F465287

General Info

Members Datasets Scaffolds Average Seq Length
574 251 574 180

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100081435|Ga0070706_1000814352
Length 187
Sequence MKVLTAWIERMNRRERVLSLVIGGLIFGLLNLFIWNWLLGAISVARGELATRQATRKEQAIFMKERPLWAKRDEWLQRHQPVLKNSGEAQTGLLDELKQVASKYDILIENPAIGSGETTLNHQAVFASIETKSPWPPLVHFLYDVQQPDSFIVFEAVNLMIDSSDPTMMRGKFKIARWFAPAQRKKG

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
101 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
206 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.27
Rhizosphere 93.03
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_693613 2162886006 Bacteria 1082
2 CNXas_1000045 3300000545 Bacteria 24810
3 JGI24740J21852_10018550 3300001979 Unclassified 2465
4 JGI24743J22301_10002352 3300001991 Unclassified 2830
5 JGI24750J21931_1012519 3300002070 Bacteria 1126
6 JGI24035J26624_1002889 3300002126 Bacteria 1605
7 JGI24035J26624_1003259 3300002126 Unclassified 1525
8 JGI25406J46586_10000001 3300003203 Bacteria 251772
9 JGI25406J46586_10000007 3300003203 Bacteria 112227
10 JGI25405J52794_10000331 3300003911 Bacteria 6556
11 JGI25405J52794_10001309 3300003911 Unclassified 4059
12 Ga0065703_1019677 3300005272 Bacteria 2562
13 Ga0065704_10029589 3300005289 Unclassified 1125
14 Ga0065712_10000743 3300005290 Bacteria 8391
15 Ga0065712_10003030 3300005290 Bacteria 7040
16 Ga0065712_10007741 3300005290 Unclassified 2344
17 Ga0065715_10000207 3300005293 Bacteria 34609
18 Ga0065715_10000498 3300005293 Bacteria 12786
19 Ga0065715_10001221 3300005293 Bacteria 10495
20 Ga0065715_10008852 3300005293 Bacteria 3636
21 Ga0065715_10010129 3300005293 Unclassified 2726
22 Ga0065715_10010802 3300005293 Bacteria 5534
23 Ga0065715_10143106 3300005293 Bacteria 1808
24 Ga0065715_10307833 3300005293 Unclassified 1008
25 Ga0065715_10435794 3300005293 Unclassified 842
26 Ga0065707_10022448 3300005295 Bacteria 1627
27 Ga0065707_10186400 3300005295 Unclassified 1386
28 Ga0070658_10181132 3300005327 Unclassified 1773
29 Ga0070676_10015061 3300005328 Unclassified 4260
30 Ga0070676_10077478 3300005328 Bacteria 2009
31 Ga0070676_10480469 3300005328 Unclassified 879
32 Ga0070683_100001160 3300005329 Bacteria 19949
33 Ga0070683_100221816 3300005329 Bacteria 1797
34 Ga0070690_100002449 3300005330 Bacteria 9973
35 Ga0070690_100032220 3300005330 Bacteria 3272
36 Ga0070677_10030267 3300005333 Bacteria 2060
37 Ga0068869_100010782 3300005334 Bacteria 5970
38 Ga0068869_100234661 3300005334 Unclassified 1459
39 Ga0070666_10045106 3300005335 Unclassified 2955
40 Ga0070666_10202014 3300005335 Unclassified 1398
41 Ga0070680_100028050 3300005336 Bacteria 4514
42 Ga0068868_100020457 3300005338 Bacteria 4974
43 Ga0068868_100156181 3300005338 Bacteria 1882
44 Ga0068868_100191396 3300005338 Bacteria 1701
45 Ga0070660_100109381 3300005339 Unclassified 2198
46 Ga0070689_100002648 3300005340 Bacteria 11738
47 Ga0070689_100014684 3300005340 Bacteria 5695
48 Ga0070689_100062492 3300005340 Bacteria 2898
49 Ga0070689_101412422 3300005340 Unclassified 629
50 Ga0070687_100015846 3300005343 Bacteria 3418
51 Ga0070692_10169313 3300005345 Unclassified 1258
52 Ga0070668_100013399 3300005347 Bacteria 6118
53 Ga0070668_100019031 3300005347 Bacteria 5161
54 Ga0070669_100016524 3300005353 Bacteria 5267
55 Ga0070669_100017297 3300005353 Bacteria 5143
56 Ga0070675_100007020 3300005354 Bacteria 8658
57 Ga0070675_100009289 3300005354 Bacteria 7644
58 Ga0070675_100060920 3300005354 Bacteria 3115
59 Ga0070675_100141747 3300005354 Unclassified 2055
60 Ga0070675_100195249 3300005354 Bacteria 1755
61 Ga0070675_100514029 3300005354 Unclassified 1080
62 Ga0070671_100380069 3300005355 Unclassified 1207
63 Ga0070671_100462105 3300005355 Unclassified 1089
64 Ga0070671_100674109 3300005355 Bacteria 896
65 Ga0070671_100989732 3300005355 Unclassified 737
66 Ga0070674_100000780 3300005356 Bacteria 16336
67 Ga0070673_100014849 3300005364 Bacteria 5447
68 Ga0070673_100072780 3300005364 Bacteria 2765
69 Ga0070688_100003944 3300005365 Bacteria 7694
70 Ga0070659_100017051 3300005366 Bacteria 5459
71 Ga0070659_100146967 3300005366 Bacteria 1921
72 Ga0070667_100018582 3300005367 Bacteria 5765
73 Ga0070667_100026680 3300005367 Bacteria 4805
74 Ga0070709_10009751 3300005434 Bacteria 5304
75 Ga0070709_10301815 3300005434 Unclassified 1170
76 Ga0070709_10602243 3300005434 Unclassified 846
77 Ga0070714_100030203 3300005435 Bacteria 4509
78 Ga0070714_100138478 3300005435 Bacteria 2182
79 Ga0070714_100237878 3300005435 Bacteria 1680
80 Ga0070713_100004806 3300005436 Bacteria 9151
81 Ga0070713_100034708 3300005436 Bacteria 4055
82 Ga0070713_100159196 3300005436 Bacteria 2014
83 Ga0070713_100220092 3300005436 Unclassified 1722
84 Ga0070713_100628440 3300005436 Unclassified 1022
85 Ga0070713_101132471 3300005436 Bacteria 757
86 Ga0070710_10047448 3300005437 Unclassified 2395
87 Ga0070710_10050623 3300005437 Bacteria 2329
88 Ga0070710_10091139 3300005437 Bacteria 1798
89 Ga0070711_100012285 3300005439 Bacteria 5343
90 Ga0070711_100136342 3300005439 Bacteria 1835
91 Ga0070705_100024037 3300005440 Bacteria 3282
92 Ga0070705_100037428 3300005440 Bacteria 2737
93 Ga0070705_100055659 3300005440 Bacteria 2326
94 Ga0070700_100192845 3300005441 Unclassified 1426
95 Ga0070708_100029555 3300005445 Bacteria 4727
96 Ga0070708_100088506 3300005445 Unclassified 2816
97 Ga0070708_100120626 3300005445 Unclassified 2419
98 Ga0070708_100158335 3300005445 Bacteria 2109
99 Ga0070708_100167112 3300005445 Bacteria 2052
100 Ga0070708_100274466 3300005445 Bacteria 1586
101 Ga0070708_100305570 3300005445 Unclassified 1498
102 Ga0070708_100516602 3300005445 Unclassified 1127
103 Ga0070708_100853247 3300005445 Unclassified 855
104 Ga0070663_100027336 3300005455 Unclassified 3874
105 Ga0070663_100030086 3300005455 Bacteria 3718
106 Ga0070678_100018503 3300005456 Bacteria 4516
107 Ga0070662_100001847 3300005457 Bacteria 12981
108 Ga0070662_100120079 3300005457 Bacteria 2013
109 Ga0070662_100726232 3300005457 Unclassified 841
110 Ga0070681_10007306 3300005458 Bacteria 10783
111 Ga0070681_11092852 3300005458 Bacteria 718
112 Ga0070685_10072563 3300005466 Bacteria 2044
113 Ga0070685_10083892 3300005466 Unclassified 1915
114 Ga0070706_100000339 3300005467 Bacteria 56563
115 Ga0070706_100013001 3300005467 Bacteria 7703
116 Ga0070706_100013153 3300005467 Bacteria 7658
117 Ga0070706_100081435 3300005467 Bacteria 2998
118 Ga0070706_100101407 3300005467 Bacteria 2675
119 Ga0070706_100118702 3300005467 Bacteria 2464
120 Ga0070706_100223200 3300005467 Bacteria 1759
121 Ga0070706_100491390 3300005467 Unclassified 1142
122 Ga0070706_100839690 3300005467 Bacteria 850
123 Ga0070707_100002484 3300005468 Bacteria 17582
124 Ga0070707_100006579 3300005468 Bacteria 10783
125 Ga0070707_100011119 3300005468 Bacteria 8385
126 Ga0070707_100014650 3300005468 Bacteria 7348
127 Ga0070707_100016462 3300005468 Bacteria 6938
128 Ga0070707_100185269 3300005468 Bacteria 2030
129 Ga0070707_100186156 3300005468 Bacteria 2024
130 Ga0070707_100232250 3300005468 Bacteria 1795
131 Ga0070707_101086040 3300005468 Bacteria 766
132 Ga0070698_100012903 3300005471 Bacteria 8849
133 Ga0070698_100044664 3300005471 Unclassified 4535
134 Ga0070698_100058377 3300005471 Unclassified 3901
135 Ga0070698_100180108 3300005471 Bacteria 2052
136 Ga0070698_100235273 3300005471 Bacteria 1765
137 Ga0070698_100361636 3300005471 Bacteria 1383
138 Ga0070698_100370848 3300005471 Bacteria 1363
139 Ga0070698_101420691 3300005471 Unclassified 645
140 Ga0070699_100017866 3300005518 Bacteria 6090
141 Ga0070699_100111344 3300005518 Unclassified 2404
142 Ga0070699_100265497 3300005518 Unclassified 1536
143 Ga0070699_100415799 3300005518 Bacteria 1217
144 Ga0070699_100544001 3300005518 Unclassified 1057
145 Ga0070699_101103655 3300005518 Unclassified 728
146 Ga0070679_100134560 3300005530 Unclassified 2453
147 Ga0070684_100000906 3300005535 Bacteria 20999
148 Ga0070684_100019429 3300005535 Bacteria 5620
149 Ga0070684_100022922 3300005535 Bacteria 5214
150 Ga0070684_100103646 3300005535 Bacteria 2545
151 Ga0070697_100000889 3300005536 Bacteria 22458
152 Ga0070697_100015146 3300005536 Bacteria 6055
153 Ga0070697_100021041 3300005536 Bacteria 5165
154 Ga0070697_100027961 3300005536 Bacteria 4514
155 Ga0070697_100028727 3300005536 Bacteria 4454
156 Ga0070697_100034881 3300005536 Unclassified 4058
157 Ga0070697_100040378 3300005536 Unclassified 3775
158 Ga0070697_100096273 3300005536 Bacteria 2455
159 Ga0070697_100147317 3300005536 Unclassified 1983
160 Ga0070697_100280190 3300005536 Unclassified 1430
161 Ga0070697_100332579 3300005536 Bacteria 1310
162 Ga0068853_101111876 3300005539 Unclassified 762
163 Ga0070672_100074720 3300005543 Unclassified 2704
164 Ga0070672_100223865 3300005543 Unclassified 1579
165 Ga0070686_100139294 3300005544 Unclassified 1687
166 Ga0070693_100439785 3300005547 Unclassified 913
167 Ga0070665_100033252 3300005548 Bacteria 5189
168 Ga0070665_100118510 3300005548 Unclassified 2649
169 Ga0070665_100693235 3300005548 Unclassified 1032
170 Ga0070704_100013053 3300005549 Bacteria 5144
171 Ga0070704_100057908 3300005549 Bacteria 2758
172 Ga0070664_100964762 3300005564 Unclassified 801
173 Ga0068854_101200740 3300005578 Unclassified 680
174 Ga0068856_100204964 3300005614 Unclassified 1987
175 Ga0068856_100394941 3300005614 Bacteria 1403
176 Ga0068852_100578260 3300005616 Bacteria 1126
177 Ga0068864_100105926 3300005618 Bacteria 2500
178 Ga0068866_10089768 3300005718 Bacteria 1671
179 Ga0068858_100294132 3300005842 Bacteria 1548
180 Ga0068858_100702051 3300005842 Unclassified 984
181 Ga0068860_100012546 3300005843 Bacteria 8343
182 Ga0068860_100023997 3300005843 Bacteria 5895
183 Ga0068860_100242077 3300005843 Bacteria 1755
184 Ga0068860_100676602 3300005843 Unclassified 1041
185 Ga0068862_100051326 3300005844 Bacteria 3527
186 Ga0068862_100633512 3300005844 Unclassified 1030
187 Ga0081455_10000314 3300005937 Bacteria 63484
188 Ga0081455_10000959 3300005937 Bacteria 36868
189 Ga0081455_10005232 3300005937 Bacteria 14267
190 Ga0081455_10015384 3300005937 Bacteria 7437
191 Ga0081455_10041812 3300005937 Unclassified 4026
192 Ga0081455_10049009 3300005937 Unclassified 3644
193 Ga0081540_1000016 3300005983 Bacteria 165370
194 Ga0081540_1024398 3300005983 Unclassified 3510
195 Ga0081540_1105686 3300005983 Unclassified 1202
196 Ga0081539_10000014 3300005985 Bacteria 411270
197 Ga0081539_10036270 3300005985 Bacteria 2954
198 Ga0070717_10002989 3300006028 Bacteria 12038
199 Ga0070717_10007985 3300006028 Bacteria 7882
200 Ga0070717_10028994 3300006028 Bacteria 4436
201 Ga0070717_10037682 3300006028 Bacteria 3927
202 Ga0070717_10154153 3300006028 Bacteria 1989
203 Ga0070717_10247184 3300006028 Unclassified 1575
204 Ga0070717_10294897 3300006028 Unclassified 1440
205 Ga0070717_10827050 3300006028 Unclassified 843
206 Ga0070715_10017096 3300006163 Bacteria 2739
207 Ga0070715_10214124 3300006163 Bacteria 986
208 Ga0070715_10298201 3300006163 Unclassified 861
209 Ga0070716_100039273 3300006173 Bacteria 2626
210 Ga0070716_100071576 3300006173 Bacteria 2039
211 Ga0070716_100375522 3300006173 Bacteria 1014
212 Ga0070716_101183426 3300006173 Unclassified 613
213 Ga0070712_100030859 3300006175 Bacteria 3606
214 Ga0070712_100040418 3300006175 Bacteria 3197
215 Ga0070712_100063004 3300006175 Bacteria 2624
216 Ga0070712_100070560 3300006175 Unclassified 2497
217 Ga0070712_100081693 3300006175 Bacteria 2342
218 Ga0070712_100130567 3300006175 Bacteria 1903
219 Ga0070712_100393987 3300006175 Unclassified 1142
220 Ga0070712_101009824 3300006175 Unclassified 720
221 Ga0070712_101074313 3300006175 Bacteria 698
222 Ga0070712_101132725 3300006175 Unclassified 680
223 Ga0097621_100035590 3300006237 Unclassified 3980
224 Ga0068871_100083945 3300006358 Unclassified 2643
225 Ga0075433_10892098 3300006852 Unclassified 776
226 Ga0075434_100315802 3300006871 Bacteria 1583
227 Ga0068865_100034788 3300006881 Unclassified 3383
228 Ga0068865_100257833 3300006881 Unclassified 1379
229 Ga0075436_100134397 3300006914 Bacteria 1736
230 Ga0099794_10186454 3300007265 Bacteria 1060
231 Ga0099795_10002031 3300007788 Bacteria 4635
232 Ga0099795_10007257 3300007788 Unclassified 3081
233 Ga0105240_10808136 3300009093 Bacteria 1015
234 Ga0111539_10104757 3300009094 Bacteria 3319
235 Ga0105245_10094451 3300009098 Bacteria 2756
236 Ga0105245_10296930 3300009098 Unclassified 1584
237 Ga0105245_10531666 3300009098 Unclassified 1196
238 Ga0105245_10966590 3300009098 Bacteria 895
239 Ga0105245_11406218 3300009098 Unclassified 748
240 Ga0105247_10481337 3300009101 Unclassified 901
241 Ga0114129_10826009 3300009147 Bacteria 1180
242 Ga0105243_10637500 3300009148 Unclassified 1031
243 Ga0105243_10893895 3300009148 Unclassified 883
244 Ga0105241_10112915 3300009174 Bacteria 2177
245 Ga0105242_10116091 3300009176 Bacteria 2289
246 Ga0105242_10136501 3300009176 Unclassified 2124
247 Ga0105248_10676437 3300009177 Unclassified 1164
248 Ga0105237_10122402 3300009545 Unclassified 2595
249 Ga0105237_10889363 3300009545 Unclassified 898
250 Ga0105237_10951825 3300009545 Bacteria 866
251 Ga0105249_10030100 3300009553 Bacteria 4905
252 Ga0105249_10362235 3300009553 Bacteria 1472
253 Ga0099796_10002908 3300010159 Unclassified 3864
254 Ga0099796_10111074 3300010159 Bacteria 1043
255 Ga0105239_10011346 3300010375 Bacteria 9941
256 Ga0105246_10070808 3300011119 Unclassified 2454
257 Ga0157327_1004405 3300012512 Bacteria 1088
258 Ga0157338_1010564 3300012515 Bacteria 934
259 Ga0157373_10793866 3300013100 Unclassified 698
260 Ga0157371_10120829 3300013102 Unclassified 1862
261 Ga0157371_10615544 3300013102 Unclassified 808
262 Ga0157370_10138585 3300013104 Bacteria 2267
263 Ga0157369_10029470 3300013105 Bacteria 6064
264 Ga0157369_10515238 3300013105 Bacteria 1237
265 Ga0157374_10018203 3300013296 Bacteria 6197
266 Ga0157374_10043729 3300013296 Bacteria 4139
267 Ga0157374_10124964 3300013296 Bacteria 2486
268 Ga0157374_10130760 3300013296 Bacteria 2429
269 Ga0157374_10176130 3300013296 Bacteria 2088
270 Ga0157374_11219120 3300013296 Unclassified 774
271 Ga0157374_11293480 3300013296 Bacteria 751
272 Ga0157378_10008313 3300013297 Bacteria 9043
273 Ga0157378_10052801 3300013297 Bacteria 3617
274 Ga0157378_10197829 3300013297 Bacteria 1899
275 Ga0157378_10831336 3300013297 Unclassified 951
276 Ga0157378_10849896 3300013297 Unclassified 941
277 Ga0157378_11786480 3300013297 Unclassified 663
278 Ga0163162_10010679 3300013306 Bacteria 8930
279 Ga0163162_10043125 3300013306 Bacteria 4516
280 Ga0163162_10202920 3300013306 Bacteria 2112
281 Ga0163162_10228506 3300013306 Bacteria 1991
282 Ga0157372_10084908 3300013307 Unclassified 3590
283 Ga0157372_10146547 3300013307 Bacteria 2723
284 Ga0157372_10152490 3300013307 Bacteria 2668
285 Ga0157375_10018938 3300013308 Bacteria 6250
286 Ga0157375_10233657 3300013308 Bacteria 1998
287 Ga0157375_10321922 3300013308 Bacteria 1711
288 Ga0157375_10571852 3300013308 Unclassified 1291
289 Ga0157375_11078286 3300013308 Bacteria 940
290 Ga0163163_10231397 3300014325 Unclassified 1897
291 Ga0163163_10311040 3300014325 Unclassified 1628
292 Ga0163163_10413183 3300014325 Unclassified 1408
293 Ga0163163_10414470 3300014325 Bacteria 1406
294 Ga0182008_10026360 3300014497 Unclassified 2948
295 Ga0157377_10338359 3300014745 Bacteria 1006
296 Ga0157379_10145567 3300014968 Bacteria 2137
297 Ga0157376_10031020 3300014969 Bacteria 4275
298 Ga0157376_10087782 3300014969 Bacteria 2685
299 Ga0157376_10478669 3300014969 Bacteria 1220
300 Ga0157376_10898592 3300014969 Unclassified 904
301 Ga0182005_1010277 3300015265 Unclassified 2697
302 Ga0163161_10111116 3300017792 Bacteria 2049
303 Ga0163161_10530323 3300017792 Unclassified 962
304 Ga0207666_1002361 3300025271 Bacteria 2270
305 Ga0207666_1036648 3300025271 Unclassified 762
306 Ga0207673_1004308 3300025290 Unclassified 1696
307 Ga0207673_1006416 3300025290 Bacteria 1455
308 Ga0207697_10000283 3300025315 Bacteria 28184
309 Ga0207697_10000681 3300025315 Bacteria 19317
310 Ga0207697_10002609 3300025315 Bacteria 9267
311 Ga0207697_10006249 3300025315 Bacteria 5415
312 Ga0207697_10007405 3300025315 Bacteria 4899
313 Ga0207697_10028652 3300025315 Unclassified 2278
314 Ga0207697_10322936 3300025315 Unclassified 685
315 Ga0207653_10015114 3300025885 Bacteria 2422
316 Ga0207682_10016117 3300025893 Bacteria 2913
317 Ga0207692_10124997 3300025898 Bacteria 1445
318 Ga0207710_10170959 3300025900 Unclassified 1062
319 Ga0207688_10002322 3300025901 Bacteria 10225
320 Ga0207688_10115308 3300025901 Bacteria 1563
321 Ga0207688_10207565 3300025901 Bacteria 1176
322 Ga0207680_10176824 3300025903 Unclassified 1441
323 Ga0207647_10005474 3300025904 Bacteria 9294
324 Ga0207647_10150291 3300025904 Bacteria 1361
325 Ga0207685_10006553 3300025905 Bacteria 3180
326 Ga0207685_10027122 3300025905 Unclassified 2001
327 Ga0207699_10027500 3300025906 Bacteria 3150
328 Ga0207645_10001228 3300025907 Bacteria 21121
329 Ga0207645_10007044 3300025907 Bacteria 8005
330 Ga0207705_10426776 3300025909 Unclassified 1027
331 Ga0207684_10000276 3300025910 Bacteria 75551
332 Ga0207684_10011637 3300025910 Bacteria 7683
333 Ga0207684_10015808 3300025910 Bacteria 6490
334 Ga0207684_10019577 3300025910 Bacteria 5789
335 Ga0207684_10047164 3300025910 Bacteria 3655
336 Ga0207684_10069067 3300025910 Bacteria 3003
337 Ga0207684_10082108 3300025910 Bacteria 2744
338 Ga0207684_10159963 3300025910 Bacteria 1939
339 Ga0207684_10286517 3300025910 Bacteria 1420
340 Ga0207654_10056090 3300025911 Bacteria 2284
341 Ga0207707_10048004 3300025912 Unclassified 3719
342 Ga0207671_10533735 3300025914 Bacteria 935
343 Ga0207693_10004040 3300025915 Bacteria 12470
344 Ga0207693_10033901 3300025915 Unclassified 4028
345 Ga0207693_10040626 3300025915 Bacteria 3663
346 Ga0207693_10050893 3300025915 Bacteria 3252
347 Ga0207693_10057166 3300025915 Bacteria 3058
348 Ga0207693_10080040 3300025915 Unclassified 2558
349 Ga0207693_10127633 3300025915 Bacteria 1999
350 Ga0207693_10142275 3300025915 Bacteria 1886
351 Ga0207663_10011079 3300025916 Bacteria 4826
352 Ga0207663_10040250 3300025916 Bacteria 2839
353 Ga0207663_10630892 3300025916 Unclassified 844
354 Ga0207660_10104664 3300025917 Unclassified 2119
355 Ga0207662_10006705 3300025918 Bacteria 6225
356 Ga0207662_10081717 3300025918 Bacteria 1973
357 Ga0207657_10043454 3300025919 Bacteria 3958
358 Ga0207657_10382983 3300025919 Unclassified 1107
359 Ga0207649_10019808 3300025920 Unclassified 3850
360 Ga0207649_10369416 3300025920 Unclassified 1066
361 Ga0207652_10018051 3300025921 Bacteria 5784
362 Ga0207646_10003213 3300025922 Bacteria 18658
363 Ga0207646_10005702 3300025922 Bacteria 13058
364 Ga0207646_10021461 3300025922 Bacteria 5966
365 Ga0207646_10048382 3300025922 Bacteria 3811
366 Ga0207646_10067553 3300025922 Bacteria 3192
367 Ga0207646_10072396 3300025922 Unclassified 3078
368 Ga0207646_10179174 3300025922 Unclassified 1914
369 Ga0207646_10275548 3300025922 Bacteria 1520
370 Ga0207646_10781003 3300025922 Bacteria 851
371 Ga0207646_10824631 3300025922 Unclassified 825
372 Ga0207681_10004121 3300025923 Bacteria 9010
373 Ga0207681_10367123 3300025923 Unclassified 1156
374 Ga0207681_11095656 3300025923 Unclassified 669
375 Ga0207694_11139538 3300025924 Unclassified 660
376 Ga0207650_10651867 3300025925 Bacteria 888
377 Ga0207659_10005770 3300025926 Bacteria 7544
378 Ga0207659_10005985 3300025926 Bacteria 7420
379 Ga0207659_10147386 3300025926 Bacteria 1834
380 Ga0207659_10157156 3300025926 Unclassified 1781
381 Ga0207659_10227596 3300025926 Unclassified 1502
382 Ga0207687_10169395 3300025927 Unclassified 1683
383 Ga0207687_10204868 3300025927 Bacteria 1544
384 Ga0207700_10096336 3300025928 Bacteria 2349
385 Ga0207700_10238363 3300025928 Bacteria 1549
386 Ga0207700_10342903 3300025928 Unclassified 1299
387 Ga0207700_10744610 3300025928 Bacteria 876
388 Ga0207664_10126294 3300025929 Unclassified 2148
389 Ga0207664_10129312 3300025929 Bacteria 2124
390 Ga0207664_10153692 3300025929 Bacteria 1957
391 Ga0207664_10216193 3300025929 Bacteria 1660
392 Ga0207664_10311419 3300025929 Bacteria 1387
393 Ga0207644_10065887 3300025931 Bacteria 2635
394 Ga0207644_10155407 3300025931 Unclassified 1773
395 Ga0207644_10330899 3300025931 Unclassified 1233
396 Ga0207644_10754296 3300025931 Unclassified 813
397 Ga0207690_10091569 3300025932 Bacteria 2149
398 Ga0207706_10002099 3300025933 Bacteria 19504
399 Ga0207706_10056139 3300025933 Bacteria 3472
400 Ga0207706_10123205 3300025933 Bacteria 2281
401 Ga0207706_10124287 3300025933 Unclassified 2270
402 Ga0207706_10262968 3300025933 Bacteria 1506
403 Ga0207686_10081096 3300025934 Unclassified 2117
404 Ga0207670_10005975 3300025936 Bacteria 6723
405 Ga0207670_10209018 3300025936 Bacteria 1487
406 Ga0207670_10333096 3300025936 Unclassified 1197
407 Ga0207669_10095655 3300025937 Bacteria 1947
408 Ga0207669_10651924 3300025937 Unclassified 861
409 Ga0207704_10109564 3300025938 Unclassified 1863
410 Ga0207665_10004405 3300025939 Bacteria 9357
411 Ga0207665_10033284 3300025939 Unclassified 3415
412 Ga0207665_10126526 3300025939 Bacteria 1810
413 Ga0207665_10160231 3300025939 Bacteria 1618
414 Ga0207665_10242195 3300025939 Bacteria 1329
415 Ga0207665_10267526 3300025939 Bacteria 1268
416 Ga0207665_10751627 3300025939 Unclassified 769
417 Ga0207665_10956523 3300025939 Unclassified 681
418 Ga0207691_10001630 3300025940 Bacteria 22283
419 Ga0207711_10739115 3300025941 Unclassified 917
420 Ga0207689_10038227 3300025942 Bacteria 3977
421 Ga0207689_10147016 3300025942 Bacteria 1942
422 Ga0207689_10241008 3300025942 Unclassified 1495
423 Ga0207661_10016865 3300025944 Bacteria 5394
424 Ga0207661_10431376 3300025944 Bacteria 1198
425 Ga0207679_10274705 3300025945 Bacteria 1443
426 Ga0207679_10410843 3300025945 Unclassified 1193
427 Ga0207679_11120282 3300025945 Unclassified 722
428 Ga0207651_10032291 3300025960 Bacteria 3361
429 Ga0207651_10032847 3300025960 Unclassified 3338
430 Ga0207651_10118809 3300025960 Bacteria 2000
431 Ga0207712_10026166 3300025961 Bacteria 3884
432 Ga0207668_10009977 3300025972 Bacteria 5714
433 Ga0207668_10124106 3300025972 Bacteria 1960
434 Ga0207668_10573047 3300025972 Bacteria 980
435 Ga0207658_10017925 3300025986 Bacteria 4880
436 Ga0207658_10130796 3300025986 Bacteria 2016
437 Ga0207658_10277751 3300025986 Bacteria 1435
438 Ga0207677_10011998 3300026023 Bacteria 4963
439 Ga0207677_10132978 3300026023 Bacteria 1892
440 Ga0207703_10399611 3300026035 Bacteria 1275
441 Ga0207703_10810343 3300026035 Unclassified 894
442 Ga0207678_10021102 3300026067 Bacteria 5708
443 Ga0207678_10651110 3300026067 Bacteria 926
444 Ga0207708_10051341 3300026075 Bacteria 3139
445 Ga0207702_10135196 3300026078 Unclassified 2224
446 Ga0207641_10158525 3300026088 Bacteria 2055
447 Ga0207648_10131171 3300026089 Bacteria 2206
448 Ga0207676_10525297 3300026095 Unclassified 1127
449 Ga0207674_10510817 3300026116 Bacteria 1161
450 Ga0207675_100118653 3300026118 Bacteria 2502
451 Ga0207683_10018640 3300026121 Bacteria 5924
452 Ga0207683_10062891 3300026121 Unclassified 3269
453 Ga0207683_10240052 3300026121 Unclassified 1653
454 Ga0207683_10266044 3300026121 Bacteria 1566
455 Ga0207698_10326781 3300026142 Unclassified 1439
456 Ga0209973_1019799 3300027252 Unclassified 884
457 Ga0209179_1012944 3300027512 Unclassified 1507
458 Ga0210002_1004868 3300027617 Unclassified 2004
459 Ga0209971_1021268 3300027682 Unclassified 1543
460 Ga0209998_10011390 3300027717 Unclassified 1843
461 Ga0268266_10031046 3300028379 Bacteria 4537
462 Ga0268266_10046725 3300028379 Unclassified 3706
463 Ga0268266_10068131 3300028379 Bacteria 3081
464 Ga0268266_10111515 3300028379 Bacteria 2424
465 Ga0268264_10009325 3300028381 Bacteria 8127
466 Ga0268264_10119843 3300028381 Bacteria 2318
467 Ga0268264_10353569 3300028381 Bacteria 1399
468 Ga0373944_0052727 3300035089 Bacteria 1286
469 Ga0373944_0079782 3300035089 Unclassified 1079
470 Ga0373936_0303549 3300035113 Unclassified 721
471 Ga0373943_0249618 3300035170 Bacteria 996
472 Ga0373943_0267870 3300035170 Unclassified 963
473 Ga0373946_0015546 3300035171 Bacteria 2888
474 Ga0373946_0094934 3300035171 Unclassified 1328
475 Ga0373946_0479729 3300035171 Unclassified 636
476 Ga0373955_0628350 3300035172 Unclassified 658
477 Ga0373931_0146795 3300035691 Bacteria 1372
478 Ga0373935_0031307 3300035692 Unclassified 3301
479 Ga0373927_0215533 3300035695 Bacteria 1261
480 Ga0373927_0285902 3300035695 Unclassified 1085
481 Ga0373933_0082349 3300035724 Bacteria 1975
482 Ga0373947_0019989 3300035725 Unclassified 3865
483 Ga0373947_0132783 3300035725 Unclassified 1591
484 Ga0373947_0186010 3300035725 Bacteria 1354
485 Ga0373947_0437293 3300035725 Unclassified 885
486 Ga0373947_0476840 3300035725 Bacteria 846
487 Ga0373925_0027165 3300037068 Unclassified 4191
488 Ga0373925_0062700 3300037068 Unclassified 2796
489 Ga0373925_0087360 3300037068 Bacteria 2380
490 Ga0373925_0122764 3300037068 Bacteria 2018
491 Ga0373925_0629881 3300037068 Unclassified 884
492 Ga0395899_0068396 3300037312 Bacteria 2604
493 Ga0395899_0845924 3300037312 Unclassified 562
494 Ga0395900_1018914 3300037418 Bacteria 747
495 Ga0395900_1043134 3300037418 Unclassified 736
496 Ga0395898_0026578 3300037466 Bacteria 5821
497 Ga0395905_0136986 3300037471 Unclassified 2303
498 Ga0436364_1130765 3300037853 Unclassified 901
499 Ga0395901_0001233 3300038443 Bacteria 27296
500 Ga0395901_0166012 3300038443 Bacteria 2318
501 Ga0395901_0957845 3300038443 Unclassified 834
502 Ga0436363_1341675 3300039450 Bacteria 1261
503 Ga0451839_0929501 3300041496 Unclassified 1208
504 Ga0451853_3717991 3300041512 Unclassified 1613
505 Ga0451576_0025769 3300045051 Bacteria 6334
506 Ga0495629_0268043 3300046459 Bacteria 1173
507 Ga0495653_0250399 3300046463 Bacteria 1176
508 Ga0495653_0389325 3300046463 Unclassified 888
509 Ga0495582_0038820 3300046473 Bacteria 2621
510 Ga0495639_0092171 3300046475 Bacteria 1423
511 Ga0495662_0060765 3300046476 Bacteria 1825
512 Ga0495594_0025738 3300046499 Bacteria 3164
513 Ga0495618_0153917 3300046514 Unclassified 1468
514 Ga0495630_0078442 3300046517 Unclassified 2490
515 Ga0495644_0121506 3300046523 Unclassified 994
516 Ga0495598_0065016 3300046537 Bacteria 1135
517 Ga0495656_0173897 3300046615 Unclassified 1055
518 Ga0495634_0334744 3300046642 Unclassified 909
519 Ga0495634_0619095 3300046642 Unclassified 627
520 Ga0495588_0540922 3300046674 Unclassified 610
521 Ga0495657_0365481 3300046675 Bacteria 852
522 Ga0495623_0185280 3300046679 Unclassified 1206
523 Ga0495647_0096680 3300046681 Bacteria 1218
524 Ga0495658_0052907 3300046683 Unclassified 2304
525 Ga0495669_0046049 3300046684 Bacteria 1946
526 Ga0495624_0176822 3300046690 Bacteria 1301
527 Ga0495600_0578329 3300046809 Unclassified 684
528 Ga0495581_0065519 3300047315 Bacteria 2100
529 Ga0495674_0226158 3300047319 Unclassified 1545
530 Ga0495676_0910583 3300047321 Unclassified 563
531 Ga0495593_0126960 3300047673 Bacteria 1296
532 Ga0496100_0013450 3300048903 Bacteria 4720
533 Ga0496100_0205696 3300048903 Unclassified 1437
534 Ga0496101_0030095 3300048904 Unclassified 3803
535 Ga0496101_0329202 3300048904 Unclassified 1199
536 Ga0496102_0028285 3300048905 Bacteria 5006
537 Ga0496102_0103744 3300048905 Bacteria 2644
538 Ga0496103_0016087 3300048906 Unclassified 4463
539 Ga0496103_0080463 3300048906 Bacteria 2049
540 Ga0496104_0064037 3300048907 Bacteria 3488
541 Ga0496104_0186408 3300048907 Bacteria 1985
542 Ga0496105_0175184 3300048908 Unclassified 1757
543 Ga0496105_0202510 3300048908 Bacteria 1620
544 Ga0496105_0852123 3300048908 Unclassified 690
545 Ga0496106_0003614 3300048909 Bacteria 11532
546 Ga0496107_0273656 3300048910 Unclassified 1257
547 Ga0496108_0025515 3300048911 Unclassified 4870
548 Ga0496108_0248321 3300048911 Bacteria 1548
549 Ga0496109_0007567 3300048912 Bacteria 9206
550 Ga0496110_0022586 3300048913 Bacteria 5344
551 Ga0496110_0206993 3300048913 Bacteria 1783
552 Ga0496110_0558374 3300048913 Bacteria 1040
553 Ga0496111_0652138 3300048914 Bacteria 768
554 Ga0496111_0900615 3300048914 Bacteria 637
555 Ga0496112_0023116 3300048915 Bacteria 5934
556 Ga0496112_0034175 3300048915 Unclassified 4947
557 Ga0496112_0265788 3300048915 Bacteria 1664
558 Ga0496112_0305463 3300048915 Bacteria 1536
559 Ga0496112_0334221 3300048915 Bacteria 1459
560 Ga0496112_0527272 3300048915 Unclassified 1116
561 Ga0496112_0605150 3300048915 Unclassified 1028
562 Ga0496114_0070039 3300048917 Unclassified 2945
563 Ga0496114_0180199 3300048917 Bacteria 1845
564 Ga0496114_0514507 3300048917 Unclassified 1059
565 Ga0496115_0034988 3300048918 Bacteria 3972
566 Ga0496115_0075949 3300048918 Unclassified 2731
567 Ga0496115_0206830 3300048918 Unclassified 1621
568 nmdc:mga05p37_38407_c1 3300050507 Bacteria 5872
569 nmdc:mga05p37_740629_c1 3300050507 Unclassified 1085
570 nmdc:mga08y16_423464_c1 3300050511 Unclassified 1360
571 nmdc:mga0n895_314015_c1 3300050512 Bacteria 1588
572 nmdc:mga08x19_80221_c1 3300050514 Bacteria 2141
573 Ga0495595_0076554 3300053084 Bacteria 1588
574 Ga0495595_0607315 3300053084 Unclassified 559

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10126526 Ga0207665_101265262 150
2 3300005434 Ga0070709_10301815 Ga0070709_103018152 151
3 3300005536 Ga0070697_100280190 Ga0070697_1002801902 151
4 3300006028 Ga0070717_10294897 Ga0070717_102948972 151
5 3300047321 Ga0495676_0910583 Ga0495676_0910583_11_466 151
6 3300006175 Ga0070712_100393987 Ga0070712_1003939872 152
7 3300025915 Ga0207693_10080040 Ga0207693_100800402 152
8 3300025928 Ga0207700_10238363 Ga0207700_102383632 152
9 3300038443 Ga0395901_0166012 Ga0395901_0166012_239_790 152
10 3300025915 Ga0207693_10127633 Ga0207693_101276332 153
11 3300006163 Ga0070715_10017096 Ga0070715_100170963 154
12 3300006175 Ga0070712_100030859 Ga0070712_1000308593 154
13 3300025905 Ga0207685_10027122 Ga0207685_100271222 154
14 3300025915 Ga0207693_10033901 Ga0207693_100339013 154
15 3300005471 Ga0070698_101420691 Ga0070698_1014206911 156
16 3300005436 Ga0070713_101132471 Ga0070713_1011324711 157
17 3300005467 Ga0070706_100118702 Ga0070706_1001187022 157
18 3300006028 Ga0070717_10007985 Ga0070717_100079854 157
19 3300025910 Ga0207684_10015808 Ga0207684_100158087 157
20 3300005468 Ga0070707_100014650 Ga0070707_1000146505 158
21 3300005471 Ga0070698_100235273 Ga0070698_1002352732 158
22 3300005536 Ga0070697_100000889 Ga0070697_1000008899 158
23 3300006028 Ga0070717_10247184 Ga0070717_102471841 158
24 3300025922 Ga0207646_10072396 Ga0207646_100723962 158
25 3300025929 Ga0207664_10153692 Ga0207664_101536922 158
26 3300046675 Ga0495657_0365481 Ga0495657_0365481_331_807 158
27 3300048917 Ga0496114_0514507 Ga0496114_0514507_561_1037 158
28 3300053084 Ga0495595_0607315 Ga0495595_0607315_31_507 158
29 3300025928 Ga0207700_10744610 Ga0207700_107446101 161
30 3300048913 Ga0496110_0558374 Ga0496110_0558374_391_918 163
31 3300048914 Ga0496111_0652138 Ga0496111_0652138_221_748 163
32 3300048918 Ga0496115_0034988 Ga0496115_0034988_2461_2988 163
33 3300035172 Ga0373955_0628350 Ga0373955_0628350_23_517 164
34 3300005468 Ga0070707_100185269 Ga0070707_1001852692 169
35 3300025922 Ga0207646_10179174 Ga0207646_101791742 169
36 3300037312 Ga0395899_0068396 Ga0395899_0068396_1893_2420 170
37 3300037466 Ga0395898_0026578 Ga0395898_0026578_5251_5778 170
38 3300037471 Ga0395905_0136986 Ga0395905_0136986_595_1122 170
39 3300038443 Ga0395901_0001233 Ga0395901_0001233_25738_26265 170
40 3300005518 Ga0070699_100111344 Ga0070699_1001113442 171
41 3300005293 Ga0065715_10000207 Ga0065715_1000020728 172
42 3300005440 Ga0070705_100037428 Ga0070705_1000374284 172
43 3300005937 Ga0081455_10041812 Ga0081455_100418125 172
44 3300013296 Ga0157374_11293480 Ga0157374_112934802 172
45 3300005436 Ga0070713_100220092 Ga0070713_1002200922 173
46 3300005290 Ga0065712_10000743 Ga0065712_100007438 174
47 3300005293 Ga0065715_10000498 Ga0065715_1000049810 174
48 3300005340 Ga0070689_100062492 Ga0070689_1000624923 174
49 3300005445 Ga0070708_100088506 Ga0070708_1000885063 174
50 3300005467 Ga0070706_100000339 Ga0070706_10000033936 174
51 3300005467 Ga0070706_100013153 Ga0070706_1000131535 174
52 3300005468 Ga0070707_100186156 Ga0070707_1001861562 174
53 3300005471 Ga0070698_100180108 Ga0070698_1001801082 174
54 3300005471 Ga0070698_100361636 Ga0070698_1003616362 174
55 3300005518 Ga0070699_100544001 Ga0070699_1005440012 174
56 3300006175 Ga0070712_100063004 Ga0070712_1000630042 174
57 3300014325 Ga0163163_10311040 Ga0163163_103110402 174
58 3300014968 Ga0157379_10145567 Ga0157379_101455672 174
