0373936_0303549 | Ga0373936_0303549_142_693 | 183 |
| 542 | 3300035171 | Ga0373946_0015546 | Ga0373946_0015546_1538_2089 | 183 |
| 543 | 3300035691 | Ga0373931_0146795 | Ga0373931_0146795_419_970 | 183 |
| 544 | 3300035695 | Ga0373927_0285902 | Ga0373927_0285902_152_703 | 183 |
| 545 | 3300035725 | Ga0373947_0019989 | Ga0373947_0019989_223_774 | 183 |
| 546 | 3300035725 | Ga0373947_0437293 | Ga0373947_0437293_283_834 | 183 |
| 547 | 3300037068 | Ga0373925_0062700 | Ga0373925_0062700_1209_1760 | 183 |
| 548 | 3300037068 | Ga0373925_0087360 | Ga0373925_0087360_1417_1986 | 183 |
| 549 | 3300037418 | Ga0395900_1043134 | Ga0395900_1043134_67_621 | 183 |
| 550 | 3300037853 | Ga0436364_1130765 | Ga0436364_1130765_268_828 | 183 |
| 551 | 3300038443 | Ga0395901_0957845 | Ga0395901_0957845_230_784 | 183 |
| 552 | 3300041512 | Ga0451853_3717991 | Ga0451853_3717991_386_940 | 183 |
| 553 | 3300046473 | Ga0495582_0038820 | Ga0495582_0038820_2030_2581 | 183 |
| 554 | 3300046476 | Ga0495662_0060765 | Ga0495662_0060765_1230_1781 | 183 |
| 555 | 3300046523 | Ga0495644_0121506 | Ga0495644_0121506_28_579 | 183 |
| 556 | 3300046615 | Ga0495656_0173897 | Ga0495656_0173897_451_1002 | 183 |
| 557 | 3300048903 | Ga0496100_0013450 | Ga0496100_0013450_508_1059 | 183 |
| 558 | 3300048904 | Ga0496101_0030095 | Ga0496101_0030095_2040_2591 | 183 |
| 559 | 3300048905 | Ga0496102_0103744 | Ga0496102_0103744_1451_2002 | 183 |
| 560 | 3300048906 | Ga0496103_0016087 | Ga0496103_0016087_1625_2176 | 183 |
| 561 | 3300048907 | Ga0496104_0186408 | Ga0496104_0186408_1366_1917 | 183 |
| 562 | 3300048908 | Ga0496105_0202510 | Ga0496105_0202510_85_636 | 183 |
| 563 | 3300048909 | Ga0496106_0003614 | Ga0496106_0003614_1799_2350 | 183 |
| 564 | 3300048910 | Ga0496107_0273656 | Ga0496107_0273656_20_571 | 183 |
| 565 | 3300048911 | Ga0496108_0248321 | Ga0496108_0248321_809_1360 | 183 |
| 566 | 3300048913 | Ga0496110_0022586 | Ga0496110_0022586_1403_1954 | 183 |
| 567 | 3300048913 | Ga0496110_0206993 | Ga0496110_0206993_309_860 | 183 |
| 568 | 3300048915 | Ga0496112_0023116 | Ga0496112_0023116_5362_5913 | 183 |
| 569 | 3300048915 | Ga0496112_0265788 | Ga0496112_0265788_1005_1556 | 183 |
| 570 | 3300048917 | Ga0496114_0180199 | Ga0496114_0180199_586_1137 | 183 |
| 571 | 3300050507 | nmdc:mga05p37_38407_c1 | nmdc:mga05p37_38407_c1_4196_4747 | 183 |
| 572 | 3300050507 | nmdc:mga05p37_740629_c1 | nmdc:mga05p37_740629_c1_523_1074 | 183 |
| 573 | 3300050511 | nmdc:mga08y16_423464_c1 | nmdc:mga08y16_423464_c1_139_690 | 183 |
| 574 | 3300050514 | nmdc:mga08x19_80221_c1 | nmdc:mga08x19_80221_c1_1441_2004 | 183 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5uvr-assembly1.cif.gz_A | the core region of pilo from the type iv pilus system of pseudomonas aeruginosa | 0.7486 | 90 | 183 |
| 2rjz-assembly1.cif.gz_B | crystal structure of the type 4 fimbrial biogenesis protein pilo from pseudomonas aeruginosa | 0.7319 | 64 | 177 |
| 2rjz-assembly1.cif.gz_A | crystal structure of the type 4 fimbrial biogenesis protein pilo from pseudomonas aeruginosa | 0.7247 | 64 | 177 |
| 6lad-assembly7.cif.gz_A | crystal structure of amuc_1100 from akkermansia muciniphila | 0.718 | 93 | 183 |
| 5uvr-assembly1.cif.gz_A | the core region of pilo from the type iv pilus system of pseudomonas aeruginosa | 0.7153 | 90 | 183 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2rjzB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B | 0.8472 | 90 | 177 | 3.30.70.60 |
| af_P0ADG1_1_87_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.7876 | 123 | 172 | 3.30.70.260 |
| 2rjzB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B | 0.783 | 90 | 177 | 3.30.70.60 |
| af_Q55EI4_11_156_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.7608 | 84 | 118 | 3.30.300.20 |
| af_P37051_4_77_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.6956 | 123 | 172 | 3.30.70.260 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1CSA1-F1-model_v4 | Uncharacterized protein | 0.9422 | 67 | 183 |
|
| AF-A0A7W1CSA1-F1-model_v4 | Uncharacterized protein | 0.9268 | 67 | 183 |
|
| AF-A0A836SXJ2-F1-model_v4 | Uncharacterized protein | 0.9121 | 81 | 180 |
|
| AF-A0A838N6K8-F1-model_v4 | Type 4a pilus biogenesis protein PilO | 0.8946 | 89 | 180 |
GO:0043107
GO:0043683 |
| AF-A0A496K310-F1-model_v4 | deleted | 0.889 | 95 | 181 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar