F465231
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 573 | 345 | 1146 | 154 |
Family's Representative Sequence
| Representative Sequence | 3300046529|Ga0495652_0512195|Ga0495652_0512195_179_637 |
| Length | 146 |
| Sequence | VSSNVTIEIRQLPHGEGLALPAYQSAHAAGLDLLAAVPEASPLVLAPGKYALVPTGLTYEAQVRPRSGLAAKHGVTVLNAPGTVDADYRGEIGVLLINHGAAPFEIRRGERIAQMVIASVARAELVPVISLSSTERGSGGFGSTGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 47 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 48 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 49 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 77 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 78 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 126 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 127 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 128 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 129 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 130 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 132 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 136 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 137 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 138 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 139 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 140 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 141 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 142 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 143 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 144 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 145 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 146 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 147 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 150 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 151 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 152 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 155 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 156 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 157 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 159 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 160 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 161 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 166 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 167 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 168 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 169 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 170 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 171 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 172 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 173 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 174 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 232 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 233 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 234 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 235 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 236 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 239 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 240 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 241 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 242 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 243 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 244 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 245 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 246 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 247 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 248 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 249 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 250 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 251 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 252 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 253 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 254 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 255 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 288 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 289 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 290 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 291 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 294 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 298 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 299 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 300 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 301 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 302 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 303 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 304 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 305 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 306 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 307 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 308 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 309 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 310 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 311 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 312 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 313 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 314 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 315 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 316 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 317 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 318 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 319 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 320 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 321 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 322 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 323 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 324 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 325 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 326 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 327 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 328 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 329 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 330 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 331 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 332 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 333 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 334 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 335 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 338 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 339 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 340 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 341 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 342 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 343 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 344 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 345 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.6 |
| Metatranscriptomes | 0 |
| Isolates | 1.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.87 |
| Nodule | 0.52 |
| Rhizoplane | 7.68 |
| Rhizosphere | 73.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495652_0512195 | 3300046529 | Bacteria | 830 |
| 2 | JGI25406J46586_10011737 | 3300003203 | Bacteria | 3827 |
| 3 | JGI25153J46596_10108078 | 3300003215 | Bacteria | 643 |
| 4 | JGI25404J52841_10012934 | 3300003659 | Bacteria | 1810 |
| 5 | JGI25404J52841_10027589 | 3300003659 | Bacteria | 1221 |
| 6 | JGI25404J52841_10060461 | 3300003659 | Bacteria | 794 |
| 7 | Ga0070690_100010589 | 3300005330 | Bacteria | 5372 |
| 8 | Ga0070677_10014465 | 3300005333 | Bacteria | 2778 |
| 9 | Ga0070666_10256469 | 3300005335 | Bacteria | 1239 |
| 10 | Ga0068868_100438752 | 3300005338 | Bacteria | 1133 |
| 11 | Ga0070660_100606469 | 3300005339 | Bacteria | 915 |
| 12 | Ga0070689_100002472 | 3300005340 | Bacteria | 12069 |
| 13 | Ga0070692_10396598 | 3300005345 | Bacteria | 870 |
| 14 | Ga0070668_100294799 | 3300005347 | Bacteria | 1359 |
| 15 | Ga0070668_100951538 | 3300005347 | Bacteria | 770 |
| 16 | Ga0070669_100227598 | 3300005353 | Bacteria | 1476 |
| 17 | Ga0070674_100272740 | 3300005356 | Bacteria | 1337 |
| 18 | Ga0070673_100513678 | 3300005364 | Bacteria | 1085 |
| 19 | Ga0070688_100001319 | 3300005365 | Bacteria | 12334 |
| 20 | Ga0070667_100126996 | 3300005367 | Bacteria | 2223 |
| 21 | Ga0070667_100647243 | 3300005367 | Bacteria | 976 |
| 22 | Ga0070667_101241073 | 3300005367 | Bacteria | 698 |
| 23 | Ga0070709_10007588 | 3300005434 | Bacteria | 5955 |
| 24 | Ga0070709_10429197 | 3300005434 | Bacteria | 992 |
| 25 | Ga0070714_100207143 | 3300005435 | Bacteria | 1796 |
| 26 | Ga0070714_100367723 | 3300005435 | Bacteria | 1353 |
| 27 | Ga0070714_100489397 | 3300005435 | Bacteria | 1172 |
| 28 | Ga0070713_100005466 | 3300005436 | Bacteria | 8688 |
| 29 | Ga0070713_100069360 | 3300005436 | Bacteria | 2973 |
| 30 | Ga0070710_10007716 | 3300005437 | Bacteria | 5218 |
| 31 | Ga0070711_100022808 | 3300005439 | Bacteria | 4062 |
| 32 | Ga0070711_100043153 | 3300005439 | Bacteria | 3053 |
| 33 | Ga0070663_100091463 | 3300005455 | Bacteria | 2254 |
| 34 | Ga0070678_100211859 | 3300005456 | Bacteria | 1606 |
| 35 | Ga0070681_10013655 | 3300005458 | Bacteria | 8083 |
| 36 | Ga0068867_100073523 | 3300005459 | Bacteria | 2560 |
| 37 | Ga0068867_100665287 | 3300005459 | Bacteria | 915 |
| 38 | Ga0070707_100501717 | 3300005468 | Bacteria | 1175 |
| 39 | Ga0070698_100035915 | 3300005471 | Bacteria | 5123 |
| 40 | Ga0070699_100915008 | 3300005518 | Bacteria | 803 |
| 41 | Ga0070679_100012418 | 3300005530 | Bacteria | 8140 |
| 42 | Ga0068853_100269057 | 3300005539 | Bacteria | 1568 |
| 43 | Ga0070665_100857093 | 3300005548 | Bacteria | 921 |
| 44 | Ga0068855_100031878 | 3300005563 | Bacteria | 6292 |
| 45 | Ga0068855_100237950 | 3300005563 | Bacteria | 2036 |
| 46 | Ga0068854_100263124 | 3300005578 | Bacteria | 1382 |
| 47 | Ga0068854_101269229 | 3300005578 | Unclassified | 662 |
| 48 | Ga0068856_100000761 | 3300005614 | Bacteria | 34979 |
| 49 | Ga0068856_100393550 | 3300005614 | Bacteria | 1405 |
| 50 | Ga0070702_100246367 | 3300005615 | Bacteria | 1209 |
| 51 | Ga0068859_100631016 | 3300005617 | Bacteria | 1164 |
| 52 | Ga0068864_100278101 | 3300005618 | Bacteria | 1562 |
| 53 | Ga0068864_101669383 | 3300005618 | Bacteria | 642 |
| 54 | Ga0068858_100260578 | 3300005842 | Bacteria | 1648 |
| 55 | Ga0068860_100091477 | 3300005843 | Bacteria | 2898 |
| 56 | Ga0068860_100545064 | 3300005843 | Bacteria | 1162 |
| 57 | Ga0068862_100214801 | 3300005844 | Bacteria | 1739 |
| 58 | Ga0068862_100241429 | 3300005844 | Bacteria | 1643 |
| 59 | Ga0081455_10014276 | 3300005937 | Bacteria | 7795 |
| 60 | Ga0081540_1011614 | 3300005983 | Bacteria | 5874 |
| 61 | Ga0081540_1016829 | 3300005983 | Bacteria | 4555 |
| 62 | Ga0081540_1017969 | 3300005983 | Bacteria | 4358 |
| 63 | Ga0081540_1027265 | 3300005983 | Bacteria | 3241 |
| 64 | Ga0081540_1128393 | 3300005983 | Bacteria | 1040 |
| 65 | Ga0081540_1130164 | 3300005983 | Bacteria | 1029 |
| 66 | Ga0081540_1251141 | 3300005983 | Bacteria | 617 |
| 67 | Ga0081539_10001127 | 3300005985 | Bacteria | 48442 |
| 68 | Ga0081539_10035408 | 3300005985 | Bacteria | 3001 |
| 69 | Ga0081539_10078035 | 3300005985 | Bacteria | 1749 |
| 70 | Ga0081539_10146897 | 3300005985 | Bacteria | 1139 |
| 71 | Ga0070717_10309444 | 3300006028 | Bacteria | 1406 |
| 72 | Ga0075365_10015558 | 3300006038 | Bacteria | 4604 |
| 73 | Ga0075365_10041302 | 3300006038 | Bacteria | 3012 |
| 74 | Ga0075368_10116070 | 3300006042 | Bacteria | 1106 |
| 75 | Ga0075363_100221972 | 3300006048 | Bacteria | 1083 |
| 76 | Ga0075363_100282077 | 3300006048 | Bacteria | 961 |
| 77 | Ga0075363_100296568 | 3300006048 | Bacteria | 937 |
| 78 | Ga0075364_10126659 | 3300006051 | Bacteria | 1713 |
| 79 | Ga0070716_100003112 | 3300006173 | Bacteria | 7749 |
| 80 | Ga0070716_100012502 | 3300006173 | Bacteria | 4305 |
| 81 | Ga0070712_100009673 | 3300006175 | Bacteria | 6076 |
| 82 | Ga0070712_100106433 | 3300006175 | Bacteria | 2085 |
| 83 | Ga0070712_101370368 | 3300006175 | Bacteria | 617 |
| 84 | Ga0075367_10085466 | 3300006178 | Bacteria | 1914 |
| 85 | Ga0075434_100248904 | 3300006871 | Bacteria | 1796 |
| 86 | Ga0068865_100328817 | 3300006881 | Bacteria | 1232 |
| 87 | Ga0068865_100378264 | 3300006881 | Bacteria | 1154 |
| 88 | Ga0097620_100631130 | 3300006931 | Bacteria | 1164 |
| 89 | Ga0105240_10155868 | 3300009093 | Bacteria | 2716 |
| 90 | Ga0105245_10766933 | 3300009098 | Bacteria | 1001 |
| 91 | Ga0105245_10919624 | 3300009098 | Bacteria | 917 |
| 92 | Ga0105245_12823806 | 3300009098 | Bacteria | 538 |
| 93 | Ga0105242_10059068 | 3300009176 | Bacteria | 3146 |
| 94 | Ga0105248_10014730 | 3300009177 | Bacteria | 8609 |
| 95 | Ga0105248_10434792 | 3300009177 | Bacteria | 1478 |
| 96 | Ga0105237_10733242 | 3300009545 | Bacteria | 994 |
| 97 | Ga0105249_10551360 | 3300009553 | Bacteria | 1203 |
| 98 | Ga0099796_10055005 | 3300010159 | Bacteria | 1393 |
| 99 | Ga0105246_10463363 | 3300011119 | Bacteria | 1068 |
| 100 | Ga0157371_10033080 | 3300013102 | Bacteria | 3717 |
| 101 | Ga0157370_10035286 | 3300013104 | Bacteria | 4863 |
| 102 | Ga0157370_10065246 | 3300013104 | Bacteria | 3444 |
| 103 | Ga0157374_11857111 | 3300013296 | Bacteria | 628 |
| 104 | Ga0157378_10612503 | 3300013297 | Bacteria | 1101 |
| 105 | Ga0163162_10587432 | 3300013306 | Bacteria | 1240 |
| 106 | Ga0157372_10094759 | 3300013307 | Bacteria | 3400 |
| 107 | Ga0157375_10236075 | 3300013308 | Bacteria | 1988 |
| 108 | Ga0163163_10111931 | 3300014325 | Bacteria | 2759 |
| 109 | Ga0157380_10157489 | 3300014326 | Bacteria | 1970 |
| 110 | Ga0157377_10744714 | 3300014745 | Bacteria | 716 |
| 111 | Ga0157379_10264408 | 3300014968 | Bacteria | 1564 |
| 112 | Ga0157376_10132235 | 3300014969 | Bacteria | 2228 |
| 113 | Ga0213873_10212355 | 3300021358 | Bacteria | 603 |
| 114 | Ga0213876_10003460 | 3300021384 | Bacteria | 9022 |
| 115 | Ga0209677_100313 | 3300025253 | Bacteria | 31691 |
| 116 | Ga0209564_1006813 | 3300025295 | Bacteria | 6039 |
| 117 | Ga0209758_1012411 | 3300025297 | Bacteria | 4772 |
| 118 | Ga0207682_10073429 | 3300025893 | Bacteria | 1453 |
| 119 | Ga0207692_10006354 | 3300025898 | Bacteria | 4790 |
| 120 | Ga0207692_10010068 | 3300025898 | Bacteria | 3970 |
| 121 | Ga0207642_10355756 | 3300025899 | Bacteria | 865 |
| 122 | Ga0207685_10128967 | 3300025905 | Bacteria | 1120 |
| 123 | Ga0207699_10095323 | 3300025906 | Bacteria | 1876 |
| 124 | Ga0207705_10371690 | 3300025909 | Bacteria | 1104 |
| 125 | Ga0207684_11197892 | 3300025910 | Bacteria | 629 |
| 126 | Ga0207707_10108928 | 3300025912 | Bacteria | 2422 |
| 127 | Ga0207671_10053887 | 3300025914 | Bacteria | 2981 |
| 128 | Ga0207693_10000156 | 3300025915 | Bacteria | 63230 |
| 129 | Ga0207693_10063286 | 3300025915 | Bacteria | 2898 |
| 130 | Ga0207663_10001174 | 3300025916 | Bacteria | 12084 |
| 131 | Ga0207663_10001704 | 3300025916 | Bacteria | 10332 |
| 132 | Ga0207663_10228162 | 3300025916 | Bacteria | 1359 |
| 133 | Ga0207660_10064902 | 3300025917 | Bacteria | 2636 |
| 134 | Ga0207657_10087654 | 3300025919 | Bacteria | 2604 |
| 135 | Ga0207649_10072956 | 3300025920 | Bacteria | 2198 |
| 136 | Ga0207646_10538170 | 3300025922 | Bacteria | 1051 |
| 137 | Ga0207681_10354960 | 3300025923 | Bacteria | 1174 |
| 138 | Ga0207700_10024937 | 3300025928 | Bacteria | 4145 |
| 139 | Ga0207700_10103491 | 3300025928 | Bacteria | 2276 |
| 140 | Ga0207700_10536608 | 3300025928 | Bacteria | 1037 |
| 141 | Ga0207664_10048745 | 3300025929 | Bacteria | 3332 |
| 142 | Ga0207664_10084818 | 3300025929 | Bacteria | 2584 |
| 143 | Ga0207664_10139132 | 3300025929 | Bacteria | 2051 |
| 144 | Ga0207664_10706228 | 3300025929 | Bacteria | 907 |
| 145 | Ga0207644_10033487 | 3300025931 | Bacteria | 3591 |
| 146 | Ga0207644_10718609 | 3300025931 | Bacteria | 833 |
| 147 | Ga0207686_10168712 | 3300025934 | Bacteria | 1541 |
| 148 | Ga0207670_10001012 | 3300025936 | Bacteria | 14852 |
| 149 | Ga0207669_10375514 | 3300025937 | Bacteria | 1106 |
| 150 | Ga0207704_10302518 | 3300025938 | Bacteria | 1226 |
| 151 | Ga0207665_10000235 | 3300025939 | Bacteria | 37854 |
| 152 | Ga0207665_10020075 | 3300025939 | Bacteria | 4389 |
| 153 | Ga0207665_11145388 | 3300025939 | Bacteria | 620 |
| 154 | Ga0207691_10088387 | 3300025940 | Bacteria | 2779 |
| 155 | Ga0207711_10004642 | 3300025941 | Bacteria | 11670 |
| 156 | Ga0207667_10027892 | 3300025949 | Bacteria | 6138 |
| 157 | Ga0207712_10468849 | 3300025961 | Bacteria | 1071 |
| 158 | Ga0207668_10780640 | 3300025972 | Bacteria | 844 |
| 159 | Ga0207640_10069153 | 3300025981 | Bacteria | 2369 |
| 160 | Ga0207640_10846025 | 3300025981 | Bacteria | 796 |
| 161 | Ga0207658_10044722 | 3300025986 | Bacteria | 3225 |
| 162 | Ga0207658_10574261 | 3300025986 | Bacteria | 1011 |
| 163 | Ga0207677_10110193 | 3300026023 | Bacteria | 2049 |
| 164 | Ga0207677_10498635 | 3300026023 | Bacteria | 1052 |
| 165 | Ga0207703_10169946 | 3300026035 | Bacteria | 1917 |
| 166 | Ga0207703_10946685 | 3300026035 | Unclassified | 825 |
| 167 | Ga0207639_10612082 | 3300026041 | Bacteria | 1005 |
| 168 | Ga0207678_10097577 | 3300026067 | Bacteria | 2511 |
| 169 | Ga0207678_10366722 | 3300026067 | Bacteria | 1244 |
| 170 | Ga0207702_10000350 | 3300026078 | Bacteria | 52867 |
| 171 | Ga0207702_10224659 | 3300026078 | Bacteria | 1751 |
| 172 | Ga0207648_10043345 | 3300026089 | Bacteria | 3950 |
| 173 | Ga0207648_10706965 | 3300026089 | Bacteria | 934 |
| 174 | Ga0207676_10189051 | 3300026095 | Bacteria | 1810 |
| 175 | Ga0207675_100352506 | 3300026118 | Bacteria | 1442 |
| 176 | Ga0207683_10240322 | 3300026121 | Bacteria | 1652 |
| 177 | Ga0268266_11872857 | 3300028379 | Bacteria | 574 |
| 178 | Ga0268265_10250693 | 3300028380 | Bacteria | 1568 |
| 179 | Ga0268264_10001882 | 3300028381 | Bacteria | 19054 |
| 180 | Ga0268264_10029133 | 3300028381 | Bacteria | 4521 |
| 181 | Ga0268264_10359404 | 3300028381 | Bacteria | 1388 |
| 182 | Ga0265330_10003452 | 3300031235 | Bacteria | 8255 |
| 183 | Ga0265340_10001191 | 3300031247 | Bacteria | 14849 |
| 184 | Ga0265331_10022357 | 3300031250 | Bacteria | 3227 |
| 185 | Ga0265316_10104223 | 3300031344 | Bacteria | 2153 |
| 186 | Ga0307509_10338568 | 3300031507 | Bacteria | 1233 |
| 187 | Ga0307408_100317972 | 3300031548 | Bacteria | 1310 |
| 188 | Ga0265314_10027319 | 3300031711 | Bacteria | 4274 |
| 189 | Ga0307516_10038873 | 3300031730 | Bacteria | 4744 |
| 190 | Ga0307405_10525445 | 3300031731 | Bacteria | 953 |
| 191 | Ga0307412_10194972 | 3300031911 | Bacteria | 1534 |
| 192 | Ga0307416_100236528 | 3300032002 | Bacteria | 1766 |
| 193 | Ga0307416_101247215 | 3300032002 | Bacteria | 849 |
| 194 | Ga0307415_101338121 | 3300032126 | Bacteria | 680 |
| 195 | Ga0373948_0158705 | 3300034817 | Bacteria | 569 |
| 196 | Ga0373958_0022332 | 3300034819 | Bacteria | 1181 |
| 197 | Ga0373938_0044279 | 3300034957 | Bacteria | 998 |
| 198 | Ga0373926_0040543 | 3300035083 | Bacteria | 1662 |
| 199 | Ga0373928_0007159 | 3300035084 | Bacteria | 2151 |
| 200 | Ga0373934_0166194 | 3300035086 | Bacteria | 905 |
| 201 | Ga0373944_0064416 | 3300035089 | Bacteria | 1182 |
| 202 | Ga0373923_0010215 | 3300035111 | Bacteria | 3409 |
| 203 | Ga0373936_0014463 | 3300035113 | Bacteria | 3017 |
| 204 | Ga0373939_0018837 | 3300035114 | Bacteria | 1855 |
| 205 | Ga0373945_0001600 | 3300035116 | Bacteria | 6931 |
| 206 | Ga0373953_0095465 | 3300035117 | Bacteria | 1247 |
| 207 | Ga0373954_0439730 | 3300035118 | Bacteria | 645 |
| 208 | Ga0373943_0005257 | 3300035170 | Bacteria | 5824 |
| 209 | Ga0373946_0007126 | 3300035171 | Bacteria | 4083 |
| 210 | Ga0373946_0099734 | 3300035171 | Bacteria | 1300 |
| 211 | Ga0373946_0148522 | 3300035171 | Bacteria | 1092 |
| 212 | Ga0373955_0061155 | 3300035172 | Bacteria | 2079 |
| 213 | Ga0373942_0034367 | 3300035207 | Bacteria | 1356 |
| 214 | Ga0373942_0376405 | 3300035207 | Bacteria | 506 |
| 215 | Ga0373961_0048421 | 3300035241 | Bacteria | 1252 |
| 216 | Ga0373962_0048978 | 3300035242 | Bacteria | 1213 |
| 217 | Ga0373924_0110795 | 3300035410 | Bacteria | 1186 |
| 218 | Ga0373931_0001074 | 3300035691 | Bacteria | 11553 |
| 219 | Ga0373931_0005511 | 3300035691 | Bacteria | 5861 |
| 220 | Ga0373935_0002645 | 3300035692 | Bacteria | 10292 |
| 221 | Ga0373935_0045078 | 3300035692 | Bacteria | 2781 |
| 222 | Ga0373935_0343945 | 3300035692 | Bacteria | 1062 |
| 223 | Ga0373927_0000575 | 3300035695 | Bacteria | 27971 |
| 224 | Ga0373927_0875314 | 3300035695 | Bacteria | 593 |
| 225 | Ga0373933_0161273 | 3300035724 | Bacteria | 1424 |
| 226 | Ga0373933_0262267 | 3300035724 | Bacteria | 1114 |
| 227 | Ga0373947_0000425 | 3300035725 | Bacteria | 23992 |
| 228 | Ga0373937_0006400 | 3300036401 | Bacteria | 10162 |
| 229 | Ga0373937_0595183 | 3300036401 | Bacteria | 1050 |
| 230 | Ga0373925_0002067 | 3300037068 | Bacteria | 16544 |
| 231 | Ga0373925_0268773 | 3300037068 | Bacteria | 1371 |
| 232 | Ga0395899_0060304 | 3300037312 | Bacteria | 2795 |
| 233 | Ga0395900_0141643 | 3300037418 | Bacteria | 2462 |
| 234 | Ga0395898_0108337 | 3300037466 | Bacteria | 2664 |
| 235 | Ga0395901_0020648 | 3300038443 | Bacteria | 6740 |
| 236 | Ga0436365_1605102 | 3300039437 | Bacteria | 14296 |
| 237 | Ga0436361_0132059 | 3300039447 | Bacteria | 3007 |
| 238 | Ga0436363_1249664 | 3300039450 | Bacteria | 812 |
| 239 | Ga0436362_1053650 | 3300039453 | Bacteria | 4668 |
| 240 | Ga0451843_1572989 | 3300041509 | Bacteria | 621 |
| 241 | Ga0466959_0346004 | 3300045049 | Bacteria | 1014 |
| 242 | Ga0466967_0233858 | 3300045976 | Bacteria | 1751 |
| 243 | Ga0495603_0000048 | 3300046455 | Bacteria | 51928 |
| 244 | Ga0495603_0225820 | 3300046455 | Bacteria | 1080 |
| 245 | Ga0495629_0000620 | 3300046459 | Bacteria | 28889 |
| 246 | Ga0495629_0016014 | 3300046459 | Bacteria | 5389 |
| 247 | Ga0495638_0015679 | 3300046460 | Bacteria | 5082 |
| 248 | Ga0495638_0074494 | 3300046460 | Bacteria | 2070 |
| 249 | Ga0495641_0030500 | 3300046461 | Bacteria | 2585 |
| 250 | Ga0495580_0000084 | 3300046472 | Bacteria | 60217 |
| 251 | Ga0495582_0000688 | 3300046473 | Bacteria | 18626 |
| 252 | Ga0495639_0000009 | 3300046475 | Bacteria | 94240 |
| 253 | Ga0495639_0179717 | 3300046475 | Bacteria | 1030 |
| 254 | Ga0495662_0000335 | 3300046476 | Bacteria | 20522 |
| 255 | Ga0495664_0003477 | 3300046477 | Bacteria | 8575 |
| 256 | Ga0495594_0000197 | 3300046499 | Bacteria | 29482 |
| 257 | Ga0495606_0000676 | 3300046507 | Bacteria | 53366 |
| 258 | Ga0495618_0302750 | 3300046514 | Bacteria | 993 |
| 259 | Ga0495628_0013890 | 3300046516 | Bacteria | 6764 |
| 260 | Ga0495628_0208302 | 3300046516 | Bacteria | 1471 |
| 261 | Ga0495628_0362621 | 3300046516 | Bacteria | 1064 |
| 262 | Ga0495630_0000906 | 3300046517 | Bacteria | 20714 |
| 263 | Ga0495631_0147613 | 3300046518 | Bacteria | 1009 |
| 264 | Ga0495632_0364677 | 3300046519 | Bacteria | 634 |
| 265 | Ga0495637_0022511 | 3300046520 | Bacteria | 2873 |
| 266 | Ga0495648_0002751 | 3300046524 | Bacteria | 15879 |
| 267 | Ga0495648_0187952 | 3300046524 | Bacteria | 1044 |
| 268 | Ga0495666_0129878 | 3300046526 | Bacteria | 1177 |
| 269 | Ga0495652_0031501 | 3300046529 | Bacteria | 4644 |
| 270 | Ga0495654_0021554 | 3300046530 | Bacteria | 3351 |
| 271 | Ga0495665_0000131 | 3300046531 | Bacteria | 35816 |
| 272 | Ga0495640_0001770 | 3300046533 | Bacteria | 17120 |
| 273 | Ga0495640_0706366 | 3300046533 | Unclassified | 605 |
| 274 | Ga0495586_0034707 | 3300046535 | Bacteria | 2710 |
| 275 | Ga0495622_0074353 | 3300046557 | Bacteria | 1567 |
| 276 | Ga0495667_0018740 | 3300046559 | Bacteria | 4672 |
| 277 | Ga0495668_0273024 | 3300046616 | Bacteria | 926 |
| 278 | Ga0495634_0002111 | 3300046642 | Bacteria | 16783 |
| 279 | Ga0495625_0069479 | 3300046660 | Bacteria | 2474 |
| 280 | Ga0495635_0000119 | 3300046663 | Bacteria | 47408 |
| 281 | Ga0495661_0017093 | 3300046665 | Bacteria | 4793 |
| 282 | Ga0495588_0120564 | 3300046674 | Bacteria | 1382 |
| 283 | Ga0495588_0283052 | 3300046674 | Bacteria | 874 |
| 284 | Ga0495657_0119970 | 3300046675 | Bacteria | 1657 |
| 285 | Ga0495657_0216737 | 3300046675 | Bacteria | 1162 |
| 286 | Ga0495646_0011788 | 3300046680 | Bacteria | 5559 |
| 287 | Ga0495647_0000110 | 3300046681 | Bacteria | 20564 |
| 288 | Ga0495658_0001495 | 3300046683 | Bacteria | 12260 |
| 289 | Ga0495613_0004156 | 3300046689 | Bacteria | 10833 |
| 290 | Ga0495624_0004281 | 3300046690 | Bacteria | 10483 |
| 291 | Ga0495670_0184777 | 3300046691 | Bacteria | 1101 |
| 292 | Ga0495671_0047795 | 3300046692 | Bacteria | 2136 |
| 293 | Ga0495660_0061161 | 3300046810 | Bacteria | 2021 |
| 294 | Ga0495581_0000103 | 3300047315 | Bacteria | 35265 |
| 295 | Ga0495604_0104337 | 3300047317 | Bacteria | 2078 |
| 296 | Ga0495674_0000367 | 3300047319 | Bacteria | 40173 |
| 297 | Ga0495672_0111996 | 3300047320 | Bacteria | 1463 |
| 298 | Ga0495676_0103320 | 3300047321 | Bacteria | 2104 |
| 299 | Ga0495680_0025944 | 3300047322 | Bacteria | 4842 |
| 300 | Ga0495683_0424922 | 3300047323 | Bacteria | 549 |
| 301 | Ga0495675_0218207 | 3300047444 | Bacteria | 1155 |
| 302 | Ga0495675_0278460 | 3300047444 | Bacteria | 998 |
| 303 | Ga0495681_0082358 | 3300047470 | Bacteria | 1434 |
| 304 | Ga0495681_0283066 | 3300047470 | Bacteria | 646 |
| 305 | Ga0495684_0185490 | 3300047471 | Bacteria | 1540 |
| 306 | Ga0495684_0332676 | 3300047471 | Bacteria | 1083 |
| 307 | Ga0495686_0033893 | 3300047472 | Bacteria | 3292 |
| 308 | Ga0495686_0581189 | 3300047472 | Bacteria | 582 |
| 309 | Ga0495593_0000081 | 3300047673 | Bacteria | 41353 |
| 310 | Ga0495614_0004594 | 3300048089 | Bacteria | 6216 |
| 311 | Ga0495626_0039140 | 3300048091 | Bacteria | 2245 |
| 312 | Ga0496100_0047562 | 3300048903 | Bacteria | 2765 |
| 313 | Ga0496100_0137698 | 3300048903 | Bacteria | 1727 |
| 314 | Ga0496101_0028681 | 3300048904 | Bacteria | 3888 |
| 315 | Ga0496101_0965183 | 3300048904 | Bacteria | 670 |
| 316 | Ga0496102_0200644 | 3300048905 | Bacteria | 1880 |
| 317 | Ga0496102_0260013 | 3300048905 | Bacteria | 1637 |
| 318 | Ga0496102_0351500 | 3300048905 | Bacteria | 1388 |
| 319 | Ga0496102_0952616 | 3300048905 | Bacteria | 779 |
| 320 | Ga0496103_0193215 | 3300048906 | Bacteria | 1309 |
| 321 | Ga0496103_0243516 | 3300048906 | Bacteria | 1157 |
| 322 | Ga0496104_0003524 | 3300048907 | Bacteria | 13492 |
| 323 | Ga0496104_0007468 | 3300048907 | Bacteria | 9662 |
| 324 | Ga0496105_0282289 | 3300048908 | Bacteria | 1339 |
| 325 | Ga0496106_0005298 | 3300048909 | Bacteria | 9557 |
| 326 | Ga0496106_0191357 | 3300048909 | Bacteria | 1627 |
| 327 | Ga0496107_0009345 | 3300048910 | Bacteria | 6795 |
| 328 | Ga0496107_0017275 | 3300048910 | Bacteria | 5073 |
| 329 | Ga0496108_0000803 | 3300048911 | Bacteria | 24388 |
| 330 | Ga0496108_0177157 | 3300048911 | Bacteria | 1846 |
| 331 | Ga0496109_0001236 | 3300048912 | Bacteria | 21235 |
| 332 | Ga0496109_0301919 | 3300048912 | Bacteria | 1510 |
| 333 | Ga0496109_0338728 | 3300048912 | Bacteria | 1420 |
| 334 | Ga0496109_0501815 | 3300048912 | Bacteria | 1145 |
| 335 | Ga0496110_0002758 | 3300048913 | Bacteria | 13257 |
| 336 | Ga0496110_0182376 | 3300048913 | Bacteria | 1906 |
| 337 | Ga0496110_0241849 | 3300048913 | Bacteria | 1642 |
| 338 | Ga0496110_1270609 | 3300048913 | Bacteria | 645 |
| 339 | Ga0496111_0095332 | 3300048914 | Bacteria | 2183 |
| 340 | Ga0496112_0000015 | 3300048915 | Bacteria | 206423 |
| 341 | Ga0496112_0000971 | 3300048915 | Bacteria | 20892 |
| 342 | Ga0496112_0128876 | 3300048915 | Bacteria | 2501 |
| 343 | Ga0496112_0313221 | 3300048915 | Bacteria | 1514 |
| 344 | Ga0496112_1476506 | 3300048915 | Bacteria | 594 |
| 345 | Ga0496113_0165622 | 3300048916 | Bacteria | 1749 |
| 346 | Ga0496113_0567248 | 3300048916 | Bacteria | 910 |
| 347 | Ga0496113_0638940 | 3300048916 | Bacteria | 851 |
| 348 | Ga0496114_0279578 | 3300048917 | Bacteria | 1471 |
| 349 | Ga0496114_0557728 | 3300048917 | Bacteria | 1012 |
| 350 | Ga0496114_0832099 | 3300048917 | Bacteria | 803 |
| 351 | Ga0496114_1147550 | 3300048917 | Bacteria | 662 |
| 352 | Ga0496115_0049844 | 3300048918 | Bacteria | 3353 |
| 353 | Ga0496115_0442665 | 3300048918 | Bacteria | 1050 |
| 354 | Ga0496116_0017808 | 3300048919 | Bacteria | 5500 |
| 355 | Ga0496116_0293803 | 3300048919 | Bacteria | 778 |
| 356 | Ga0496117_0029505 | 3300048920 | Bacteria | 4227 |
| 357 | Ga0496117_0061624 | 3300048920 | Bacteria | 2577 |
| 358 | Ga0496117_0114529 | 3300048920 | Bacteria | 1671 |
| 359 | Ga0496118_0055443 | 3300048921 | Bacteria | 2991 |
| 360 | Ga0496118_0079511 | 3300048921 | Bacteria | 2313 |
| 361 | Ga0496118_0135609 | 3300048921 | Bacteria | 1571 |
| 362 | Ga0496119_0082665 | 3300048922 | Bacteria | 1847 |
| 363 | Ga0496119_0096221 | 3300048922 | Bacteria | 1671 |
| 364 | Ga0496120_0032227 | 3300048923 | Bacteria | 3162 |
| 365 | Ga0496120_0041553 | 3300048923 | Bacteria | 2692 |
| 366 | Ga0496121_0014101 | 3300048924 | Bacteria | 8520 |
| 367 | Ga0496121_0075971 | 3300048924 | Bacteria | 2681 |
| 368 | Ga0496121_0224520 | 3300048924 | Bacteria | 1320 |
| 369 | Ga0496122_0037865 | 3300048925 | Bacteria | 3874 |
| 370 | Ga0496122_0107651 | 3300048925 | Bacteria | 1841 |
| 371 | Ga0496123_0050040 | 3300048926 | Bacteria | 2795 |
| 372 | Ga0496123_0122150 | 3300048926 | Bacteria | 1462 |
| 373 | Ga0496124_0109575 | 3300048927 | Bacteria | 2225 |
| 374 | Ga0496124_0147725 | 3300048927 | Bacteria | 1848 |
| 375 | Ga0496125_0008308 | 3300048928 | Bacteria | 10899 |
| 376 | Ga0496125_0033092 | 3300048928 | Bacteria | 4581 |
| 377 | Ga0496126_0072375 | 3300048929 | Bacteria | 3066 |
| 378 | Ga0496126_0074325 | 3300048929 | Bacteria | 3019 |
| 379 | Ga0496126_0258679 | 3300048929 | Bacteria | 1448 |
| 380 | Ga0496126_0379409 | 3300048929 | Bacteria | 1151 |
| 381 | Ga0496126_0968367 | 3300048929 | Bacteria | 640 |
| 382 | Ga0501031_0000413 | 3300049568 | Bacteria | 24721 |
| 383 | Ga0501031_0020178 | 3300049568 | Bacteria | 4344 |
| 384 | Ga0501031_0085166 | 3300049568 | Bacteria | 2060 |
| 385 | Ga0501032_0000887 | 3300049569 | Bacteria | 24230 |
| 386 | Ga0501032_0008175 | 3300049569 | Bacteria | 7627 |
| 387 | Ga0501032_0019964 | 3300049569 | Bacteria | 4676 |
| 388 | Ga0501032_0124980 | 3300049569 | Bacteria | 1699 |
| 389 | Ga0501032_0469141 | 3300049569 | Bacteria | 806 |
| 390 | Ga0501033_0000205 | 3300049570 | Bacteria | 56697 |
| 391 | Ga0501033_0001299 | 3300049570 | Bacteria | 22220 |
| 392 | Ga0501033_0014479 | 3300049570 | Bacteria | 5987 |
| 393 | Ga0501033_0049274 | 3300049570 | Bacteria | 3126 |
| 394 | Ga0501034_0000058 | 3300049571 | Bacteria | 198554 |
| 395 | Ga0501034_0099140 | 3300049571 | Bacteria | 2908 |
| 396 | Ga0501034_0109041 | 3300049571 | Bacteria | 2759 |
| 397 | Ga0501034_0194981 | 3300049571 | Bacteria | 1986 |
| 398 | Ga0501034_0363735 | 3300049571 | Bacteria | 1373 |
| 399 | Ga0501034_0378504 | 3300049571 | Bacteria | 1341 |
| 400 | Ga0501034_0458825 | 3300049571 | Bacteria | 1191 |
| 401 | Ga0501036_0000191 | 3300049572 | Bacteria | 40653 |
| 402 | Ga0501036_0032478 | 3300049572 | Bacteria | 4410 |
| 403 | Ga0501036_0111620 | 3300049572 | Bacteria | 2310 |
| 404 | Ga0501036_0136144 | 3300049572 | Bacteria | 2073 |
| 405 | Ga0501036_0841968 | 3300049572 | Bacteria | 754 |
| 406 | Ga0501037_0000078 | 3300049573 | Bacteria | 90398 |
| 407 | Ga0501037_0003271 | 3300049573 | Bacteria | 11763 |
| 408 | Ga0501037_0095389 | 3300049573 | Bacteria | 2150 |
| 409 | Ga0501037_0119616 | 3300049573 | Bacteria | 1894 |
| 410 | Ga0501038_0000799 | 3300049574 | Bacteria | 27929 |
| 411 | Ga0501038_0001041 | 3300049574 | Bacteria | 25043 |
| 412 | Ga0501038_0031495 | 3300049574 | Bacteria | 4686 |
| 413 | Ga0501038_0076900 | 3300049574 | Bacteria | 2819 |
| 414 | Ga0501038_0116851 | 3300049574 | Bacteria | 2204 |
| 415 | Ga0501038_0118896 | 3300049574 | Bacteria | 2181 |
| 416 | Ga0501039_0000646 | 3300049575 | Bacteria | 25240 |
| 417 | Ga0501039_0015997 | 3300049575 | Bacteria | 5744 |
| 418 | Ga0501039_0090085 | 3300049575 | Bacteria | 2391 |
| 419 | Ga0501039_0261242 | 3300049575 | Bacteria | 1361 |
| 420 | Ga0501039_0340088 | 3300049575 | Bacteria | 1179 |
| 421 | Ga0501040_0012606 | 3300049576 | Bacteria | 5543 |
| 422 | Ga0501041_0156709 | 3300049577 | Bacteria | 1423 |
| 423 | Ga0501042_0009120 | 3300049578 | Bacteria | 6595 |
| 424 | Ga0501042_0048328 | 3300049578 | Bacteria | 3033 |
| 425 | Ga0501042_0223377 | 3300049578 | Bacteria | 1358 |
| 426 | Ga0501043_0000400 | 3300049579 | Bacteria | 38956 |
| 427 | Ga0501043_0023227 | 3300049579 | Bacteria | 4864 |
| 428 | Ga0501043_0037948 | 3300049579 | Bacteria | 3789 |
| 429 | Ga0501043_0062603 | 3300049579 | Bacteria | 2921 |
| 430 | Ga0501043_0091805 | 3300049579 | Bacteria | 2387 |
| 431 | Ga0501043_0292830 | 3300049579 | Bacteria | 1246 |
| 432 | Ga0501043_0299934 | 3300049579 | Bacteria | 1228 |
| 433 | Ga0501043_0552467 | 3300049579 | Bacteria | 855 |
| 434 | Ga0501046_0002690 | 3300049580 | Bacteria | 16557 |
| 435 | Ga0501046_0072237 | 3300049580 | Bacteria | 2680 |
| 436 | Ga0501046_0347349 | 3300049580 | Bacteria | 1077 |
| 437 | Ga0501046_0347387 | 3300049580 | Bacteria | 1077 |
| 438 | Ga0501047_0000022 | 3300049581 | Bacteria | 249062 |
| 439 | Ga0501047_0003563 | 3300049581 | Bacteria | 14700 |
| 440 | Ga0501047_0050373 | 3300049581 | Bacteria | 4021 |
| 441 | Ga0501047_0118657 | 3300049581 | Bacteria | 2527 |
| 442 | Ga0501047_0210604 | 3300049581 | Bacteria | 1802 |
| 443 | Ga0501047_1053377 | 3300049581 | Bacteria | 627 |
| 444 | Ga0501048_0000041 | 3300049582 | Bacteria | 62410 |
| 445 | Ga0501048_0043863 | 3300049582 | Bacteria | 3200 |
| 446 | Ga0501048_0261509 | 3300049582 | Bacteria | 1229 |
| 447 | Ga0501067_0000623 | 3300049583 | Bacteria | 19087 |
| 448 | Ga0501067_0015867 | 3300049583 | Bacteria | 4166 |
| 449 | Ga0501067_0230246 | 3300049583 | Bacteria | 1031 |
| 450 | Ga0501068_0001006 | 3300049584 | Bacteria | 14848 |
| 451 | Ga0501068_0025630 | 3300049584 | Bacteria | 3469 |
| 452 | Ga0501069_0000994 | 3300049585 | Bacteria | 13524 |
| 453 | Ga0501069_0108870 | 3300049585 | Bacteria | 1577 |
| 454 | Ga0501069_0308539 | 3300049585 | Bacteria | 928 |
| 455 | Ga0501069_0809548 | 3300049585 | Bacteria | 568 |
| 456 | Ga0501070_0006297 | 3300049586 | Bacteria | 10102 |
| 457 | Ga0501070_0023285 | 3300049586 | Bacteria | 5187 |
| 458 | Ga0501070_0072494 | 3300049586 | Bacteria | 2851 |
| 459 | Ga0501070_0098406 | 3300049586 | Bacteria | 2420 |
| 460 | Ga0501070_0340579 | 3300049586 | Bacteria | 1218 |
| 461 | Ga0501070_0521122 | 3300049586 | Bacteria | 954 |
| 462 | Ga0501071_0004628 | 3300049587 | Bacteria | 8733 |
| 463 | Ga0501071_0026928 | 3300049587 | Bacteria | 4041 |
| 464 | Ga0501072_0010286 | 3300049588 | Bacteria | 7128 |
| 465 | Ga0501072_0238397 | 3300049588 | Bacteria | 1448 |
| 466 | Ga0501072_0500690 | 3300049588 | Bacteria | 961 |
| 467 | Ga0501073_0000707 | 3300049589 | Bacteria | 23568 |
| 468 | Ga0501073_0031873 | 3300049589 | Bacteria | 3760 |
| 469 | Ga0501073_0239782 | 3300049589 | Bacteria | 1252 |
| 470 | Ga0501074_0000403 | 3300049590 | Bacteria | 25812 |
| 471 | Ga0501074_0030023 | 3300049590 | Bacteria | 3939 |
| 472 | Ga0501076_0012159 | 3300049592 | Bacteria | 6435 |
| 473 | Ga0501077_0072284 | 3300049593 | Bacteria | 2186 |
| 474 | Ga0501079_0002506 | 3300049741 | Bacteria | 13340 |
| 475 | Ga0501079_0049657 | 3300049741 | Bacteria | 3238 |
| 476 | Ga0501080_0016575 | 3300049742 | Bacteria | 6806 |
| 477 | Ga0501080_0162573 | 3300049742 | Bacteria | 2061 |
| 478 | Ga0501080_0939834 | 3300049742 | Bacteria | 752 |
| 479 | Ga0501081_0135271 | 3300049743 | Bacteria | 1764 |
| 480 | Ga0501083_0000623 | 3300049744 | Bacteria | 22875 |
| 481 | Ga0501083_0006657 | 3300049744 | Bacteria | 8198 |
| 482 | Ga0501083_0698031 | 3300049744 | Bacteria | 660 |
| 483 | Ga0501035_0000517 | 3300049822 | Bacteria | 43406 |
| 484 | Ga0501035_0039305 | 3300049822 | Bacteria | 4281 |
| 485 | Ga0501035_0062675 | 3300049822 | Bacteria | 3308 |
| 486 | Ga0501035_0169543 | 3300049822 | Bacteria | 1886 |
| 487 | Ga0501035_0194731 | 3300049822 | Bacteria | 1741 |
| 488 | Ga0501035_0409217 | 3300049822 | Bacteria | 1127 |
| 489 | Ga0501044_0000370 | 3300049823 | Bacteria | 56259 |
| 490 | Ga0501044_0016896 | 3300049823 | Bacteria | 7828 |
| 491 | Ga0501044_0022684 | 3300049823 | Bacteria | 6684 |
| 492 | Ga0501044_0116420 | 3300049823 | Bacteria | 2678 |
| 493 | Ga0501044_0206572 | 3300049823 | Bacteria | 1920 |
| 494 | Ga0501044_0286860 | 3300049823 | Bacteria | 1578 |
| 495 | Ga0501044_0355062 | 3300049823 | Bacteria | 1385 |
| 496 | Ga0501044_0458367 | 3300049823 | Bacteria | 1180 |
| 497 | Ga0501044_0927926 | 3300049823 | Bacteria | 744 |
| 498 | Ga0501045_0006554 | 3300049824 | Bacteria | 8069 |
| 499 | Ga0501045_0021112 | 3300049824 | Bacteria | 4657 |
| 500 | nmdc:mga03n38_234819_c1 | 3300050490 | Bacteria | 963 |
| 501 | nmdc:mga00v17_216124_c1 | 3300050491 | Bacteria | 1241 |
| 502 | nmdc:mga0yw44_112301_c1 | 3300050492 | Bacteria | 1747 |
| 503 | nmdc:mga0yw44_2232_c1 | 3300050492 | Bacteria | 8167 |
| 504 | nmdc:mga0yw44_99305_c1 | 3300050492 | Bacteria | 1852 |
| 505 | nmdc:mga06z11_409223_c1 | 3300050494 | Bacteria | 817 |
| 506 | nmdc:mga07m45_97798_c1 | 3300050496 | Bacteria | 1684 |
| 507 | nmdc:mga0n895_310544_c1 | 3300050512 | Bacteria | 1598 |
| 508 | nmdc:mga0sz30_34581_c1 | 3300050516 | Bacteria | 2105 |
| 509 | Ga0495601_0054483 | 3300053077 | Bacteria | 2530 |
| 510 | Ga0495595_0025812 | 3300053084 | Bacteria | 2606 |
| 511 | Ga0495619_0200492 | 3300053085 | Bacteria | 1381 |
| 512 | Ga0500578_0269654 | 3300053086 | Bacteria | 1019 |
| 513 | Ga0500643_025048 | 3300053087 | Bacteria | 1885 |
| 514 | Ga0500644_0150092 | 3300053088 | Bacteria | 933 |
| 515 | Ga0500644_0159120 | 3300053088 | Bacteria | 911 |
| 516 | Ga0500647_0017713 | 3300053091 | Bacteria | 3289 |
| 517 | Ga0500651_0084244 | 3300053093 | Bacteria | 1966 |
| 518 | Ga0500651_0142361 | 3300053093 | Bacteria | 1444 |
| 519 | Ga0500566_0000054 | 3300053094 | Bacteria | 54975 |
| 520 | Ga0500566_0000273 | 3300053094 | Bacteria | 27887 |
| 521 | Ga0500640_066194 | 3300053095 | Bacteria | 1558 |
| 522 | Ga0500641_0018037 | 3300053096 | Bacteria | 2649 |
| 523 | Ga0500641_0042888 | 3300053096 | Bacteria | 1834 |
| 524 | Ga0500641_0115977 | 3300053096 | Bacteria | 1153 |
| 525 | Ga0500648_152254 | 3300053097 | Bacteria | 1228 |
| 526 | Ga0500650_0001131 | 3300053098 | Bacteria | 7742 |
| 527 | Ga0500554_015338 | 3300053102 | Bacteria | 1999 |
| 528 | Ga0500556_0000081 | 3300053104 | Bacteria | 90508 |
| 529 | Ga0500557_101006 | 3300053105 | Bacteria | 958 |
| 530 | Ga0500562_021264 | 3300053108 | Bacteria | 1687 |
| 531 | Ga0500569_004879 | 3300053109 | Bacteria | 2850 |
| 532 | Ga0500572_004102 | 3300053111 | Bacteria | 3308 |
| 533 | Ga0500592_000924 | 3300053116 | Bacteria | 4789 |
| 534 | Ga0500594_0117191 | 3300053118 | Bacteria | 833 |
| 535 | Ga0500608_037882 | 3300053122 | Bacteria | 2305 |
| 536 | Ga0500618_002100 | 3300053125 | Bacteria | 7903 |
| 537 | Ga0500618_060980 | 3300053125 | Bacteria | 848 |
| 538 | Ga0500642_0000042 | 3300053130 | Bacteria | 86476 |
| 539 | Ga0500652_001266 | 3300053131 | Bacteria | 8023 |
| 540 | Ga0500559_0000106 | 3300053136 | Bacteria | 65670 |
| 541 | Ga0500559_0425795 | 3300053136 | Bacteria | 615 |
| 542 | Ga0500568_0001103 | 3300053139 | Bacteria | 18169 |
| 543 | Ga0500577_0071737 | 3300053142 | Bacteria | 1360 |
| 544 | Ga0500586_000217 | 3300053145 | Bacteria | 11350 |
| 545 | Ga0500590_021743 | 3300053148 | Bacteria | 3329 |
| 546 | Ga0500590_123677 | 3300053148 | Bacteria | 1208 |
| 547 | Ga0500604_0016891 | 3300053151 | Bacteria | 2013 |
| 548 | Ga0500616_0000227 | 3300053153 | Bacteria | 88098 |
| 549 | Ga0500619_117264 | 3300053154 | Bacteria | 907 |
| 550 | Ga0500622_0001577 | 3300053156 | Bacteria | 17942 |
| 551 | Ga0500627_0263181 | 3300053158 | Bacteria | 760 |
| 552 | Ga0500633_0006675 | 3300053160 | Bacteria | 2847 |
| 553 | Ga0500634_0099904 | 3300053161 | Bacteria | 1454 |
| 554 | Ga0500634_0194481 | 3300053161 | Bacteria | 898 |
| 555 | Ga0500636_0004953 | 3300053177 | Bacteria | 7562 |
| 556 | Ga0500636_0103478 | 3300053177 | Bacteria | 1616 |
| 557 | Ga0500637_0073465 | 3300053178 | Bacteria | 1969 |
| 558 | Ga0500645_115189 | 3300053730 | Bacteria | 752 |
| 559 | Ga0500596_015321 | 3300053735 | Bacteria | 1151 |
| 560 | Ga0501084_0000828 | 3300054114 | Bacteria | 23846 |
| 561 | Ga0501084_0136066 | 3300054114 | Bacteria | 2068 |
| 562 | Ga0501082_0003277 | 3300060353 | Bacteria | 14134 |
| 563 | Ga0501082_0071551 | 3300060353 | Bacteria | 2986 |
| 564 | Ga0530510_0349994 | 3300061734 | Bacteria | 1110 |
| 565 | Ga0530510_0523334 | 3300061734 | Bacteria | 900 |
| 566 | 2513888634 | 2513237141 | Bacteria | 8496279 |
| 567 | 2599332470 | 2599185156 | Bacteria | 5403036 |
| 568 | 2603858385 | 2602042107 | Bacteria | 6226103 |
| 569 | 2857526519 | 2857524615 | Bacteria | 6615449 |
| 570 | 2893067232 | 2893066018 | Bacteria | 6158120 |
| 571 | 2919073667 | 2919073203 | Bacteria | 6531949 |
| 572 | 8006969469 | 8006964411 | Bacteria | 8966052 |
| 573 | 8056675607 | 8056673599 | Bacteria | 7871253 |
| 574 | Ga0495652_0512195 | |||
| 575 | JGI25406J46586_10011737 | |||
| 576 | JGI25153J46596_10108078 | |||
| 577 | JGI25404J52841_10012934 | |||
| 578 | JGI25404J52841_10027589 | |||
| 579 | JGI25404J52841_10060461 | |||
| 580 | Ga0070690_100010589 | |||
| 581 | Ga0070677_10014465 | |||
| 582 | Ga0070666_10256469 | |||
| 583 | Ga0068868_100438752 | |||
| 584 | Ga0070660_100606469 | |||
| 585 | Ga0070689_100002472 | |||
| 586 | Ga0070692_10396598 | |||
| 587 | Ga0070668_100294799 | |||
| 588 | Ga0070668_100951538 | |||
| 589 | Ga0070669_100227598 | |||
| 590 | Ga0070674_100272740 | |||
| 591 | Ga0070673_100513678 | |||
| 592 | Ga0070688_100001319 | |||
| 593 | Ga0070667_100126996 | |||
| 594 | Ga0070667_100647243 | |||
| 595 | Ga0070667_101241073 | |||
| 596 | Ga0070709_10007588 | |||
| 597 | Ga0070709_10429197 | |||
| 598 | Ga0070714_100207143 | |||
| 599 | Ga0070714_100367723 | |||
| 600 | Ga0070714_100489397 | |||
| 601 | Ga0070713_100005466 | |||
| 602 | Ga0070713_100069360 | |||
| 603 | Ga0070710_10007716 | |||
| 604 | Ga0070711_100022808 | |||
| 605 | Ga0070711_100043153 | |||
| 606 | Ga0070663_100091463 | |||
| 607 | Ga0070678_100211859 | |||
| 608 | Ga0070681_10013655 | |||
| 609 | Ga0068867_100073523 | |||
| 610 | Ga0068867_100665287 | |||
| 611 | Ga0070707_100501717 | |||
| 612 | Ga0070698_100035915 | |||
| 613 | Ga0070699_100915008 | |||
| 614 | Ga0070679_100012418 | |||
| 615 | Ga0068853_100269057 | |||
| 616 | Ga0070665_100857093 | |||
| 617 | Ga0068855_100031878 | |||
| 618 | Ga0068855_100237950 | |||
| 619 | Ga0068854_100263124 | |||
| 620 | Ga0068854_101269229 | |||
| 621 | Ga0068856_100000761 | |||
| 622 | Ga0068856_100393550 | |||
| 623 | Ga0070702_100246367 | |||
| 624 | Ga0068859_100631016 | |||
| 625 | Ga0068864_100278101 | |||
| 626 | Ga0068864_101669383 | |||
| 627 | Ga0068858_100260578 | |||
| 628 | Ga0068860_100091477 | |||
| 629 | Ga0068860_100545064 | |||
| 630 | Ga0068862_100214801 | |||
| 631 | Ga0068862_100241429 | |||
| 632 | Ga0081455_10014276 | |||
| 633 | Ga0081540_1011614 | |||
| 634 | Ga0081540_1016829 | |||
| 635 | Ga0081540_1017969 | |||
| 636 | Ga0081540_1027265 | |||
| 637 | Ga0081540_1128393 | |||
| 638 | Ga0081540_1130164 | |||
| 639 | Ga0081540_1251141 | |||
| 640 | Ga0081539_10001127 | |||
| 641 | Ga0081539_10035408 | |||
| 642 | Ga0081539_10078035 | |||
| 643 | Ga0081539_10146897 | |||
| 644 | Ga0070717_10309444 | |||
| 645 | Ga0075365_10015558 | |||
| 646 | Ga0075365_10041302 | |||
| 647 | Ga0075368_10116070 | |||
| 648 | Ga0075363_100221972 | |||
| 649 | Ga0075363_100282077 | |||
| 650 | Ga0075363_100296568 | |||
| 651 | Ga0075364_10126659 | |||
| 652 | Ga0070716_100003112 | |||
| 653 | Ga0070716_100012502 | |||
| 654 | Ga0070712_100009673 | |||
| 655 | Ga0070712_100106433 | |||
| 656 | Ga0070712_101370368 | |||
| 657 | Ga0075367_10085466 | |||
| 658 | Ga0075434_100248904 | |||
| 659 | Ga0068865_100328817 | |||
| 660 | Ga0068865_100378264 | |||
| 661 | Ga0097620_100631130 | |||
| 662 | Ga0105240_10155868 | |||
| 663 | Ga0105245_10766933 | |||
| 664 | Ga0105245_10919624 | |||
| 665 | Ga0105245_12823806 | |||
| 666 | Ga0105242_10059068 | |||
| 667 | Ga0105248_10014730 | |||
| 668 | Ga0105248_10434792 | |||
| 669 | Ga0105237_10733242 | |||
| 670 | Ga0105249_10551360 | |||
| 671 | Ga0099796_10055005 | |||
| 672 | Ga0105246_10463363 | |||
| 673 | Ga0157371_10033080 | |||
| 674 | Ga0157370_10035286 | |||
| 675 | Ga0157370_10065246 | |||
| 676 | Ga0157374_11857111 | |||
| 677 | Ga0157378_10612503 | |||
| 678 | Ga0163162_10587432 | |||
| 679 | Ga0157372_10094759 | |||
| 680 | Ga0157375_10236075 | |||
| 681 | Ga0163163_10111931 | |||
| 682 | Ga0157380_10157489 | |||
| 683 | Ga0157377_10744714 | |||
| 684 | Ga0157379_10264408 | |||
| 685 | Ga0157376_10132235 | |||
| 686 | Ga0213873_10212355 | |||
| 687 | Ga0213876_10003460 | |||
| 688 | Ga0209677_100313 | |||
| 689 | Ga0209564_1006813 | |||
| 690 | Ga0209758_1012411 | |||
| 691 | Ga0207682_10073429 | |||
| 692 | Ga0207692_10006354 | |||
| 693 | Ga0207692_10010068 | |||
| 694 | Ga0207642_10355756 | |||
| 695 | Ga0207685_10128967 | |||
| 696 | Ga0207699_10095323 | |||
| 697 | Ga0207705_10371690 | |||
| 698 | Ga0207684_11197892 | |||
| 699 | Ga0207707_10108928 | |||
| 700 | Ga0207671_10053887 | |||
| 701 | Ga0207693_10000156 | |||
| 702 | Ga0207693_10063286 | |||
| 703 | Ga0207663_10001174 | |||
| 704 | Ga0207663_10001704 | |||
| 705 | Ga0207663_10228162 | |||
| 706 | Ga0207660_10064902 | |||
| 707 | Ga0207657_10087654 | |||
| 708 | Ga0207649_10072956 | |||
| 709 | Ga0207646_10538170 | |||
| 710 | Ga0207681_10354960 | |||
| 711 | Ga0207700_10024937 | |||
| 712 | Ga0207700_10103491 | |||
| 713 | Ga0207700_10536608 | |||
| 714 | Ga0207664_10048745 | |||
| 715 | Ga0207664_10084818 | |||
| 716 | Ga0207664_10139132 | |||
| 717 | Ga0207664_10706228 | |||
| 718 | Ga0207644_10033487 | |||
| 719 | Ga0207644_10718609 | |||
| 720 | Ga0207686_10168712 | |||
| 721 | Ga0207670_10001012 | |||
| 722 | Ga0207669_10375514 | |||
| 723 | Ga0207704_10302518 | |||
| 724 | Ga0207665_10000235 | |||
| 725 | Ga0207665_10020075 | |||
| 726 | Ga0207665_11145388 | |||
| 727 | Ga0207691_10088387 | |||
| 728 | Ga0207711_10004642 | |||
| 729 | Ga0207667_10027892 | |||