59 3300025900 Ga0207710_10170959 Ga0207710_101709591 174
60 3300025910 Ga0207684_10000276 Ga0207684_1000027623 174
61 3300025910 Ga0207684_10011637 Ga0207684_100116376 174
62 3300025915 Ga0207693_10057166 Ga0207693_100571663 174
63 3300025922 Ga0207646_10067553 Ga0207646_100675534 174
64 3300025936 Ga0207670_10333096 Ga0207670_103330962 174
65 3300025939 Ga0207665_10033284 Ga0207665_100332842 174
66 3300048904 Ga0496101_0329202 Ga0496101_0329202_339_890 174
67 3300048905 Ga0496102_0028285 Ga0496102_0028285_1436_1987 174
68 3300048907 Ga0496104_0064037 Ga0496104_0064037_1702_2253 174
69 3300048908 Ga0496105_0852123 Ga0496105_0852123_78_629 174
70 3300048911 Ga0496108_0025515 Ga0496108_0025515_4043_4594 174
71 3300048912 Ga0496109_0007567 Ga0496109_0007567_5072_5623 174
72 3300048915 Ga0496112_0034175 Ga0496112_0034175_2901_3452 174
73 3300048918 Ga0496115_0206830 Ga0496115_0206830_1040_1591 174
74 3300005334 Ga0068869_100234661 Ga0068869_1002346612 175
75 3300005354 Ga0070675_100514029 Ga0070675_1005140291 175
76 3300005467 Ga0070706_100223200 Ga0070706_1002232002 175
77 3300009553 Ga0105249_10362235 Ga0105249_103622353 175
78 3300013297 Ga0157378_10052801 Ga0157378_100528015 175
79 3300025911 Ga0207654_10056090 Ga0207654_100560902 175
80 3300035089 Ga0373944_0052727 Ga0373944_0052727_578_1105 175
81 3300035170 Ga0373943_0267870 Ga0373943_0267870_33_560 175
82 3300035171 Ga0373946_0094934 Ga0373946_0094934_622_1149 175
83 3300035171 Ga0373946_0479729 Ga0373946_0479729_17_544 175
84 3300035692 Ga0373935_0031307 Ga0373935_0031307_2549_3076 175
85 3300035695 Ga0373927_0215533 Ga0373927_0215533_226_753 175
86 3300035724 Ga0373933_0082349 Ga0373933_0082349_227_754 175
87 3300035725 Ga0373947_0132783 Ga0373947_0132783_227_754 175
88 3300035725 Ga0373947_0186010 Ga0373947_0186010_351_878 175
89 3300035725 Ga0373947_0476840 Ga0373947_0476840_128_655 175
90 3300037068 Ga0373925_0027165 Ga0373925_0027165_2857_3384 175
91 3300037068 Ga0373925_0122764 Ga0373925_0122764_445_972 175
92 3300037312 Ga0395899_0845924 Ga0395899_0845924_17_547 175
93 3300037418 Ga0395900_1018914 Ga0395900_1018914_156_683 175
94 3300041496 Ga0451839_0929501 Ga0451839_0929501_459_986 175
95 3300046459 Ga0495629_0268043 Ga0495629_0268043_550_1077 175
96 3300046463 Ga0495653_0250399 Ga0495653_0250399_478_1005 175
97 3300046475 Ga0495639_0092171 Ga0495639_0092171_645_1172 175
98 3300046499 Ga0495594_0025738 Ga0495594_0025738_1489_2016 175
99 3300046514 Ga0495618_0153917 Ga0495618_0153917_849_1376 175
100 3300046537 Ga0495598_0065016 Ga0495598_0065016_592_1119 175
101 3300046642 Ga0495634_0619095 Ga0495634_0619095_37_564 175
102 3300046679 Ga0495623_0185280 Ga0495623_0185280_489_1016 175
103 3300046681 Ga0495647_0096680 Ga0495647_0096680_259_786 175
104 3300046683 Ga0495658_0052907 Ga0495658_0052907_1695_2222 175
105 3300046684 Ga0495669_0046049 Ga0495669_0046049_102_629 175
106 3300046690 Ga0495624_0176822 Ga0495624_0176822_324_851 175
107 3300046809 Ga0495600_0578329 Ga0495600_0578329_22_549 175
108 3300047315 Ga0495581_0065519 Ga0495581_0065519_1308_1835 175
109 3300047319 Ga0495674_0226158 Ga0495674_0226158_18_545 175
110 3300047673 Ga0495593_0126960 Ga0495593_0126960_214_741 175
111 3300048906 Ga0496103_0080463 Ga0496103_0080463_1420_1947 175
112 3300048914 Ga0496111_0900615 Ga0496111_0900615_17_544 175
113 3300048915 Ga0496112_0334221 Ga0496112_0334221_151_678 175
114 3300048915 Ga0496112_0527272 Ga0496112_0527272_350_877 175
115 3300048915 Ga0496112_0605150 Ga0496112_0605150_417_944 175
116 3300053084 Ga0495595_0076554 Ga0495595_0076554_1043_1570 175
117 3300005445 Ga0070708_100305570 Ga0070708_1003055702 176
118 3300017792 Ga0163161_10530323 Ga0163161_105303231 176
119 3300002070 JGI24750J21931_1012519 JGI24750J21931_10125192 177
120 3300002126 JGI24035J26624_1002889 JGI24035J26624_10028892 177
121 3300005328 Ga0070676_10015061 Ga0070676_100150611 177
122 3300005334 Ga0068869_100010782 Ga0068869_1000107823 177
123 3300005338 Ga0068868_100156181 Ga0068868_1001561812 177
124 3300005339 Ga0070660_100109381 Ga0070660_1001093812 177
125 3300005340 Ga0070689_100014684 Ga0070689_1000146846 177
126 3300005343 Ga0070687_100015846 Ga0070687_1000158462 177
127 3300005347 Ga0070668_100013399 Ga0070668_1000133992 177
128 3300005353 Ga0070669_100016524 Ga0070669_1000165242 177
129 3300005354 Ga0070675_100007020 Ga0070675_1000070206 177
130 3300005366 Ga0070659_100017051 Ga0070659_1000170516 177
131 3300005367 Ga0070667_100018582 Ga0070667_1000185826 177
132 3300005437 Ga0070710_10091139 Ga0070710_100911392 177
133 3300005439 Ga0070711_100136342 Ga0070711_1001363423 177
134 3300005445 Ga0070708_100853247 Ga0070708_1008532471 177
135 3300005455 Ga0070663_100027336 Ga0070663_1000273364 177
136 3300005457 Ga0070662_100001847 Ga0070662_1000018475 177
137 3300005535 Ga0070684_100019429 Ga0070684_1000194295 177
138 3300005539 Ga0068853_101111876 Ga0068853_1011118761 177
139 3300005564 Ga0070664_100964762 Ga0070664_1009647621 177
140 3300005843 Ga0068860_100023997 Ga0068860_1000239972 177
141 3300005844 Ga0068862_100051326 Ga0068862_1000513265 177
142 3300005983 Ga0081540_1105686 Ga0081540_11056862 177
143 3300006163 Ga0070715_10298201 Ga0070715_102982012 177
144 3300006175 Ga0070712_100040418 Ga0070712_1000404183 177
145 3300006852 Ga0075433_10892098 Ga0075433_108920981 177
146 3300009093 Ga0105240_10808136 Ga0105240_108081362 177
147 3300009098 Ga0105245_10094451 Ga0105245_100944512 177
148 3300009148 Ga0105243_10893895 Ga0105243_108938951 177
149 3300009545 Ga0105237_10951825 Ga0105237_109518252 177
150 3300009553 Ga0105249_10030100 Ga0105249_100301005 177
151 3300010375 Ga0105239_10011346 Ga0105239_100113467 177
152 3300011119 Ga0105246_10070808 Ga0105246_100708082 177
153 3300013296 Ga0157374_10018203 Ga0157374_100182035 177
154 3300013297 Ga0157378_10197829 Ga0157378_101978294 177
155 3300013306 Ga0163162_10010679 Ga0163162_100106796 177
156 3300013308 Ga0157375_11078286 Ga0157375_110782862 177
157 3300014325 Ga0163163_10231397 Ga0163163_102313972 177
158 3300025315 Ga0207697_10002609 Ga0207697_100026096 177
159 3300025901 Ga0207688_10207565 Ga0207688_102075652 177
160 3300025904 Ga0207647_10150291 Ga0207647_101502912 177
161 3300025907 Ga0207645_10007044 Ga0207645_100070446 177
162 3300025914 Ga0207671_10533735 Ga0207671_105337352 177
163 3300025915 Ga0207693_10004040 Ga0207693_100040409 177
164 3300025915 Ga0207693_10142275 Ga0207693_101422751 177
165 3300025916 Ga0207663_10630892 Ga0207663_106308922 177
166 3300025918 Ga0207662_10006705 Ga0207662_100067052 177
167 3300025919 Ga0207657_10043454 Ga0207657_100434544 177
168 3300025920 Ga0207649_10019808 Ga0207649_100198083 177
169 3300025923 Ga0207681_10004121 Ga0207681_100041217 177
170 3300025926 Ga0207659_10147386 Ga0207659_101473863 177
171 3300025927 Ga0207687_10204868 Ga0207687_102048682 177
172 3300025933 Ga0207706_10002099 Ga0207706_1000209914 177
173 3300025936 Ga0207670_10209018 Ga0207670_102090181 177
174 3300025942 Ga0207689_10038227 Ga0207689_100382274 177
175 3300025945 Ga0207679_11120282 Ga0207679_111202821 177
176 3300025961 Ga0207712_10026166 Ga0207712_100261662 177
177 3300025972 Ga0207668_10009977 Ga0207668_100099776 177
178 3300025986 Ga0207658_10017925 Ga0207658_100179255 177
179 3300026023 Ga0207677_10132978 Ga0207677_101329782 177
180 3300026067 Ga0207678_10021102 Ga0207678_100211025 177
181 3300028381 Ga0268264_10119843 Ga0268264_101198431 177
182 3300045051 Ga0451576_0025769 Ga0451576_0025769_532_1083 177
183 3300014745 Ga0157377_10338359 Ga0157377_103383592 178
184 3300050512 nmdc:mga0n895_314015_c1 nmdc:mga0n895_314015_c1_638_1195 178
185 3300005272 Ga0065703_1019677 Ga0065703_10196773 179
186 3300006175 Ga0070712_101009824 Ga0070712_1010098242 179
187 3300013100 Ga0157373_10793866 Ga0157373_107938662 179
188 3300035170 Ga0373943_0249618 Ga0373943_0249618_17_559 179
189 3300046674 Ga0495588_0540922 Ga0495588_0540922_16_558 179
190 3300048915 Ga0496112_0305463 Ga0496112_0305463_531_1073 179
191 3300039450 Ga0436363_1341675 Ga0436363_1341675_307_849 180
192 3300000545 CNXas_1000045 CNXas_10000453 181
193 3300005340 Ga0070689_101412422 Ga0070689_1014124221 181
194 3300005457 Ga0070662_100726232 Ga0070662_1007262322 181
195 3300006881 Ga0068865_100257833 Ga0068865_1002578332 181
196 3300009098 Ga0105245_11406218 Ga0105245_114062181 181
197 3300014969 Ga0157376_10087782 Ga0157376_100877824 181
198 3300037068 Ga0373925_0629881 Ga0373925_0629881_80_628 181
199 3300001979 JGI24740J21852_10018550 JGI24740J21852_100185501 182
200 3300001991 JGI24743J22301_10002352 JGI24743J22301_100023523 182
201 3300005290 Ga0065712_10003030 Ga0065712_100030308 182
202 3300005293 Ga0065715_10001221 Ga0065715_100012218 182
203 3300005329 Ga0070683_100001160 Ga0070683_1000011603 182
204 3300005335 Ga0070666_10045106 Ga0070666_100451063 182
205 3300005336 Ga0070680_100028050 Ga0070680_1000280504 182
206 3300005338 Ga0068868_100020457 Ga0068868_1000204575 182
207 3300005354 Ga0070675_100141747 Ga0070675_1001417474 182
208 3300005355 Ga0070671_100380069 Ga0070671_1003800692 182
209 3300005364 Ga0070673_100072780 Ga0070673_1000727804 182
210 3300005436 Ga0070713_100034708 Ga0070713_1000347085 182
211 3300005437 Ga0070710_10047448 Ga0070710_100474482 182
212 3300005455 Ga0070663_100030086 Ga0070663_1000300862 182
213 3300005456 Ga0070678_100018503 Ga0070678_1000185032 182
214 3300005458 Ga0070681_10007306 Ga0070681_100073068 182
215 3300005466 Ga0070685_10083892 Ga0070685_100838922 182
216 3300005468 Ga0070707_101086040 Ga0070707_1010860402 182
217 3300005530 Ga0070679_100134560 Ga0070679_1001345604 182
218 3300005535 Ga0070684_100022922 Ga0070684_1000229221 182
219 3300005547 Ga0070693_100439785 Ga0070693_1004397852 182
220 3300005548 Ga0070665_100033252 Ga0070665_1000332521 182
221 3300005614 Ga0068856_100204964 Ga0068856_1002049642 182
222 3300005843 Ga0068860_100676602 Ga0068860_1006766022 182
223 3300006028 Ga0070717_10002989 Ga0070717_100029896 182
224 3300006028 Ga0070717_10028994 Ga0070717_100289945 182
225 3300006237 Ga0097621_100035590 Ga0097621_1000355902 182
226 3300006358 Ga0068871_100083945 Ga0068871_1000839453 182
227 3300009098 Ga0105245_10296930 Ga0105245_102969302 182
228 3300009101 Ga0105247_10481337 Ga0105247_104813372 182
229 3300009174 Ga0105241_10112915 Ga0105241_101129152 182
230 3300009177 Ga0105248_10676437 Ga0105248_106764371 182
231 3300013102 Ga0157371_10120829 Ga0157371_101208292 182
232 3300013104 Ga0157370_10138585 Ga0157370_101385852 182
233 3300013105 Ga0157369_10029470 Ga0157369_1002947010 182
234 3300013296 Ga0157374_10043729 Ga0157374_100437293 182
235 3300013297 Ga0157378_10831336 Ga0157378_108313362 182
236 3300013307 Ga0157372_10146547 Ga0157372_101465472 182
237 3300013308 Ga0157375_10018938 Ga0157375_100189385 182
238 3300014969 Ga0157376_10898592 Ga0157376_108985922 182
239 3300025315 Ga0207697_10007405 Ga0207697_100074055 182
240 3300025901 Ga0207688_10115308 Ga0207688_101153082 182
241 3300025903 Ga0207680_10176824 Ga0207680_101768242 182
242 3300025912 Ga0207707_10048004 Ga0207707_100480043 182
243 3300025917 Ga0207660_10104664 Ga0207660_101046643 182
244 3300025921 Ga0207652_10018051 Ga0207652_100180514 182
245 3300025922 Ga0207646_10781003 Ga0207646_107810032 182
246 3300025926 Ga0207659_10157156 Ga0207659_101571562 182
247 3300025927 Ga0207687_10169395 Ga0207687_101693952 182
248 3300025928 Ga0207700_10342903 Ga0207700_103429032 182
249 3300025929 Ga0207664_10216193 Ga0207664_102161932 182
250 3300025931 Ga0207644_10065887 Ga0207644_100658872 182
251 3300025941 Ga0207711_10739115 Ga0207711_107391152 182
252 3300025942 Ga0207689_10241008 Ga0207689_102410082 182
253 3300025944 Ga0207661_10016865 Ga0207661_100168656 182
254 3300025945 Ga0207679_10410843 Ga0207679_104108432 182
255 3300025960 Ga0207651_10032291 Ga0207651_100322914 182
256 3300026023 Ga0207677_10011998 Ga0207677_100119985 182
257 3300026078 Ga0207702_10135196 Ga0207702_101351963 182
258 3300026121 Ga0207683_10240052 Ga0207683_102400522 182
259 3300028379 Ga0268266_10046725 Ga0268266_100467253 182
260 3300046463 Ga0495653_0389325 Ga0495653_0389325_118_666 182
261 3300046517 Ga0495630_0078442 Ga0495630_0078442_318_866 182
262 3300046642 Ga0495634_0334744 Ga0495634_0334744_21_569 182
263 3300048903 Ga0496100_0205696 Ga0496100_0205696_809_1357 182
264 3300048908 Ga0496105_0175184 Ga0496105_0175184_117_665 182
265 3300048917 Ga0496114_0070039 Ga0496114_0070039_1033_1581 182
266 3300048918 Ga0496115_0075949 Ga0496115_0075949_1104_1652 182
267 2162886006 SwRhRL3b_contig_693613 SwRhRL3b_0949.00000280 183
268 3300002126 JGI24035J26624_1003259 JGI24035J26624_10032592 183
269 3300003203 JGI25406J46586_10000001 JGI25406J46586_10000001168 183
270 3300003203 JGI25406J46586_10000007 JGI25406J46586_10000007105 183
271 3300003911 JGI25405J52794_10000331 JGI25405J52794_100003319 183
272 3300003911 JGI25405J52794_10001309 JGI25405J52794_100013095 183
273 3300005289 Ga0065704_10029589 Ga0065704_100295891 183
274 3300005290 Ga0065712_10007741 Ga0065712_100077412 183
275 3300005293 Ga0065715_10008852 Ga0065715_100088524 183
276 3300005293 Ga0065715_10010129 Ga0065715_100101292 183
277 3300005293 Ga0065715_10010802 Ga0065715_100108024 183
278 3300005293 Ga0065715_10143106 Ga0065715_101431062 183
279 3300005293 Ga0065715_10307833 Ga0065715_103078332 183
280 3300005293 Ga0065715_10435794 Ga0065715_104357941 183
281 3300005295 Ga0065707_10022448 Ga0065707_100224483 183
282 3300005295 Ga0065707_10186400 Ga0065707_101864002 183
283 3300005327 Ga0070658_10181132 Ga0070658_101811322 183
284 3300005328 Ga0070676_10077478 Ga0070676_100774782 183
285 3300005328 Ga0070676_10480469 Ga0070676_104804691 183
286 3300005329 Ga0070683_100221816 Ga0070683_1002218162 183
287 3300005330 Ga0070690_100002449 Ga0070690_1000024495 183
288 3300005330 Ga0070690_100032220 Ga0070690_1000322203 183
289 3300005333 Ga0070677_10030267 Ga0070677_100302672 183
290 3300005335 Ga0070666_10202014 Ga0070666_102020142 183
291 3300005338 Ga0068868_100191396 Ga0068868_1001913961 183
292 3300005340 Ga0070689_100002648 Ga0070689_10000264813 183
293 3300005345 Ga0070692_10169313 Ga0070692_101693132 183
294 3300005347 Ga0070668_100019031 Ga0070668_1000190312 183
295 3300005353 Ga0070669_100017297 Ga0070669_1000172976 183
296 3300005354 Ga0070675_100009289 Ga0070675_1000092895 183
297 3300005354 Ga0070675_100060920 Ga0070675_1000609204 183
298 3300005354 Ga0070675_100195249 Ga0070675_1001952492 183
299 3300005355 Ga0070671_100462105 Ga0070671_1004621052 183
300 3300005355 Ga0070671_100674109 Ga0070671_1006741091 183
301 3300005355 Ga0070671_100989732 Ga0070671_1009897321 183
302 3300005356 Ga0070674_100000780 Ga0070674_1000007805 183
303 3300005364 Ga0070673_100014849 Ga0070673_1000148493 183
304 3300005365 Ga0070688_100003944 Ga0070688_1000039446 183
305 3300005366 Ga0070659_100146967 Ga0070659_1001469673 183
306 3300005367 Ga0070667_100026680 Ga0070667_1000266804 183
307 3300005434 Ga0070709_10009751 Ga0070709_100097515 183
308 3300005434 Ga0070709_10602243 Ga0070709_106022431 183
309 3300005435 Ga0070714_100030203 Ga0070714_1000302032 183
310 3300005435 Ga0070714_100138478 Ga0070714_1001384782 183
311 3300005435 Ga0070714_100237878 Ga0070714_1002378783 183
312 3300005436 Ga0070713_100004806 Ga0070713_1000048063 183
313 3300005436 Ga0070713_100159196 Ga0070713_1001591962 183
314 3300005436 Ga0070713_100628440 Ga0070713_1006284402 183
315 3300005437 Ga0070710_10050623 Ga0070710_100506233 183
316 3300005439 Ga0070711_100012285 Ga0070711_1000122852 183
317 3300005440 Ga0070705_100024037 Ga0070705_1000240373 183
318 3300005440 Ga0070705_100055659 Ga0070705_1000556594 183
319 3300005441 Ga0070700_100192845 Ga0070700_1001928452 183
320 3300005445 Ga0070708_100029555 Ga0070708_1000295553 183
321 3300005445 Ga0070708_100120626 Ga0070708_1001206262 183
322 3300005445 Ga0070708_100158335 Ga0070708_1001583353 183
323 3300005445 Ga0070708_100167112 Ga0070708_1001671122 183
324 3300005445 Ga0070708_100274466 Ga0070708_1002744662 183
325 3300005445 Ga0070708_100516602 Ga0070708_1005166022 183
326 3300005457 Ga0070662_100120079 Ga0070662_1001200793 183
327 3300005458 Ga0070681_11092852 Ga0070681_110928522 183
328 3300005466 Ga0070685_10072563 Ga0070685_100725632 183
329 3300005467 Ga0070706_100013001 Ga0070706_1000130014 183
330 3300005467 Ga0070706_100081435 Ga0070706_1000814352 183
331 3300005467 Ga0070706_100101407 Ga0070706_1001014072 183
332 3300005467 Ga0070706_100491390 Ga0070706_1004913901 183
333 3300005467 Ga0070706_100839690 Ga0070706_1008396902 183
334 3300005468 Ga0070707_100002484 Ga0070707_1000024845 183
335 3300005468 Ga0070707_100006579 Ga0070707_1000065793 183
336 3300005468 Ga0070707_100011119 Ga0070707_1000111195 183
337 3300005468 Ga0070707_100016462 Ga0070707_1000164627 183
338 3300005468 Ga0070707_100232250 Ga0070707_1002322501 183
339 3300005471 Ga0070698_100012903 Ga0070698_1000129034 183
340 3300005471 Ga0070698_100044664 Ga0070698_1000446642 183
341 3300005471 Ga0070698_100058377 Ga0070698_1000583774 183
342 3300005471 Ga0070698_100370848 Ga0070698_1003708483 183
343 3300005518 Ga0070699_100017866 Ga0070699_1000178663 183
344 3300005518 Ga0070699_100265497 Ga0070699_1002654972 183
345 3300005518 Ga0070699_100415799 Ga0070699_1004157992 183
346 3300005518 Ga0070699_101103655 Ga0070699_1011036551 183
347 3300005535 Ga0070684_100000906 Ga0070684_10000090610 183
348 3300005535 Ga0070684_100103646 Ga0070684_1001036462 183
349 3300005536 Ga0070697_100015146 Ga0070697_1000151462 183
350 3300005536 Ga0070697_100021041 Ga0070697_1000210414 183
351 3300005536 Ga0070697_100027961 Ga0070697_1000279615 183
352 3300005536 Ga0070697_100028727 Ga0070697_1000287275 183
353 3300005536 Ga0070697_100034881 Ga0070697_1000348816 183
354 3300005536 Ga0070697_100040378 Ga0070697_1000403785 183
355 3300005536 Ga0070697_100096273 Ga0070697_1000962732 183
356 3300005536 Ga0070697_100147317 Ga0070697_1001473172 183
357 3300005536 Ga0070697_100332579 Ga0070697_1003325792 183
358 3300005543 Ga0070672_100074720 Ga0070672_1000747201 183
359 3300005543 Ga0070672_100223865 Ga0070672_1002238652 183
360 3300005544 Ga0070686_100139294 Ga0070686_1001392942 183
361 3300005548 Ga0070665_100118510 Ga0070665_1001185102 183
362 3300005548 Ga0070665_100693235 Ga0070665_1006932352 183
363 3300005549 Ga0070704_100013053 Ga0070704_1000130532 183
364 3300005549 Ga0070704_100057908 Ga0070704_1000579082 183
365 3300005578 Ga0068854_101200740 Ga0068854_1012007402 183
366 3300005614 Ga0068856_100394941 Ga0068856_1003949412 183
367 3300005616 Ga0068852_100578260 Ga0068852_1005782601 183
368 3300005618 Ga0068864_100105926 Ga0068864_1001059263 183
369 3300005718 Ga0068866_10089768 Ga0068866_100897682 183
370 3300005842 Ga0068858_100294132 Ga0068858_1002941322 183
371 3300005842 Ga0068858_100702051 Ga0068858_1007020512 183
372 3300005843 Ga0068860_100012546 Ga0068860_1000125464 183
373 3300005843 Ga0068860_100242077 Ga0068860_1002420772 183
374 3300005844 Ga0068862_100633512 Ga0068862_1006335122 183
375 3300005937 Ga0081455_10000314 Ga0081455_1000031447 183
376 3300005937 Ga0081455_10000959 Ga0081455_1000095915 183
377 3300005937 Ga0081455_10005232 Ga0081455_1000523214 183
378 3300005937 Ga0081455_10015384 Ga0081455_100153844 183
379 3300005937 Ga0081455_10049009 Ga0081455_100490092 183
380 3300005983 Ga0081540_1000016 Ga0081540_100001611 183
381 3300005983 Ga0081540_1024398 Ga0081540_10243982 183
382 3300005985 Ga0081539_10000014 Ga0081539_10000014274 183
383 3300005985 Ga0081539_10036270 Ga0081539_100362702 183
384 3300006028 Ga0070717_10037682 Ga0070717_100376822 183
385 3300006028 Ga0070717_10154153 Ga0070717_101541532 183
386 3300006028 Ga0070717_10827050 Ga0070717_108270502 183
387 3300006163 Ga0070715_10214124 Ga0070715_102141241 183
388 3300006173 Ga0070716_100039273 Ga0070716_1000392732 183
389 3300006173 Ga0070716_100071576 Ga0070716_1000715762 183
390 3300006173 Ga0070716_100375522 Ga0070716_1003755222 183
391 3300006173 Ga0070716_101183426 Ga0070716_1011834261 183
392 3300006175 Ga0070712_100070560 Ga0070712_1000705602 183
393 3300006175 Ga0070712_100081693 Ga0070712_1000816932 183
394 3300006175 Ga0070712_100130567 Ga0070712_1001305673 183
395 3300006175 Ga0070712_101074313 Ga0070712_1010743132 183
396 3300006175 Ga0070712_101132725 Ga0070712_1011327252 183
397 3300006871 Ga0075434_100315802 Ga0075434_1003158022 183
398 3300006881 Ga0068865_100034788 Ga0068865_1000347882 183
399 3300006914 Ga0075436_100134397 Ga0075436_1001343972 183
400 3300007265 Ga0099794_10186454 Ga0099794_101864542 183
401 3300007788 Ga0099795_10002031 Ga0099795_100020315 183
402 3300007788 Ga0099795_10007257 Ga0099795_100072574 183
403 3300009094 Ga0111539_10104757 Ga0111539_101047572 183
404 3300009098 Ga0105245_10531666 Ga0105245_105316662 183
405 3300009098 Ga0105245_10966590 Ga0105245_109665902 183
406 3300009147 Ga0114129_10826009 Ga0114129_108260092 183
407 3300009148 Ga0105243_10637500 Ga0105243_106375002 183
408 3300009176 Ga0105242_10116091 Ga0105242_101160912 183
409 3300009176 Ga0105242_10136501 Ga0105242_101365011 183
410 3300009545 Ga0105237_10122402 Ga0105237_101224022 183
411 3300009545 Ga0105237_10889363 Ga0105237_108893631 183
412 3300010159 Ga0099796_10002908 Ga0099796_100029082 183
413 3300010159 Ga0099796_10111074 Ga0099796_101110742 183
414 3300012512 Ga0157327_1004405 Ga0157327_10044052 183
415 3300012515 Ga0157338_1010564 Ga0157338_10105642 183
416 3300013102 Ga0157371_10615544 Ga0157371_106155441 183
417 3300013105 Ga0157369_10515238 Ga0157369_105152382 183
418 3300013296 Ga0157374_10124964 Ga0157374_101249643 183
419 3300013296 Ga0157374_10130760 Ga0157374_101307602 183
420 3300013296 Ga0157374_10176130 Ga0157374_101761302 183
421 3300013296 Ga0157374_11219120 Ga0157374_112191202 183
422 3300013297 Ga0157378_10008313 Ga0157378_100083137 183
423 3300013297 Ga0157378_10849896 Ga0157378_108498962 183
424 3300013297 Ga0157378_11786480 Ga0157378_117864801 183
425 3300013306 Ga0163162_10043125 Ga0163162_100431253 183
426 3300013306 Ga0163162_10202920 Ga0163162_102029202 183
427 3300013306 Ga0163162_10228506 Ga0163162_102285062 183
428 3300013307 Ga0157372_10084908 Ga0157372_100849082 183
429 3300013307 Ga0157372_10152490 Ga0157372_101524902 183
430 3300013308 Ga0157375_10233657 Ga0157375_102336573 183
431 3300013308 Ga0157375_10321922 Ga0157375_103219222 183
432 3300013308 Ga0157375_10571852 Ga0157375_105718522 183
433 3300014325 Ga0163163_10413183 Ga0163163_104131832 183
434 3300014325 Ga0163163_10414470 Ga0163163_104144702 183
435 3300014497 Ga0182008_10026360 Ga0182008_100263603 183
436 3300014969 Ga0157376_10031020 Ga0157376_100310205 183
437 3300014969 Ga0157376_10478669 Ga0157376_104786692 183
438 3300015265 Ga0182005_1010277 Ga0182005_10102772 183
439 3300017792 Ga0163161_10111116 Ga0163161_101111164 183
440 3300025271 Ga0207666_1002361 Ga0207666_10023612 183
441 3300025271 Ga0207666_1036648 Ga0207666_10366482 183
442 3300025290 Ga0207673_1004308 Ga0207673_10043082 183
443 3300025290 Ga0207673_1006416 Ga0207673_10064162 183
444 3300025315 Ga0207697_10000283 Ga0207697_1000028312 183
445 3300025315 Ga0207697_10000681 Ga0207697_1000068117 183
446 3300025315 Ga0207697_10006249 Ga0207697_100062495 183
447 3300025315 Ga0207697_10028652 Ga0207697_100286522 183
448 3300025315 Ga0207697_10322936 Ga0207697_103229361 183
449 3300025885 Ga0207653_10015114 Ga0207653_100151144 183
450 3300025893 Ga0207682_10016117 Ga0207682_100161174 183
451 3300025898 Ga0207692_10124997 Ga0207692_101249972 183
452 3300025901 Ga0207688_10002322 Ga0207688_100023229 183
453 3300025904 Ga0207647_10005474 Ga0207647_100054745 183
454 3300025905 Ga0207685_10006553 Ga0207685_100065534 183
455 3300025906 Ga0207699_10027500 Ga0207699_100275002 183
456 3300025907 Ga0207645_10001228 Ga0207645_100012285 183
457 3300025909 Ga0207705_10426776 Ga0207705_104267761 183
458 3300025910 Ga0207684_10019577 Ga0207684_100195779 183
459 3300025910 Ga0207684_10047164 Ga0207684_100471642 183
460 3300025910 Ga0207684_10069067 Ga0207684_100690672 183
461 3300025910 Ga0207684_10082108 Ga0207684_100821083 183
462 3300025910 Ga0207684_10159963 Ga0207684_101599634 183
463 3300025910 Ga0207684_10286517 Ga0207684_102865172 183
464 3300025915 Ga0207693_10040626 Ga0207693_100406263 183
465 3300025915 Ga0207693_10050893 Ga0207693_100508932 183
466 3300025916 Ga0207663_10011079 Ga0207663_100110794 183
467 3300025916 Ga0207663_10040250 Ga0207663_100402503 183
468 3300025918 Ga0207662_10081717 Ga0207662_100817172 183
469 3300025919 Ga0207657_10382983 Ga0207657_103829832 183
470 3300025920 Ga0207649_10369416 Ga0207649_103694162 183
471 3300025922 Ga0207646_10003213 Ga0207646_100032135 183
472 3300025922 Ga0207646_10005702 Ga0207646_100057023 183
473 3300025922 Ga0207646_10021461 Ga0207646_100214615 183
474 3300025922 Ga0207646_10048382 Ga0207646_100483822 183
475 3300025922 Ga0207646_10275548 Ga0207646_102755482 183
476 3300025922 Ga0207646_10824631 Ga0207646_108246311 183
477 3300025923 Ga0207681_10367123 Ga0207681_103671232 183
478 3300025923 Ga0207681_11095656 Ga0207681_110956561 183
479 3300025924 Ga0207694_11139538 Ga0207694_111395381 183
480 3300025925 Ga0207650_10651867 Ga0207650_106518672 183
481 3300025926 Ga0207659_10005770 Ga0207659_100057708 183
482 3300025926 Ga0207659_10005985 Ga0207659_100059853 183
483 3300025926 Ga0207659_10227596 Ga0207659_102275962 183
484 3300025928 Ga0207700_10096336 Ga0207700_100963362 183
485 3300025929 Ga0207664_10126294 Ga0207664_101262942 183
486 3300025929 Ga0207664_10129312 Ga0207664_101293122 183
487 3300025929 Ga0207664_10311419 Ga0207664_103114192 183
488 3300025931 Ga0207644_10155407 Ga0207644_101554073 183
489 3300025931 Ga0207644_10330899 Ga0207644_103308992 183
490 3300025931 Ga0207644_10754296 Ga0207644_107542961 183
491 3300025932 Ga0207690_10091569 Ga0207690_100915693 183
492 3300025933 Ga0207706_10056139 Ga0207706_100561394 183
493 3300025933 Ga0207706_10123205 Ga0207706_101232052 183
494 3300025933 Ga0207706_10124287 Ga0207706_101242872 183
495 3300025933 Ga0207706_10262968 Ga0207706_102629683 183
496 3300025934 Ga0207686_10081096 Ga0207686_100810961 183
497 3300025936 Ga0207670_10005975 Ga0207670_100059752 183
498 3300025937 Ga0207669_10095655 Ga0207669_100956552 183
499 3300025937 Ga0207669_10651924 Ga0207669_106519241 183
500 3300025938 Ga0207704_10109564 Ga0207704_101095643 183
501 3300025939 Ga0207665_10004405 Ga0207665_100044058 183
502 3300025939 Ga0207665_10160231 Ga0207665_101602312 183
503 3300025939 Ga0207665_10242195 Ga0207665_102421952 183
504 3300025939 Ga0207665_10267526 Ga0207665_102675262 183
505 3300025939 Ga0207665_10751627 Ga0207665_107516271 183
506 3300025939 Ga0207665_10956523 Ga0207665_109565232 183
507 3300025940 Ga0207691_10001630 Ga0207691_100016305 183
508 3300025942 Ga0207689_10147016 Ga0207689_101470162 183
509 3300025944 Ga0207661_10431376 Ga0207661_104313762 183
510 3300025945 Ga0207679_10274705 Ga0207679_102747052 183
511 3300025960 Ga0207651_10032847 Ga0207651_100328471 183
512 3300025960 Ga0207651_10118809 Ga0207651_101188092 183
513 3300025972 Ga0207668_10124106 Ga0207668_101241062 183
514 3300025972 Ga0207668_10573047 Ga0207668_105730471 183
515 3300025986 Ga0207658_10130796 Ga0207658_101307962 183
516 3300025986 Ga0207658_10277751 Ga0207658_102777512 183
517 3300026035 Ga0207703_10399611 Ga0207703_103996112 183
518 3300026035 Ga0207703_10810343 Ga0207703_108103432 183
519 3300026067 Ga0207678_10651110 Ga0207678_106511102 183
520 3300026075 Ga0207708_10051341 Ga0207708_100513413 183
521 3300026088 Ga0207641_10158525 Ga0207641_101585254 183
522 3300026089 Ga0207648_10131171 Ga0207648_101311711 183
523 3300026095 Ga0207676_10525297 Ga0207676_105252972 183
524 3300026116 Ga0207674_10510817 Ga0207674_105108172 183
525 3300026118 Ga0207675_100118653 Ga0207675_1001186532 183
526 3300026121 Ga0207683_10018640 Ga0207683_100186407 183
527 3300026121 Ga0207683_10062891 Ga0207683_100628913 183
528 3300026121 Ga0207683_10266044 Ga0207683_102660442 183
529 3300026142 Ga0207698_10326781 Ga0207698_103267812 183
530 3300027252 Ga0209973_1019799 Ga0209973_10197992 183
531 3300027512 Ga0209179_1012944 Ga0209179_10129442 183
532 3300027617 Ga0210002_1004868 Ga0210002_10048682 183
533 3300027682 Ga0209971_1021268 Ga0209971_10212682 183
534 3300027717 Ga0209998_10011390 Ga0209998_100113902 183
535 3300028379 Ga0268266_10031046 Ga0268266_100310462 183
536 3300028379 Ga0268266_10068131 Ga0268266_100681312 183
537 3300028379 Ga0268266_10111515 Ga0268266_101115152 183
538 3300028381 Ga0268264_10009325 Ga0268264_100093254 183
539 3300028381 Ga0268264_10353569 Ga0268264_103535692 183
540 3300035089 Ga0373944_0079782 Ga0373944_0079782_89_640 183
541 3300035113 Ga0373936_0303549 Ga0373936_0303549_142_693 183
542 3300035171 Ga0373946_0015546 Ga0373946_0015546_1538_2089 183
543 3300035691 Ga0373931_0146795 Ga0373931_0146795_419_970 183
544 3300035695 Ga0373927_0285902 Ga0373927_0285902_152_703 183
545 3300035725 Ga0373947_0019989 Ga0373947_0019989_223_774 183
546 3300035725 Ga0373947_0437293 Ga0373947_0437293_283_834 183
547 3300037068 Ga0373925_0062700 Ga0373925_0062700_1209_1760 183
548 3300037068 Ga0373925_0087360 Ga0373925_0087360_1417_1986 183
549 3300037418 Ga0395900_1043134 Ga0395900_1043134_67_621 183
550 3300037853 Ga0436364_1130765 Ga0436364_1130765_268_828 183
551 3300038443 Ga0395901_0957845 Ga0395901_0957845_230_784 183
552 3300041512 Ga0451853_3717991 Ga0451853_3717991_386_940 183
553 3300046473 Ga0495582_0038820 Ga0495582_0038820_2030_2581 183
554 3300046476 Ga0495662_0060765 Ga0495662_0060765_1230_1781 183
555 3300046523 Ga0495644_0121506 Ga0495644_0121506_28_579 183
556 3300046615 Ga0495656_0173897 Ga0495656_0173897_451_1002 183
557 3300048903 Ga0496100_0013450 Ga0496100_0013450_508_1059 183
558 3300048904 Ga0496101_0030095 Ga0496101_0030095_2040_2591 183
559 3300048905 Ga0496102_0103744 Ga0496102_0103744_1451_2002 183
560 3300048906 Ga0496103_0016087 Ga0496103_0016087_1625_2176 183
561 3300048907 Ga0496104_0186408 Ga0496104_0186408_1366_1917 183
562 3300048908 Ga0496105_0202510 Ga0496105_0202510_85_636 183
563 3300048909 Ga0496106_0003614 Ga0496106_0003614_1799_2350 183
564 3300048910 Ga0496107_0273656 Ga0496107_0273656_20_571 183
565 3300048911 Ga0496108_0248321 Ga0496108_0248321_809_1360 183
566 3300048913 Ga0496110_0022586 Ga0496110_0022586_1403_1954 183
567 3300048913 Ga0496110_0206993 Ga0496110_0206993_309_860 183
568 3300048915 Ga0496112_0023116 Ga0496112_0023116_5362_5913 183
569 3300048915 Ga0496112_0265788 Ga0496112_0265788_1005_1556 183
570 3300048917 Ga0496114_0180199 Ga0496114_0180199_586_1137 183
571 3300050507 nmdc:mga05p37_38407_c1 nmdc:mga05p37_38407_c1_4196_4747 183
572 3300050507 nmdc:mga05p37_740629_c1 nmdc:mga05p37_740629_c1_523_1074 183
573 3300050511 nmdc:mga08y16_423464_c1 nmdc:mga08y16_423464_c1_139_690 183
574 3300050514 nmdc:mga08x19_80221_c1 nmdc:mga08x19_80221_c1_1441_2004 183

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uvr-assembly1.cif.gz_A the core region of pilo from the type iv pilus system of pseudomonas aeruginosa 0.7486 90 183
2rjz-assembly1.cif.gz_B crystal structure of the type 4 fimbrial biogenesis protein pilo from pseudomonas aeruginosa 0.7319 64 177
2rjz-assembly1.cif.gz_A crystal structure of the type 4 fimbrial biogenesis protein pilo from pseudomonas aeruginosa 0.7247 64 177
6lad-assembly7.cif.gz_A crystal structure of amuc_1100 from akkermansia muciniphila 0.718 93 183
5uvr-assembly1.cif.gz_A the core region of pilo from the type iv pilus system of pseudomonas aeruginosa 0.7153 90 183
ID Description Score Start End Superfamily
2rjzB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.8472 90 177 3.30.70.60
af_P0ADG1_1_87_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7876 123 172 3.30.70.260
2rjzB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.783 90 177 3.30.70.60
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7608 84 118 3.30.300.20
af_P37051_4_77_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.6956 123 172 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A7W1CSA1-F1-model_v4 Uncharacterized protein 0.9422 67 183
AF-A0A7W1CSA1-F1-model_v4 Uncharacterized protein 0.9268 67 183
AF-A0A836SXJ2-F1-model_v4 Uncharacterized protein 0.9121 81 180
AF-A0A838N6K8-F1-model_v4 Type 4a pilus biogenesis protein PilO 0.8946 89 180 GO:0043107
GO:0043683
AF-A0A496K310-F1-model_v4 deleted 0.889 95 181

Feature Viewer

pLDDT pTM Quality
79.51 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map