| 730 | Ga0207712_10468849 | |||
| 731 | Ga0207668_10780640 | |||
| 732 | Ga0207640_10069153 | |||
| 733 | Ga0207640_10846025 | |||
| 734 | Ga0207658_10044722 | |||
| 735 | Ga0207658_10574261 | |||
| 736 | Ga0207677_10110193 | |||
| 737 | Ga0207677_10498635 | |||
| 738 | Ga0207703_10169946 | |||
| 739 | Ga0207703_10946685 | |||
| 740 | Ga0207639_10612082 | |||
| 741 | Ga0207678_10097577 | |||
| 742 | Ga0207678_10366722 | |||
| 743 | Ga0207702_10000350 | |||
| 744 | Ga0207702_10224659 | |||
| 745 | Ga0207648_10043345 | |||
| 746 | Ga0207648_10706965 | |||
| 747 | Ga0207676_10189051 | |||
| 748 | Ga0207675_100352506 | |||
| 749 | Ga0207683_10240322 | |||
| 750 | Ga0268266_11872857 | |||
| 751 | Ga0268265_10250693 | |||
| 752 | Ga0268264_10001882 | |||
| 753 | Ga0268264_10029133 | |||
| 754 | Ga0268264_10359404 | |||
| 755 | Ga0265330_10003452 | |||
| 756 | Ga0265340_10001191 | |||
| 757 | Ga0265331_10022357 | |||
| 758 | Ga0265316_10104223 | |||
| 759 | Ga0307509_10338568 | |||
| 760 | Ga0307408_100317972 | |||
| 761 | Ga0265314_10027319 | |||
| 762 | Ga0307516_10038873 | |||
| 763 | Ga0307405_10525445 | |||
| 764 | Ga0307412_10194972 | |||
| 765 | Ga0307416_100236528 | |||
| 766 | Ga0307416_101247215 | |||
| 767 | Ga0307415_101338121 | |||
| 768 | Ga0373948_0158705 | |||
| 769 | Ga0373958_0022332 | |||
| 770 | Ga0373938_0044279 | |||
| 771 | Ga0373926_0040543 | |||
| 772 | Ga0373928_0007159 | |||
| 773 | Ga0373934_0166194 | |||
| 774 | Ga0373944_0064416 | |||
| 775 | Ga0373923_0010215 | |||
| 776 | Ga0373936_0014463 | |||
| 777 | Ga0373939_0018837 | |||
| 778 | Ga0373945_0001600 | |||
| 779 | Ga0373953_0095465 | |||
| 780 | Ga0373954_0439730 | |||
| 781 | Ga0373943_0005257 | |||
| 782 | Ga0373946_0007126 | |||
| 783 | Ga0373946_0099734 | |||
| 784 | Ga0373946_0148522 | |||
| 785 | Ga0373955_0061155 | |||
| 786 | Ga0373942_0034367 | |||
| 787 | Ga0373942_0376405 | |||
| 788 | Ga0373961_0048421 | |||
| 789 | Ga0373962_0048978 | |||
| 790 | Ga0373924_0110795 | |||
| 791 | Ga0373931_0001074 | |||
| 792 | Ga0373931_0005511 | |||
| 793 | Ga0373935_0002645 | |||
| 794 | Ga0373935_0045078 | |||
| 795 | Ga0373935_0343945 | |||
| 796 | Ga0373927_0000575 | |||
| 797 | Ga0373927_0875314 | |||
| 798 | Ga0373933_0161273 | |||
| 799 | Ga0373933_0262267 | |||
| 800 | Ga0373947_0000425 | |||
| 801 | Ga0373937_0006400 | |||
| 802 | Ga0373937_0595183 | |||
| 803 | Ga0373925_0002067 | |||
| 804 | Ga0373925_0268773 | |||
| 805 | Ga0395899_0060304 | |||
| 806 | Ga0395900_0141643 | |||
| 807 | Ga0395898_0108337 | |||
| 808 | Ga0395901_0020648 | |||
| 809 | Ga0436365_1605102 | |||
| 810 | Ga0436361_0132059 | |||
| 811 | Ga0436363_1249664 | |||
| 812 | Ga0436362_1053650 | |||
| 813 | Ga0451843_1572989 | |||
| 814 | Ga0466959_0346004 | |||
| 815 | Ga0466967_0233858 | |||
| 816 | Ga0495603_0000048 | |||
| 817 | Ga0495603_0225820 | |||
| 818 | Ga0495629_0000620 | |||
| 819 | Ga0495629_0016014 | |||
| 820 | Ga0495638_0015679 | |||
| 821 | Ga0495638_0074494 | |||
| 822 | Ga0495641_0030500 | |||
| 823 | Ga0495580_0000084 | |||
| 824 | Ga0495582_0000688 | |||
| 825 | Ga0495639_0000009 | |||
| 826 | Ga0495639_0179717 | |||
| 827 | Ga0495662_0000335 | |||
| 828 | Ga0495664_0003477 | |||
| 829 | Ga0495594_0000197 | |||
| 830 | Ga0495606_0000676 | |||
| 831 | Ga0495618_0302750 | |||
| 832 | Ga0495628_0013890 | |||
| 833 | Ga0495628_0208302 | |||
| 834 | Ga0495628_0362621 | |||
| 835 | Ga0495630_0000906 | |||
| 836 | Ga0495631_0147613 | |||
| 837 | Ga0495632_0364677 | |||
| 838 | Ga0495637_0022511 | |||
| 839 | Ga0495648_0002751 | |||
| 840 | Ga0495648_0187952 | |||
| 841 | Ga0495666_0129878 | |||
| 842 | Ga0495652_0031501 | |||
| 843 | Ga0495654_0021554 | |||
| 844 | Ga0495665_0000131 | |||
| 845 | Ga0495640_0001770 | |||
| 846 | Ga0495640_0706366 | |||
| 847 | Ga0495586_0034707 | |||
| 848 | Ga0495622_0074353 | |||
| 849 | Ga0495667_0018740 | |||
| 850 | Ga0495668_0273024 | |||
| 851 | Ga0495634_0002111 | |||
| 852 | Ga0495625_0069479 | |||
| 853 | Ga0495635_0000119 | |||
| 854 | Ga0495661_0017093 | |||
| 855 | Ga0495588_0120564 | |||
| 856 | Ga0495588_0283052 | |||
| 857 | Ga0495657_0119970 | |||
| 858 | Ga0495657_0216737 | |||
| 859 | Ga0495646_0011788 | |||
| 860 | Ga0495647_0000110 | |||
| 861 | Ga0495658_0001495 | |||
| 862 | Ga0495613_0004156 | |||
| 863 | Ga0495624_0004281 | |||
| 864 | Ga0495670_0184777 | |||
| 865 | Ga0495671_0047795 | |||
| 866 | Ga0495660_0061161 | |||
| 867 | Ga0495581_0000103 | |||
| 868 | Ga0495604_0104337 | |||
| 869 | Ga0495674_0000367 | |||
| 870 | Ga0495672_0111996 | |||
| 871 | Ga0495676_0103320 | |||
| 872 | Ga0495680_0025944 | |||
| 873 | Ga0495683_0424922 | |||
| 874 | Ga0495675_0218207 | |||
| 875 | Ga0495675_0278460 | |||
| 876 | Ga0495681_0082358 | |||
| 877 | Ga0495681_0283066 | |||
| 878 | Ga0495684_0185490 | |||
| 879 | Ga0495684_0332676 | |||
| 880 | Ga0495686_0033893 | |||
| 881 | Ga0495686_0581189 | |||
| 882 | Ga0495593_0000081 | |||
| 883 | Ga0495614_0004594 | |||
| 884 | Ga0495626_0039140 | |||
| 885 | Ga0496100_0047562 | |||
| 886 | Ga0496100_0137698 | |||
| 887 | Ga0496101_0028681 | |||
| 888 | Ga0496101_0965183 | |||
| 889 | Ga0496102_0200644 | |||
| 890 | Ga0496102_0260013 | |||
| 891 | Ga0496102_0351500 | |||
| 892 | Ga0496102_0952616 | |||
| 893 | Ga0496103_0193215 | |||
| 894 | Ga0496103_0243516 | |||
| 895 | Ga0496104_0003524 | |||
| 896 | Ga0496104_0007468 | |||
| 897 | Ga0496105_0282289 | |||
| 898 | Ga0496106_0005298 | |||
| 899 | Ga0496106_0191357 | |||
| 900 | Ga0496107_0009345 | |||
| 901 | Ga0496107_0017275 | |||
| 902 | Ga0496108_0000803 | |||
| 903 | Ga0496108_0177157 | |||
| 904 | Ga0496109_0001236 | |||
| 905 | Ga0496109_0301919 | |||
| 906 | Ga0496109_0338728 | |||
| 907 | Ga0496109_0501815 | |||
| 908 | Ga0496110_0002758 | |||
| 909 | Ga0496110_0182376 | |||
| 910 | Ga0496110_0241849 | |||
| 911 | Ga0496110_1270609 | |||
| 912 | Ga0496111_0095332 | |||
| 913 | Ga0496112_0000015 | |||
| 914 | Ga0496112_0000971 | |||
| 915 | Ga0496112_0128876 | |||
| 916 | Ga0496112_0313221 | |||
| 917 | Ga0496112_1476506 | |||
| 918 | Ga0496113_0165622 | |||
| 919 | Ga0496113_0567248 | |||
| 920 | Ga0496113_0638940 | |||
| 921 | Ga0496114_0279578 | |||
| 922 | Ga0496114_0557728 | |||
| 923 | Ga0496114_0832099 | |||
| 924 | Ga0496114_1147550 | |||
| 925 | Ga0496115_0049844 | |||
| 926 | Ga0496115_0442665 | |||
| 927 | Ga0496116_0017808 | |||
| 928 | Ga0496116_0293803 | |||
| 929 | Ga0496117_0029505 | |||
| 930 | Ga0496117_0061624 | |||
| 931 | Ga0496117_0114529 | |||
| 932 | Ga0496118_0055443 | |||
| 933 | Ga0496118_0079511 | |||
| 934 | Ga0496118_0135609 | |||
| 935 | Ga0496119_0082665 | |||
| 936 | Ga0496119_0096221 | |||
| 937 | Ga0496120_0032227 | |||
| 938 | Ga0496120_0041553 | |||
| 939 | Ga0496121_0014101 | |||
| 940 | Ga0496121_0075971 | |||
| 941 | Ga0496121_0224520 | |||
| 942 | Ga0496122_0037865 | |||
| 943 | Ga0496122_0107651 | |||
| 944 | Ga0496123_0050040 | |||
| 945 | Ga0496123_0122150 | |||
| 946 | Ga0496124_0109575 | |||
| 947 | Ga0496124_0147725 | |||
| 948 | Ga0496125_0008308 | |||
| 949 | Ga0496125_0033092 | |||
| 950 | Ga0496126_0072375 | |||
| 951 | Ga0496126_0074325 | |||
| 952 | Ga0496126_0258679 | |||
| 953 | Ga0496126_0379409 | |||
| 954 | Ga0496126_0968367 | |||
| 955 | Ga0501031_0000413 | |||
| 956 | Ga0501031_0020178 | |||
| 957 | Ga0501031_0085166 | |||
| 958 | Ga0501032_0000887 | |||
| 959 | Ga0501032_0008175 | |||
| 960 | Ga0501032_0019964 | |||
| 961 | Ga0501032_0124980 | |||
| 962 | Ga0501032_0469141 | |||
| 963 | Ga0501033_0000205 | |||
| 964 | Ga0501033_0001299 | |||
| 965 | Ga0501033_0014479 | |||
| 966 | Ga0501033_0049274 | |||
| 967 | Ga0501034_0000058 | |||
| 968 | Ga0501034_0099140 | |||
| 969 | Ga0501034_0109041 | |||
| 970 | Ga0501034_0194981 | |||
| 971 | Ga0501034_0363735 | |||
| 972 | Ga0501034_0378504 | |||
| 973 | Ga0501034_0458825 | |||
| 974 | Ga0501036_0000191 | |||
| 975 | Ga0501036_0032478 | |||
| 976 | Ga0501036_0111620 | |||
| 977 | Ga0501036_0136144 | |||
| 978 | Ga0501036_0841968 | |||
| 979 | Ga0501037_0000078 | |||
| 980 | Ga0501037_0003271 | |||
| 981 | Ga0501037_0095389 | |||
| 982 | Ga0501037_0119616 | |||
| 983 | Ga0501038_0000799 | |||
| 984 | Ga0501038_0001041 | |||
| 985 | Ga0501038_0031495 | |||
| 986 | Ga0501038_0076900 | |||
| 987 | Ga0501038_0116851 | |||
| 988 | Ga0501038_0118896 | |||
| 989 | Ga0501039_0000646 | |||
| 990 | Ga0501039_0015997 | |||
| 991 | Ga0501039_0090085 | |||
| 992 | Ga0501039_0261242 | |||
| 993 | Ga0501039_0340088 | |||
| 994 | Ga0501040_0012606 | |||
| 995 | Ga0501041_0156709 | |||
| 996 | Ga0501042_0009120 | |||
| 997 | Ga0501042_0048328 | |||
| 998 | Ga0501042_0223377 | |||
| 999 | Ga0501043_0000400 | |||
| 1000 | Ga0501043_0023227 | |||
| 1001 | Ga0501043_0037948 | |||
| 1002 | Ga0501043_0062603 | |||
| 1003 | Ga0501043_0091805 | |||
| 1004 | Ga0501043_0292830 | |||
| 1005 | Ga0501043_0299934 | |||
| 1006 | Ga0501043_0552467 | |||
| 1007 | Ga0501046_0002690 | |||
| 1008 | Ga0501046_0072237 | |||
| 1009 | Ga0501046_0347349 | |||
| 1010 | Ga0501046_0347387 | |||
| 1011 | Ga0501047_0000022 | |||
| 1012 | Ga0501047_0003563 | |||
| 1013 | Ga0501047_0050373 | |||
| 1014 | Ga0501047_0118657 | |||
| 1015 | Ga0501047_0210604 | |||
| 1016 | Ga0501047_1053377 | |||
| 1017 | Ga0501048_0000041 | |||
| 1018 | Ga0501048_0043863 | |||
| 1019 | Ga0501048_0261509 | |||
| 1020 | Ga0501067_0000623 | |||
| 1021 | Ga0501067_0015867 | |||
| 1022 | Ga0501067_0230246 | |||
| 1023 | Ga0501068_0001006 | |||
| 1024 | Ga0501068_0025630 | |||
| 1025 | Ga0501069_0000994 | |||
| 1026 | Ga0501069_0108870 | |||
| 1027 | Ga0501069_0308539 | |||
| 1028 | Ga0501069_0809548 | |||
| 1029 | Ga0501070_0006297 | |||
| 1030 | Ga0501070_0023285 | |||
| 1031 | Ga0501070_0072494 | |||
| 1032 | Ga0501070_0098406 | |||
| 1033 | Ga0501070_0340579 | |||
| 1034 | Ga0501070_0521122 | |||
| 1035 | Ga0501071_0004628 | |||
| 1036 | Ga0501071_0026928 | |||
| 1037 | Ga0501072_0010286 | |||
| 1038 | Ga0501072_0238397 | |||
| 1039 | Ga0501072_0500690 | |||
| 1040 | Ga0501073_0000707 | |||
| 1041 | Ga0501073_0031873 | |||
| 1042 | Ga0501073_0239782 | |||
| 1043 | Ga0501074_0000403 | |||
| 1044 | Ga0501074_0030023 | |||
| 1045 | Ga0501076_0012159 | |||
| 1046 | Ga0501077_0072284 | |||
| 1047 | Ga0501079_0002506 | |||
| 1048 | Ga0501079_0049657 | |||
| 1049 | Ga0501080_0016575 | |||
| 1050 | Ga0501080_0162573 | |||
| 1051 | Ga0501080_0939834 | |||
| 1052 | Ga0501081_0135271 | |||
| 1053 | Ga0501083_0000623 | |||
| 1054 | Ga0501083_0006657 | |||
| 1055 | Ga0501083_0698031 | |||
| 1056 | Ga0501035_0000517 | |||
| 1057 | Ga0501035_0039305 | |||
| 1058 | Ga0501035_0062675 | |||
| 1059 | Ga0501035_0169543 | |||
| 1060 | Ga0501035_0194731 | |||
| 1061 | Ga0501035_0409217 | |||
| 1062 | Ga0501044_0000370 | |||
| 1063 | Ga0501044_0016896 | |||
| 1064 | Ga0501044_0022684 | |||
| 1065 | Ga0501044_0116420 | |||
| 1066 | Ga0501044_0206572 | |||
| 1067 | Ga0501044_0286860 | |||
| 1068 | Ga0501044_0355062 | |||
| 1069 | Ga0501044_0458367 | |||
| 1070 | Ga0501044_0927926 | |||
| 1071 | Ga0501045_0006554 | |||
| 1072 | Ga0501045_0021112 | |||
| 1073 | nmdc:mga03n38_234819_c1 | |||
| 1074 | nmdc:mga00v17_216124_c1 | |||
| 1075 | nmdc:mga0yw44_112301_c1 | |||
| 1076 | nmdc:mga0yw44_2232_c1 | |||
| 1077 | nmdc:mga0yw44_99305_c1 | |||
| 1078 | nmdc:mga06z11_409223_c1 | |||
| 1079 | nmdc:mga07m45_97798_c1 | |||
| 1080 | nmdc:mga0n895_310544_c1 | |||
| 1081 | nmdc:mga0sz30_34581_c1 | |||
| 1082 | Ga0495601_0054483 | |||
| 1083 | Ga0495595_0025812 | |||
| 1084 | Ga0495619_0200492 | |||
| 1085 | Ga0500578_0269654 | |||
| 1086 | Ga0500643_025048 | |||
| 1087 | Ga0500644_0150092 | |||
| 1088 | Ga0500644_0159120 | |||
| 1089 | Ga0500647_0017713 | |||
| 1090 | Ga0500651_0084244 | |||
| 1091 | Ga0500651_0142361 | |||
| 1092 | Ga0500566_0000054 | |||
| 1093 | Ga0500566_0000273 | |||
| 1094 | Ga0500640_066194 | |||
| 1095 | Ga0500641_0018037 | |||
| 1096 | Ga0500641_0042888 | |||
| 1097 | Ga0500641_0115977 | |||
| 1098 | Ga0500648_152254 | |||
| 1099 | Ga0500650_0001131 | |||
| 1100 | Ga0500554_015338 | |||
| 1101 | Ga0500556_0000081 | |||
| 1102 | Ga0500557_101006 | |||
| 1103 | Ga0500562_021264 | |||
| 1104 | Ga0500569_004879 | |||
| 1105 | Ga0500572_004102 | |||
| 1106 | Ga0500592_000924 | |||
| 1107 | Ga0500594_0117191 | |||
| 1108 | Ga0500608_037882 | |||
| 1109 | Ga0500618_002100 | |||
| 1110 | Ga0500618_060980 | |||
| 1111 | Ga0500642_0000042 | |||
| 1112 | Ga0500652_001266 | |||
| 1113 | Ga0500559_0000106 | |||
| 1114 | Ga0500559_0425795 | |||
| 1115 | Ga0500568_0001103 | |||
| 1116 | Ga0500577_0071737 | |||
| 1117 | Ga0500586_000217 | |||
| 1118 | Ga0500590_021743 | |||
| 1119 | Ga0500590_123677 | |||
| 1120 | Ga0500604_0016891 | |||
| 1121 | Ga0500616_0000227 | |||
| 1122 | Ga0500619_117264 | |||
| 1123 | Ga0500622_0001577 | |||
| 1124 | Ga0500627_0263181 | |||
| 1125 | Ga0500633_0006675 | |||
| 1126 | Ga0500634_0099904 | |||
| 1127 | Ga0500634_0194481 | |||
| 1128 | Ga0500636_0004953 | |||
| 1129 | Ga0500636_0103478 | |||
| 1130 | Ga0500637_0073465 | |||
| 1131 | Ga0500645_115189 | |||
| 1132 | Ga0500596_015321 | |||
| 1133 | Ga0501084_0000828 | |||
| 1134 | Ga0501084_0136066 | |||
| 1135 | Ga0501082_0003277 | |||
| 1136 | Ga0501082_0071551 | |||
| 1137 | Ga0530510_0349994 | |||
| 1138 | Ga0530510_0523334 | |||
| 1139 | 2513888634 | |||
| 1140 | 2599332470 | |||
| 1141 | 2603858385 | |||
| 1142 | 2857526519 | |||
| 1143 | 2893067232 | |||
| 1144 | 2919073667 | |||
| 1145 | 8006969469 | |||
| 1146 | 8056675607 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mbq-assembly1.cif.gz_B | crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from brucella melitensis, orthorhombic crystal form | 0.9792 | 4 | 134 |
| 3mbq-assembly1.cif.gz_B | crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from brucella melitensis, orthorhombic crystal form | 0.9646 | 4 | 134 |
| 7n56-assembly3.cif.gz_K | crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from rickettsia prowazekii str. madrid e | 0.9587 | 1 | 138 |
| 3mbq-assembly1.cif.gz_C | crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from brucella melitensis, orthorhombic crystal form | 0.953 | 4 | 141 |
| 1sm8-assembly1.cif.gz_C | m. tuberculosis dutpase complexed with chromium and dutp | 0.9495 | 4 | 137 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3mbqA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9765 | 4 | 138 | 2.70.40.10 |
| 3mbqA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9695 | 4 | 138 | 2.70.40.10 |
| 1snfC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9489 | 4 | 137 | 2.70.40.10 |
| 1snfC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9418 | 4 | 137 | 2.70.40.10 |
| af_D4A6V3_49_177_2.70.40.10 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9226 | 42 | 152 | 2.70.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A656KD48-F1-model_v4 | deleted | 0.9936 | 32 | 126 |
|
| AF-A0A357CEZ8-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9876 | 2 | 137 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A1Q3IXS7-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9875 | 6 | 137 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A3S0G9I0-F1-model_v4 | Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (EC 3.6.1.23) (dUTP pyrophosphatase) | 0.9864 | 3 | 147 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A349J258-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9859 | 3 | 135 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |