F465231

General Info

Members Datasets Scaffolds Average Seq Length
573 345 1146 154

Family's Representative Sequence

Representative Sequence 3300046529|Ga0495652_0512195|Ga0495652_0512195_179_637
Length 146
Sequence VSSNVTIEIRQLPHGEGLALPAYQSAHAAGLDLLAAVPEASPLVLAPGKYALVPTGLTYEAQVRPRSGLAAKHGVTVLNAPGTVDADYRGEIGVLLINHGAAPFEIRRGERIAQMVIASVARAELVPVISLSSTERGSGGFGSTGR

Samples

Sample ID Description Type Environment
1 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
137 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
138 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
139 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
140 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
153 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
190 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
193 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
204 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
205 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
227 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
273 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
274 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
279 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
283 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
284 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
287 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
298 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
299 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
300 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
301 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
302 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
303 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
304 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
305 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
306 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
307 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
308 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
309 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
310 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
311 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
312 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
313 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
314 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
315 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
316 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
317 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
318 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
319 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
320 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
321 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
322 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
323 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
324 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
325 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
326 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
327 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
328 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
329 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
330 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
331 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
332 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
333 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
334 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
335 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
337 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
338 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
339 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
340 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
341 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
342 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
343 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
344 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
345 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.6
Metatranscriptomes 0
Isolates 1.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.87
Nodule 0.52
Rhizoplane 7.68
Rhizosphere 73.47
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495652_0512195 3300046529 Bacteria 830
2 JGI25406J46586_10011737 3300003203 Bacteria 3827
3 JGI25153J46596_10108078 3300003215 Bacteria 643
4 JGI25404J52841_10012934 3300003659 Bacteria 1810
5 JGI25404J52841_10027589 3300003659 Bacteria 1221
6 JGI25404J52841_10060461 3300003659 Bacteria 794
7 Ga0070690_100010589 3300005330 Bacteria 5372
8 Ga0070677_10014465 3300005333 Bacteria 2778
9 Ga0070666_10256469 3300005335 Bacteria 1239
10 Ga0068868_100438752 3300005338 Bacteria 1133
11 Ga0070660_100606469 3300005339 Bacteria 915
12 Ga0070689_100002472 3300005340 Bacteria 12069
13 Ga0070692_10396598 3300005345 Bacteria 870
14 Ga0070668_100294799 3300005347 Bacteria 1359
15 Ga0070668_100951538 3300005347 Bacteria 770
16 Ga0070669_100227598 3300005353 Bacteria 1476
17 Ga0070674_100272740 3300005356 Bacteria 1337
18 Ga0070673_100513678 3300005364 Bacteria 1085
19 Ga0070688_100001319 3300005365 Bacteria 12334
20 Ga0070667_100126996 3300005367 Bacteria 2223
21 Ga0070667_100647243 3300005367 Bacteria 976
22 Ga0070667_101241073 3300005367 Bacteria 698
23 Ga0070709_10007588 3300005434 Bacteria 5955
24 Ga0070709_10429197 3300005434 Bacteria 992
25 Ga0070714_100207143 3300005435 Bacteria 1796
26 Ga0070714_100367723 3300005435 Bacteria 1353
27 Ga0070714_100489397 3300005435 Bacteria 1172
28 Ga0070713_100005466 3300005436 Bacteria 8688
29 Ga0070713_100069360 3300005436 Bacteria 2973
30 Ga0070710_10007716 3300005437 Bacteria 5218
31 Ga0070711_100022808 3300005439 Bacteria 4062
32 Ga0070711_100043153 3300005439 Bacteria 3053
33 Ga0070663_100091463 3300005455 Bacteria 2254
34 Ga0070678_100211859 3300005456 Bacteria 1606
35 Ga0070681_10013655 3300005458 Bacteria 8083
36 Ga0068867_100073523 3300005459 Bacteria 2560
37 Ga0068867_100665287 3300005459 Bacteria 915
38 Ga0070707_100501717 3300005468 Bacteria 1175
39 Ga0070698_100035915 3300005471 Bacteria 5123
40 Ga0070699_100915008 3300005518 Bacteria 803
41 Ga0070679_100012418 3300005530 Bacteria 8140
42 Ga0068853_100269057 3300005539 Bacteria 1568
43 Ga0070665_100857093 3300005548 Bacteria 921
44 Ga0068855_100031878 3300005563 Bacteria 6292
45 Ga0068855_100237950 3300005563 Bacteria 2036
46 Ga0068854_100263124 3300005578 Bacteria 1382
47 Ga0068854_101269229 3300005578 Unclassified 662
48 Ga0068856_100000761 3300005614 Bacteria 34979
49 Ga0068856_100393550 3300005614 Bacteria 1405
50 Ga0070702_100246367 3300005615 Bacteria 1209
51 Ga0068859_100631016 3300005617 Bacteria 1164
52 Ga0068864_100278101 3300005618 Bacteria 1562
53 Ga0068864_101669383 3300005618 Bacteria 642
54 Ga0068858_100260578 3300005842 Bacteria 1648
55 Ga0068860_100091477 3300005843 Bacteria 2898
56 Ga0068860_100545064 3300005843 Bacteria 1162
57 Ga0068862_100214801 3300005844 Bacteria 1739
58 Ga0068862_100241429 3300005844 Bacteria 1643
59 Ga0081455_10014276 3300005937 Bacteria 7795
60 Ga0081540_1011614 3300005983 Bacteria 5874
61 Ga0081540_1016829 3300005983 Bacteria 4555
62 Ga0081540_1017969 3300005983 Bacteria 4358
63 Ga0081540_1027265 3300005983 Bacteria 3241
64 Ga0081540_1128393 3300005983 Bacteria 1040
65 Ga0081540_1130164 3300005983 Bacteria 1029
66 Ga0081540_1251141 3300005983 Bacteria 617
67 Ga0081539_10001127 3300005985 Bacteria 48442
68 Ga0081539_10035408 3300005985 Bacteria 3001
69 Ga0081539_10078035 3300005985 Bacteria 1749
70 Ga0081539_10146897 3300005985 Bacteria 1139
71 Ga0070717_10309444 3300006028 Bacteria 1406
72 Ga0075365_10015558 3300006038 Bacteria 4604
73 Ga0075365_10041302 3300006038 Bacteria 3012
74 Ga0075368_10116070 3300006042 Bacteria 1106
75 Ga0075363_100221972 3300006048 Bacteria 1083
76 Ga0075363_100282077 3300006048 Bacteria 961
77 Ga0075363_100296568 3300006048 Bacteria 937
78 Ga0075364_10126659 3300006051 Bacteria 1713
79 Ga0070716_100003112 3300006173 Bacteria 7749
80 Ga0070716_100012502 3300006173 Bacteria 4305
81 Ga0070712_100009673 3300006175 Bacteria 6076
82 Ga0070712_100106433 3300006175 Bacteria 2085
83 Ga0070712_101370368 3300006175 Bacteria 617
84 Ga0075367_10085466 3300006178 Bacteria 1914
85 Ga0075434_100248904 3300006871 Bacteria 1796
86 Ga0068865_100328817 3300006881 Bacteria 1232
87 Ga0068865_100378264 3300006881 Bacteria 1154
88 Ga0097620_100631130 3300006931 Bacteria 1164
89 Ga0105240_10155868 3300009093 Bacteria 2716
90 Ga0105245_10766933 3300009098 Bacteria 1001
91 Ga0105245_10919624 3300009098 Bacteria 917
92 Ga0105245_12823806 3300009098 Bacteria 538
93 Ga0105242_10059068 3300009176 Bacteria 3146
94 Ga0105248_10014730 3300009177 Bacteria 8609
95 Ga0105248_10434792 3300009177 Bacteria 1478
96 Ga0105237_10733242 3300009545 Bacteria 994
97 Ga0105249_10551360 3300009553 Bacteria 1203
98 Ga0099796_10055005 3300010159 Bacteria 1393
99 Ga0105246_10463363 3300011119 Bacteria 1068
100 Ga0157371_10033080 3300013102 Bacteria 3717
101 Ga0157370_10035286 3300013104 Bacteria 4863
102 Ga0157370_10065246 3300013104 Bacteria 3444
103 Ga0157374_11857111 3300013296 Bacteria 628
104 Ga0157378_10612503 3300013297 Bacteria 1101
105 Ga0163162_10587432 3300013306 Bacteria 1240
106 Ga0157372_10094759 3300013307 Bacteria 3400
107 Ga0157375_10236075 3300013308 Bacteria 1988
108 Ga0163163_10111931 3300014325 Bacteria 2759
109 Ga0157380_10157489 3300014326 Bacteria 1970
110 Ga0157377_10744714 3300014745 Bacteria 716
111 Ga0157379_10264408 3300014968 Bacteria 1564
112 Ga0157376_10132235 3300014969 Bacteria 2228
113 Ga0213873_10212355 3300021358 Bacteria 603
114 Ga0213876_10003460 3300021384 Bacteria 9022
115 Ga0209677_100313 3300025253 Bacteria 31691
116 Ga0209564_1006813 3300025295 Bacteria 6039
117 Ga0209758_1012411 3300025297 Bacteria 4772
118 Ga0207682_10073429 3300025893 Bacteria 1453
119 Ga0207692_10006354 3300025898 Bacteria 4790
120 Ga0207692_10010068 3300025898 Bacteria 3970
121 Ga0207642_10355756 3300025899 Bacteria 865
122 Ga0207685_10128967 3300025905 Bacteria 1120
123 Ga0207699_10095323 3300025906 Bacteria 1876
124 Ga0207705_10371690 3300025909 Bacteria 1104
125 Ga0207684_11197892 3300025910 Bacteria 629
126 Ga0207707_10108928 3300025912 Bacteria 2422
127 Ga0207671_10053887 3300025914 Bacteria 2981
128 Ga0207693_10000156 3300025915 Bacteria 63230
129 Ga0207693_10063286 3300025915 Bacteria 2898
130 Ga0207663_10001174 3300025916 Bacteria 12084
131 Ga0207663_10001704 3300025916 Bacteria 10332
132 Ga0207663_10228162 3300025916 Bacteria 1359
133 Ga0207660_10064902 3300025917 Bacteria 2636
134 Ga0207657_10087654 3300025919 Bacteria 2604
135 Ga0207649_10072956 3300025920 Bacteria 2198
136 Ga0207646_10538170 3300025922 Bacteria 1051
137 Ga0207681_10354960 3300025923 Bacteria 1174
138 Ga0207700_10024937 3300025928 Bacteria 4145
139 Ga0207700_10103491 3300025928 Bacteria 2276
140 Ga0207700_10536608 3300025928 Bacteria 1037
141 Ga0207664_10048745 3300025929 Bacteria 3332
142 Ga0207664_10084818 3300025929 Bacteria 2584
143 Ga0207664_10139132 3300025929 Bacteria 2051
144 Ga0207664_10706228 3300025929 Bacteria 907
145 Ga0207644_10033487 3300025931 Bacteria 3591
146 Ga0207644_10718609 3300025931 Bacteria 833
147 Ga0207686_10168712 3300025934 Bacteria 1541
148 Ga0207670_10001012 3300025936 Bacteria 14852
149 Ga0207669_10375514 3300025937 Bacteria 1106
150 Ga0207704_10302518 3300025938 Bacteria 1226
151 Ga0207665_10000235 3300025939 Bacteria 37854
152 Ga0207665_10020075 3300025939 Bacteria 4389
153 Ga0207665_11145388 3300025939 Bacteria 620
154 Ga0207691_10088387 3300025940 Bacteria 2779
155 Ga0207711_10004642 3300025941 Bacteria 11670
156 Ga0207667_10027892 3300025949 Bacteria 6138
157 Ga0207712_10468849 3300025961 Bacteria 1071
158 Ga0207668_10780640 3300025972 Bacteria 844
159 Ga0207640_10069153 3300025981 Bacteria 2369
160 Ga0207640_10846025 3300025981 Bacteria 796
161 Ga0207658_10044722 3300025986 Bacteria 3225
162 Ga0207658_10574261 3300025986 Bacteria 1011
163 Ga0207677_10110193 3300026023 Bacteria 2049
164 Ga0207677_10498635 3300026023 Bacteria 1052
165 Ga0207703_10169946 3300026035 Bacteria 1917
166 Ga0207703_10946685 3300026035 Unclassified 825
167 Ga0207639_10612082 3300026041 Bacteria 1005
168 Ga0207678_10097577 3300026067 Bacteria 2511
169 Ga0207678_10366722 3300026067 Bacteria 1244
170 Ga0207702_10000350 3300026078 Bacteria 52867
171 Ga0207702_10224659 3300026078 Bacteria 1751
172 Ga0207648_10043345 3300026089 Bacteria 3950
173 Ga0207648_10706965 3300026089 Bacteria 934
174 Ga0207676_10189051 3300026095 Bacteria 1810
175 Ga0207675_100352506 3300026118 Bacteria 1442
176 Ga0207683_10240322 3300026121 Bacteria 1652
177 Ga0268266_11872857 3300028379 Bacteria 574
178 Ga0268265_10250693 3300028380 Bacteria 1568
179 Ga0268264_10001882 3300028381 Bacteria 19054
180 Ga0268264_10029133 3300028381 Bacteria 4521
181 Ga0268264_10359404 3300028381 Bacteria 1388
182 Ga0265330_10003452 3300031235 Bacteria 8255
183 Ga0265340_10001191 3300031247 Bacteria 14849
184 Ga0265331_10022357 3300031250 Bacteria 3227
185 Ga0265316_10104223 3300031344 Bacteria 2153
186 Ga0307509_10338568 3300031507 Bacteria 1233
187 Ga0307408_100317972 3300031548 Bacteria 1310
188 Ga0265314_10027319 3300031711 Bacteria 4274
189 Ga0307516_10038873 3300031730 Bacteria 4744
190 Ga0307405_10525445 3300031731 Bacteria 953
191 Ga0307412_10194972 3300031911 Bacteria 1534
192 Ga0307416_100236528 3300032002 Bacteria 1766
193 Ga0307416_101247215 3300032002 Bacteria 849
194 Ga0307415_101338121 3300032126 Bacteria 680
195 Ga0373948_0158705 3300034817 Bacteria 569
196 Ga0373958_0022332 3300034819 Bacteria 1181
197 Ga0373938_0044279 3300034957 Bacteria 998
198 Ga0373926_0040543 3300035083 Bacteria 1662
199 Ga0373928_0007159 3300035084 Bacteria 2151
200 Ga0373934_0166194 3300035086 Bacteria 905
201 Ga0373944_0064416 3300035089 Bacteria 1182
202 Ga0373923_0010215 3300035111 Bacteria 3409
203 Ga0373936_0014463 3300035113 Bacteria 3017
204 Ga0373939_0018837 3300035114 Bacteria 1855
205 Ga0373945_0001600 3300035116 Bacteria 6931
206 Ga0373953_0095465 3300035117 Bacteria 1247
207 Ga0373954_0439730 3300035118 Bacteria 645
208 Ga0373943_0005257 3300035170 Bacteria 5824
209 Ga0373946_0007126 3300035171 Bacteria 4083
210 Ga0373946_0099734 3300035171 Bacteria 1300
211 Ga0373946_0148522 3300035171 Bacteria 1092
212 Ga0373955_0061155 3300035172 Bacteria 2079
213 Ga0373942_0034367 3300035207 Bacteria 1356
214 Ga0373942_0376405 3300035207 Bacteria 506
215 Ga0373961_0048421 3300035241 Bacteria 1252
216 Ga0373962_0048978 3300035242 Bacteria 1213
217 Ga0373924_0110795 3300035410 Bacteria 1186
218 Ga0373931_0001074 3300035691 Bacteria 11553
219 Ga0373931_0005511 3300035691 Bacteria 5861
220 Ga0373935_0002645 3300035692 Bacteria 10292
221 Ga0373935_0045078 3300035692 Bacteria 2781
222 Ga0373935_0343945 3300035692 Bacteria 1062
223 Ga0373927_0000575 3300035695 Bacteria 27971
224 Ga0373927_0875314 3300035695 Bacteria 593
225 Ga0373933_0161273 3300035724 Bacteria 1424
226 Ga0373933_0262267 3300035724 Bacteria 1114
227 Ga0373947_0000425 3300035725 Bacteria 23992
228 Ga0373937_0006400 3300036401 Bacteria 10162
229 Ga0373937_0595183 3300036401 Bacteria 1050
230 Ga0373925_0002067 3300037068 Bacteria 16544
231 Ga0373925_0268773 3300037068 Bacteria 1371
232 Ga0395899_0060304 3300037312 Bacteria 2795
233 Ga0395900_0141643 3300037418 Bacteria 2462
234 Ga0395898_0108337 3300037466 Bacteria 2664
235 Ga0395901_0020648 3300038443 Bacteria 6740
236 Ga0436365_1605102 3300039437 Bacteria 14296
237 Ga0436361_0132059 3300039447 Bacteria 3007
238 Ga0436363_1249664 3300039450 Bacteria 812
239 Ga0436362_1053650 3300039453 Bacteria 4668
240 Ga0451843_1572989 3300041509 Bacteria 621
241 Ga0466959_0346004 3300045049 Bacteria 1014
242 Ga0466967_0233858 3300045976 Bacteria 1751
243 Ga0495603_0000048 3300046455 Bacteria 51928
244 Ga0495603_0225820 3300046455 Bacteria 1080
245 Ga0495629_0000620 3300046459 Bacteria 28889
246 Ga0495629_0016014 3300046459 Bacteria 5389
247 Ga0495638_0015679 3300046460 Bacteria 5082
248 Ga0495638_0074494 3300046460 Bacteria 2070
249 Ga0495641_0030500 3300046461 Bacteria 2585
250 Ga0495580_0000084 3300046472 Bacteria 60217
251 Ga0495582_0000688 3300046473 Bacteria 18626
252 Ga0495639_0000009 3300046475 Bacteria 94240
253 Ga0495639_0179717 3300046475 Bacteria 1030
254 Ga0495662_0000335 3300046476 Bacteria 20522
255 Ga0495664_0003477 3300046477 Bacteria 8575
256 Ga0495594_0000197 3300046499 Bacteria 29482
257 Ga0495606_0000676 3300046507 Bacteria 53366
258 Ga0495618_0302750 3300046514 Bacteria 993
259 Ga0495628_0013890 3300046516 Bacteria 6764
260 Ga0495628_0208302 3300046516 Bacteria 1471
261 Ga0495628_0362621 3300046516 Bacteria 1064
262 Ga0495630_0000906 3300046517 Bacteria 20714
263 Ga0495631_0147613 3300046518 Bacteria 1009
264 Ga0495632_0364677 3300046519 Bacteria 634
265 Ga0495637_0022511 3300046520 Bacteria 2873
266 Ga0495648_0002751 3300046524 Bacteria 15879
267 Ga0495648_0187952 3300046524 Bacteria 1044
268 Ga0495666_0129878 3300046526 Bacteria 1177
269 Ga0495652_0031501 3300046529 Bacteria 4644
270 Ga0495654_0021554 3300046530 Bacteria 3351
271 Ga0495665_0000131 3300046531 Bacteria 35816
272 Ga0495640_0001770 3300046533 Bacteria 17120
273 Ga0495640_0706366 3300046533 Unclassified 605
274 Ga0495586_0034707 3300046535 Bacteria 2710
275 Ga0495622_0074353 3300046557 Bacteria 1567
276 Ga0495667_0018740 3300046559 Bacteria 4672
277 Ga0495668_0273024 3300046616 Bacteria 926
278 Ga0495634_0002111 3300046642 Bacteria 16783
279 Ga0495625_0069479 3300046660 Bacteria 2474
280 Ga0495635_0000119 3300046663 Bacteria 47408
281 Ga0495661_0017093 3300046665 Bacteria 4793
282 Ga0495588_0120564 3300046674 Bacteria 1382
283 Ga0495588_0283052 3300046674 Bacteria 874
284 Ga0495657_0119970 3300046675 Bacteria 1657
285 Ga0495657_0216737 3300046675 Bacteria 1162
286 Ga0495646_0011788 3300046680 Bacteria 5559
287 Ga0495647_0000110 3300046681 Bacteria 20564
288 Ga0495658_0001495 3300046683 Bacteria 12260
289 Ga0495613_0004156 3300046689 Bacteria 10833
290 Ga0495624_0004281 3300046690 Bacteria 10483
291 Ga0495670_0184777 3300046691 Bacteria 1101
292 Ga0495671_0047795 3300046692 Bacteria 2136
293 Ga0495660_0061161 3300046810 Bacteria 2021
294 Ga0495581_0000103 3300047315 Bacteria 35265
295 Ga0495604_0104337 3300047317 Bacteria 2078
296 Ga0495674_0000367 3300047319 Bacteria 40173
297 Ga0495672_0111996 3300047320 Bacteria 1463
298 Ga0495676_0103320 3300047321 Bacteria 2104
299 Ga0495680_0025944 3300047322 Bacteria 4842
300 Ga0495683_0424922 3300047323 Bacteria 549
301 Ga0495675_0218207 3300047444 Bacteria 1155
302 Ga0495675_0278460 3300047444 Bacteria 998
303 Ga0495681_0082358 3300047470 Bacteria 1434
304 Ga0495681_0283066 3300047470 Bacteria 646
305 Ga0495684_0185490 3300047471 Bacteria 1540
306 Ga0495684_0332676 3300047471 Bacteria 1083
307 Ga0495686_0033893 3300047472 Bacteria 3292
308 Ga0495686_0581189 3300047472 Bacteria 582
309 Ga0495593_0000081 3300047673 Bacteria 41353
310 Ga0495614_0004594 3300048089 Bacteria 6216
311 Ga0495626_0039140 3300048091 Bacteria 2245
312 Ga0496100_0047562 3300048903 Bacteria 2765
313 Ga0496100_0137698 3300048903 Bacteria 1727
314 Ga0496101_0028681 3300048904 Bacteria 3888
315 Ga0496101_0965183 3300048904 Bacteria 670
316 Ga0496102_0200644 3300048905 Bacteria 1880
317 Ga0496102_0260013 3300048905 Bacteria 1637
318 Ga0496102_0351500 3300048905 Bacteria 1388
319 Ga0496102_0952616 3300048905 Bacteria 779
320 Ga0496103_0193215 3300048906 Bacteria 1309
321 Ga0496103_0243516 3300048906 Bacteria 1157
322 Ga0496104_0003524 3300048907 Bacteria 13492
323 Ga0496104_0007468 3300048907 Bacteria 9662
324 Ga0496105_0282289 3300048908 Bacteria 1339
325 Ga0496106_0005298 3300048909 Bacteria 9557
326 Ga0496106_0191357 3300048909 Bacteria 1627
327 Ga0496107_0009345 3300048910 Bacteria 6795
328 Ga0496107_0017275 3300048910 Bacteria 5073
329 Ga0496108_0000803 3300048911 Bacteria 24388
330 Ga0496108_0177157 3300048911 Bacteria 1846
331 Ga0496109_0001236 3300048912 Bacteria 21235
332 Ga0496109_0301919 3300048912 Bacteria 1510
333 Ga0496109_0338728 3300048912 Bacteria 1420
334 Ga0496109_0501815 3300048912 Bacteria 1145
335 Ga0496110_0002758 3300048913 Bacteria 13257
336 Ga0496110_0182376 3300048913 Bacteria 1906
337 Ga0496110_0241849 3300048913 Bacteria 1642
338 Ga0496110_1270609 3300048913 Bacteria 645
339 Ga0496111_0095332 3300048914 Bacteria 2183
340 Ga0496112_0000015 3300048915 Bacteria 206423
341 Ga0496112_0000971 3300048915 Bacteria 20892
342 Ga0496112_0128876 3300048915 Bacteria 2501
343 Ga0496112_0313221 3300048915 Bacteria 1514
344 Ga0496112_1476506 3300048915 Bacteria 594
345 Ga0496113_0165622 3300048916 Bacteria 1749
346 Ga0496113_0567248 3300048916 Bacteria 910
347 Ga0496113_0638940 3300048916 Bacteria 851
348 Ga0496114_0279578 3300048917 Bacteria 1471
349 Ga0496114_0557728 3300048917 Bacteria 1012
350 Ga0496114_0832099 3300048917 Bacteria 803
351 Ga0496114_1147550 3300048917 Bacteria 662
352 Ga0496115_0049844 3300048918 Bacteria 3353
353 Ga0496115_0442665 3300048918 Bacteria 1050
354 Ga0496116_0017808 3300048919 Bacteria 5500
355 Ga0496116_0293803 3300048919 Bacteria 778
356 Ga0496117_0029505 3300048920 Bacteria 4227
357 Ga0496117_0061624 3300048920 Bacteria 2577
358 Ga0496117_0114529 3300048920 Bacteria 1671
359 Ga0496118_0055443 3300048921 Bacteria 2991
360 Ga0496118_0079511 3300048921 Bacteria 2313
361 Ga0496118_0135609 3300048921 Bacteria 1571
362 Ga0496119_0082665 3300048922 Bacteria 1847
363 Ga0496119_0096221 3300048922 Bacteria 1671
364 Ga0496120_0032227 3300048923 Bacteria 3162
365 Ga0496120_0041553 3300048923 Bacteria 2692
366 Ga0496121_0014101 3300048924 Bacteria 8520
367 Ga0496121_0075971 3300048924 Bacteria 2681
368 Ga0496121_0224520 3300048924 Bacteria 1320
369 Ga0496122_0037865 3300048925 Bacteria 3874
370 Ga0496122_0107651 3300048925 Bacteria 1841
371 Ga0496123_0050040 3300048926 Bacteria 2795
372 Ga0496123_0122150 3300048926 Bacteria 1462
373 Ga0496124_0109575 3300048927 Bacteria 2225
374 Ga0496124_0147725 3300048927 Bacteria 1848
375 Ga0496125_0008308 3300048928 Bacteria 10899
376 Ga0496125_0033092 3300048928 Bacteria 4581
377 Ga0496126_0072375 3300048929 Bacteria 3066
378 Ga0496126_0074325 3300048929 Bacteria 3019
379 Ga0496126_0258679 3300048929 Bacteria 1448
380 Ga0496126_0379409 3300048929 Bacteria 1151
381 Ga0496126_0968367 3300048929 Bacteria 640
382 Ga0501031_0000413 3300049568 Bacteria 24721
383 Ga0501031_0020178 3300049568 Bacteria 4344
384 Ga0501031_0085166 3300049568 Bacteria 2060
385 Ga0501032_0000887 3300049569 Bacteria 24230
386 Ga0501032_0008175 3300049569 Bacteria 7627
387 Ga0501032_0019964 3300049569 Bacteria 4676
388 Ga0501032_0124980 3300049569 Bacteria 1699
389 Ga0501032_0469141 3300049569 Bacteria 806
390 Ga0501033_0000205 3300049570 Bacteria 56697
391 Ga0501033_0001299 3300049570 Bacteria 22220
392 Ga0501033_0014479 3300049570 Bacteria 5987
393 Ga0501033_0049274 3300049570 Bacteria 3126
394 Ga0501034_0000058 3300049571 Bacteria 198554
395 Ga0501034_0099140 3300049571 Bacteria 2908
396 Ga0501034_0109041 3300049571 Bacteria 2759
397 Ga0501034_0194981 3300049571 Bacteria 1986
398 Ga0501034_0363735 3300049571 Bacteria 1373
399 Ga0501034_0378504 3300049571 Bacteria 1341
400 Ga0501034_0458825 3300049571 Bacteria 1191
401 Ga0501036_0000191 3300049572 Bacteria 40653
402 Ga0501036_0032478 3300049572 Bacteria 4410
403 Ga0501036_0111620 3300049572 Bacteria 2310
404 Ga0501036_0136144 3300049572 Bacteria 2073
405 Ga0501036_0841968 3300049572 Bacteria 754
406 Ga0501037_0000078 3300049573 Bacteria 90398
407 Ga0501037_0003271 3300049573 Bacteria 11763
408 Ga0501037_0095389 3300049573 Bacteria 2150
409 Ga0501037_0119616 3300049573 Bacteria 1894
410 Ga0501038_0000799 3300049574 Bacteria 27929
411 Ga0501038_0001041 3300049574 Bacteria 25043
412 Ga0501038_0031495 3300049574 Bacteria 4686
413 Ga0501038_0076900 3300049574 Bacteria 2819
414 Ga0501038_0116851 3300049574 Bacteria 2204
415 Ga0501038_0118896 3300049574 Bacteria 2181
416 Ga0501039_0000646 3300049575 Bacteria 25240
417 Ga0501039_0015997 3300049575 Bacteria 5744
418 Ga0501039_0090085 3300049575 Bacteria 2391
419 Ga0501039_0261242 3300049575 Bacteria 1361
420 Ga0501039_0340088 3300049575 Bacteria 1179
421 Ga0501040_0012606 3300049576 Bacteria 5543
422 Ga0501041_0156709 3300049577 Bacteria 1423
423 Ga0501042_0009120 3300049578 Bacteria 6595
424 Ga0501042_0048328 3300049578 Bacteria 3033
425 Ga0501042_0223377 3300049578 Bacteria 1358
426 Ga0501043_0000400 3300049579 Bacteria 38956
427 Ga0501043_0023227 3300049579 Bacteria 4864
428 Ga0501043_0037948 3300049579 Bacteria 3789
429 Ga0501043_0062603 3300049579 Bacteria 2921
430 Ga0501043_0091805 3300049579 Bacteria 2387
431 Ga0501043_0292830 3300049579 Bacteria 1246
432 Ga0501043_0299934 3300049579 Bacteria 1228
433 Ga0501043_0552467 3300049579 Bacteria 855
434 Ga0501046_0002690 3300049580 Bacteria 16557
435 Ga0501046_0072237 3300049580 Bacteria 2680
436 Ga0501046_0347349 3300049580 Bacteria 1077
437 Ga0501046_0347387 3300049580 Bacteria 1077
438 Ga0501047_0000022 3300049581 Bacteria 249062
439 Ga0501047_0003563 3300049581 Bacteria 14700
440 Ga0501047_0050373 3300049581 Bacteria 4021
441 Ga0501047_0118657 3300049581 Bacteria 2527
442 Ga0501047_0210604 3300049581 Bacteria 1802
443 Ga0501047_1053377 3300049581 Bacteria 627
444 Ga0501048_0000041 3300049582 Bacteria 62410
445 Ga0501048_0043863 3300049582 Bacteria 3200
446 Ga0501048_0261509 3300049582 Bacteria 1229
447 Ga0501067_0000623 3300049583 Bacteria 19087
448 Ga0501067_0015867 3300049583 Bacteria 4166
449 Ga0501067_0230246 3300049583 Bacteria 1031
450 Ga0501068_0001006 3300049584 Bacteria 14848
451 Ga0501068_0025630 3300049584 Bacteria 3469
452 Ga0501069_0000994 3300049585 Bacteria 13524
453 Ga0501069_0108870 3300049585 Bacteria 1577
454 Ga0501069_0308539 3300049585 Bacteria 928
455 Ga0501069_0809548 3300049585 Bacteria 568
456 Ga0501070_0006297 3300049586 Bacteria 10102
457 Ga0501070_0023285 3300049586 Bacteria 5187
458 Ga0501070_0072494 3300049586 Bacteria 2851
459 Ga0501070_0098406 3300049586 Bacteria 2420
460 Ga0501070_0340579 3300049586 Bacteria 1218
461 Ga0501070_0521122 3300049586 Bacteria 954
462 Ga0501071_0004628 3300049587 Bacteria 8733
463 Ga0501071_0026928 3300049587 Bacteria 4041
464 Ga0501072_0010286 3300049588 Bacteria 7128
465 Ga0501072_0238397 3300049588 Bacteria 1448
466 Ga0501072_0500690 3300049588 Bacteria 961
467 Ga0501073_0000707 3300049589 Bacteria 23568
468 Ga0501073_0031873 3300049589 Bacteria 3760
469 Ga0501073_0239782 3300049589 Bacteria 1252
470 Ga0501074_0000403 3300049590 Bacteria 25812
471 Ga0501074_0030023 3300049590 Bacteria 3939
472 Ga0501076_0012159 3300049592 Bacteria 6435
473 Ga0501077_0072284 3300049593 Bacteria 2186
474 Ga0501079_0002506 3300049741 Bacteria 13340
475 Ga0501079_0049657 3300049741 Bacteria 3238
476 Ga0501080_0016575 3300049742 Bacteria 6806
477 Ga0501080_0162573 3300049742 Bacteria 2061
478 Ga0501080_0939834 3300049742 Bacteria 752
479 Ga0501081_0135271 3300049743 Bacteria 1764
480 Ga0501083_0000623 3300049744 Bacteria 22875
481 Ga0501083_0006657 3300049744 Bacteria 8198
482 Ga0501083_0698031 3300049744 Bacteria 660
483 Ga0501035_0000517 3300049822 Bacteria 43406
484 Ga0501035_0039305 3300049822 Bacteria 4281
485 Ga0501035_0062675 3300049822 Bacteria 3308
486 Ga0501035_0169543 3300049822 Bacteria 1886
487 Ga0501035_0194731 3300049822 Bacteria 1741
488 Ga0501035_0409217 3300049822 Bacteria 1127
489 Ga0501044_0000370 3300049823 Bacteria 56259
490 Ga0501044_0016896 3300049823 Bacteria 7828
491 Ga0501044_0022684 3300049823 Bacteria 6684
492 Ga0501044_0116420 3300049823 Bacteria 2678
493 Ga0501044_0206572 3300049823 Bacteria 1920
494 Ga0501044_0286860 3300049823 Bacteria 1578
495 Ga0501044_0355062 3300049823 Bacteria 1385
496 Ga0501044_0458367 3300049823 Bacteria 1180
497 Ga0501044_0927926 3300049823 Bacteria 744
498 Ga0501045_0006554 3300049824 Bacteria 8069
499 Ga0501045_0021112 3300049824 Bacteria 4657
500 nmdc:mga03n38_234819_c1 3300050490 Bacteria 963
501 nmdc:mga00v17_216124_c1 3300050491 Bacteria 1241
502 nmdc:mga0yw44_112301_c1 3300050492 Bacteria 1747
503 nmdc:mga0yw44_2232_c1 3300050492 Bacteria 8167
504 nmdc:mga0yw44_99305_c1 3300050492 Bacteria 1852
505 nmdc:mga06z11_409223_c1 3300050494 Bacteria 817
506 nmdc:mga07m45_97798_c1 3300050496 Bacteria 1684
507 nmdc:mga0n895_310544_c1 3300050512 Bacteria 1598
508 nmdc:mga0sz30_34581_c1 3300050516 Bacteria 2105
509 Ga0495601_0054483 3300053077 Bacteria 2530
510 Ga0495595_0025812 3300053084 Bacteria 2606
511 Ga0495619_0200492 3300053085 Bacteria 1381
512 Ga0500578_0269654 3300053086 Bacteria 1019
513 Ga0500643_025048 3300053087 Bacteria 1885
514 Ga0500644_0150092 3300053088 Bacteria 933
515 Ga0500644_0159120 3300053088 Bacteria 911
516 Ga0500647_0017713 3300053091 Bacteria 3289
517 Ga0500651_0084244 3300053093 Bacteria 1966
518 Ga0500651_0142361 3300053093 Bacteria 1444
519 Ga0500566_0000054 3300053094 Bacteria 54975
520 Ga0500566_0000273 3300053094 Bacteria 27887
521 Ga0500640_066194 3300053095 Bacteria 1558
522 Ga0500641_0018037 3300053096 Bacteria 2649
523 Ga0500641_0042888 3300053096 Bacteria 1834
524 Ga0500641_0115977 3300053096 Bacteria 1153
525 Ga0500648_152254 3300053097 Bacteria 1228
526 Ga0500650_0001131 3300053098 Bacteria 7742
527 Ga0500554_015338 3300053102 Bacteria 1999
528 Ga0500556_0000081 3300053104 Bacteria 90508
529 Ga0500557_101006 3300053105 Bacteria 958
530 Ga0500562_021264 3300053108 Bacteria 1687
531 Ga0500569_004879 3300053109 Bacteria 2850
532 Ga0500572_004102 3300053111 Bacteria 3308
533 Ga0500592_000924 3300053116 Bacteria 4789
534 Ga0500594_0117191 3300053118 Bacteria 833
535 Ga0500608_037882 3300053122 Bacteria 2305
536 Ga0500618_002100 3300053125 Bacteria 7903
537 Ga0500618_060980 3300053125 Bacteria 848
538 Ga0500642_0000042 3300053130 Bacteria 86476
539 Ga0500652_001266 3300053131 Bacteria 8023
540 Ga0500559_0000106 3300053136 Bacteria 65670
541 Ga0500559_0425795 3300053136 Bacteria 615
542 Ga0500568_0001103 3300053139 Bacteria 18169
543 Ga0500577_0071737 3300053142 Bacteria 1360
544 Ga0500586_000217 3300053145 Bacteria 11350
545 Ga0500590_021743 3300053148 Bacteria 3329
546 Ga0500590_123677 3300053148 Bacteria 1208
547 Ga0500604_0016891 3300053151 Bacteria 2013
548 Ga0500616_0000227 3300053153 Bacteria 88098
549 Ga0500619_117264 3300053154 Bacteria 907
550 Ga0500622_0001577 3300053156 Bacteria 17942
551 Ga0500627_0263181 3300053158 Bacteria 760
552 Ga0500633_0006675 3300053160 Bacteria 2847
553 Ga0500634_0099904 3300053161 Bacteria 1454
554 Ga0500634_0194481 3300053161 Bacteria 898
555 Ga0500636_0004953 3300053177 Bacteria 7562
556 Ga0500636_0103478 3300053177 Bacteria 1616
557 Ga0500637_0073465 3300053178 Bacteria 1969
558 Ga0500645_115189 3300053730 Bacteria 752
559 Ga0500596_015321 3300053735 Bacteria 1151
560 Ga0501084_0000828 3300054114 Bacteria 23846
561 Ga0501084_0136066 3300054114 Bacteria 2068
562 Ga0501082_0003277 3300060353 Bacteria 14134
563 Ga0501082_0071551 3300060353 Bacteria 2986
564 Ga0530510_0349994 3300061734 Bacteria 1110
565 Ga0530510_0523334 3300061734 Bacteria 900
566 2513888634 2513237141 Bacteria 8496279
567 2599332470 2599185156 Bacteria 5403036
568 2603858385 2602042107 Bacteria 6226103
569 2857526519 2857524615 Bacteria 6615449
570 2893067232 2893066018 Bacteria 6158120
571 2919073667 2919073203 Bacteria 6531949
572 8006969469 8006964411 Bacteria 8966052
573 8056675607 8056673599 Bacteria 7871253
574 Ga0495652_0512195
575 JGI25406J46586_10011737
576 JGI25153J46596_10108078
577 JGI25404J52841_10012934
578 JGI25404J52841_10027589
579 JGI25404J52841_10060461
580 Ga0070690_100010589
581 Ga0070677_10014465
582 Ga0070666_10256469
583 Ga0068868_100438752
584 Ga0070660_100606469
585 Ga0070689_100002472
586 Ga0070692_10396598
587 Ga0070668_100294799
588 Ga0070668_100951538
589 Ga0070669_100227598
590 Ga0070674_100272740
591 Ga0070673_100513678
592 Ga0070688_100001319
593 Ga0070667_100126996
594 Ga0070667_100647243
595 Ga0070667_101241073
596 Ga0070709_10007588
597 Ga0070709_10429197
598 Ga0070714_100207143
599 Ga0070714_100367723
600 Ga0070714_100489397
601 Ga0070713_100005466
602 Ga0070713_100069360
603 Ga0070710_10007716
604 Ga0070711_100022808
605 Ga0070711_100043153
606 Ga0070663_100091463
607 Ga0070678_100211859
608 Ga0070681_10013655
609 Ga0068867_100073523
610 Ga0068867_100665287
611 Ga0070707_100501717
612 Ga0070698_100035915
613 Ga0070699_100915008
614 Ga0070679_100012418
615 Ga0068853_100269057
616 Ga0070665_100857093
617 Ga0068855_100031878
618 Ga0068855_100237950
619 Ga0068854_100263124
620 Ga0068854_101269229
621 Ga0068856_100000761
622 Ga0068856_100393550
623 Ga0070702_100246367
624 Ga0068859_100631016
625 Ga0068864_100278101
626 Ga0068864_101669383
627 Ga0068858_100260578
628 Ga0068860_100091477
629 Ga0068860_100545064
630 Ga0068862_100214801
631 Ga0068862_100241429
632 Ga0081455_10014276
633 Ga0081540_1011614
634 Ga0081540_1016829
635 Ga0081540_1017969
636 Ga0081540_1027265
637 Ga0081540_1128393
638 Ga0081540_1130164
639 Ga0081540_1251141
640 Ga0081539_10001127
641 Ga0081539_10035408
642 Ga0081539_10078035
643 Ga0081539_10146897
644 Ga0070717_10309444
645 Ga0075365_10015558
646 Ga0075365_10041302
647 Ga0075368_10116070
648 Ga0075363_100221972
649 Ga0075363_100282077
650 Ga0075363_100296568
651 Ga0075364_10126659
652 Ga0070716_100003112
653 Ga0070716_100012502
654 Ga0070712_100009673
655 Ga0070712_100106433
656 Ga0070712_101370368
657 Ga0075367_10085466
658 Ga0075434_100248904
659 Ga0068865_100328817
660 Ga0068865_100378264
661 Ga0097620_100631130
662 Ga0105240_10155868
663 Ga0105245_10766933
664 Ga0105245_10919624
665 Ga0105245_12823806
666 Ga0105242_10059068
667 Ga0105248_10014730
668 Ga0105248_10434792
669 Ga0105237_10733242
670 Ga0105249_10551360
671 Ga0099796_10055005
672 Ga0105246_10463363
673 Ga0157371_10033080
674 Ga0157370_10035286
675 Ga0157370_10065246
676 Ga0157374_11857111
677 Ga0157378_10612503
678 Ga0163162_10587432
679 Ga0157372_10094759
680 Ga0157375_10236075
681 Ga0163163_10111931
682 Ga0157380_10157489
683 Ga0157377_10744714
684 Ga0157379_10264408
685 Ga0157376_10132235
686 Ga0213873_10212355
687 Ga0213876_10003460
688 Ga0209677_100313
689 Ga0209564_1006813
690 Ga0209758_1012411
691 Ga0207682_10073429
692 Ga0207692_10006354
693 Ga0207692_10010068
694 Ga0207642_10355756
695 Ga0207685_10128967
696 Ga0207699_10095323
697 Ga0207705_10371690
698 Ga0207684_11197892
699 Ga0207707_10108928
700 Ga0207671_10053887
701 Ga0207693_10000156
702 Ga0207693_10063286
703 Ga0207663_10001174
704 Ga0207663_10001704
705 Ga0207663_10228162
706 Ga0207660_10064902
707 Ga0207657_10087654
708 Ga0207649_10072956
709 Ga0207646_10538170
710 Ga0207681_10354960
711 Ga0207700_10024937
712 Ga0207700_10103491
713 Ga0207700_10536608
714 Ga0207664_10048745
715 Ga0207664_10084818
716 Ga0207664_10139132
717 Ga0207664_10706228
718 Ga0207644_10033487
719 Ga0207644_10718609
720 Ga0207686_10168712
721 Ga0207670_10001012
722 Ga0207669_10375514
723 Ga0207704_10302518
724 Ga0207665_10000235
725 Ga0207665_10020075
726 Ga0207665_11145388
727 Ga0207691_10088387
728 Ga0207711_10004642
729 Ga0207667_10027892
730 Ga0207712_10468849
731 Ga0207668_10780640
732 Ga0207640_10069153
733 Ga0207640_10846025
734 Ga0207658_10044722
735 Ga0207658_10574261
736 Ga0207677_10110193
737 Ga0207677_10498635
738 Ga0207703_10169946
739 Ga0207703_10946685
740 Ga0207639_10612082
741 Ga0207678_10097577
742 Ga0207678_10366722
743 Ga0207702_10000350
744 Ga0207702_10224659
745 Ga0207648_10043345
746 Ga0207648_10706965
747 Ga0207676_10189051
748 Ga0207675_100352506
749 Ga0207683_10240322
750 Ga0268266_11872857
751 Ga0268265_10250693
752 Ga0268264_10001882
753 Ga0268264_10029133
754 Ga0268264_10359404
755 Ga0265330_10003452
756 Ga0265340_10001191
757 Ga0265331_10022357
758 Ga0265316_10104223
759 Ga0307509_10338568
760 Ga0307408_100317972
761 Ga0265314_10027319
762 Ga0307516_10038873
763 Ga0307405_10525445
764 Ga0307412_10194972
765 Ga0307416_100236528
766 Ga0307416_101247215
767 Ga0307415_101338121
768 Ga0373948_0158705
769 Ga0373958_0022332
770 Ga0373938_0044279
771 Ga0373926_0040543
772 Ga0373928_0007159
773 Ga0373934_0166194
774 Ga0373944_0064416
775 Ga0373923_0010215
776 Ga0373936_0014463
777 Ga0373939_0018837
778 Ga0373945_0001600
779 Ga0373953_0095465
780 Ga0373954_0439730
781 Ga0373943_0005257
782 Ga0373946_0007126
783 Ga0373946_0099734
784 Ga0373946_0148522
785 Ga0373955_0061155
786 Ga0373942_0034367
787 Ga0373942_0376405
788 Ga0373961_0048421
789 Ga0373962_0048978
790 Ga0373924_0110795
791 Ga0373931_0001074
792 Ga0373931_0005511
793 Ga0373935_0002645
794 Ga0373935_0045078
795 Ga0373935_0343945
796 Ga0373927_0000575
797 Ga0373927_0875314
798 Ga0373933_0161273
799 Ga0373933_0262267
800 Ga0373947_0000425
801 Ga0373937_0006400
802 Ga0373937_0595183
803 Ga0373925_0002067
804 Ga0373925_0268773
805 Ga0395899_0060304
806 Ga0395900_0141643
807 Ga0395898_0108337
808 Ga0395901_0020648
809 Ga0436365_1605102
810 Ga0436361_0132059
811 Ga0436363_1249664
812 Ga0436362_1053650
813 Ga0451843_1572989
814 Ga0466959_0346004
815 Ga0466967_0233858
816 Ga0495603_0000048
817 Ga0495603_0225820
818 Ga0495629_0000620
819 Ga0495629_0016014
820 Ga0495638_0015679
821 Ga0495638_0074494
822 Ga0495641_0030500
823 Ga0495580_0000084
824 Ga0495582_0000688
825 Ga0495639_0000009
826 Ga0495639_0179717
827 Ga0495662_0000335
828 Ga0495664_0003477
829 Ga0495594_0000197
830 Ga0495606_0000676
831 Ga0495618_0302750
832 Ga0495628_0013890
833 Ga0495628_0208302
834 Ga0495628_0362621
835 Ga0495630_0000906
836 Ga0495631_0147613
837 Ga0495632_0364677
838 Ga0495637_0022511
839 Ga0495648_0002751
840 Ga0495648_0187952
841 Ga0495666_0129878
842 Ga0495652_0031501
843 Ga0495654_0021554
844 Ga0495665_0000131
845 Ga0495640_0001770
846 Ga0495640_0706366
847 Ga0495586_0034707
848 Ga0495622_0074353
849 Ga0495667_0018740
850 Ga0495668_0273024
851 Ga0495634_0002111
852 Ga0495625_0069479
853 Ga0495635_0000119
854 Ga0495661_0017093
855 Ga0495588_0120564
856 Ga0495588_0283052
857 Ga0495657_0119970
858 Ga0495657_0216737
859 Ga0495646_0011788
860 Ga0495647_0000110
861 Ga0495658_0001495
862 Ga0495613_0004156
863 Ga0495624_0004281
864 Ga0495670_0184777
865 Ga0495671_0047795
866 Ga0495660_0061161
867 Ga0495581_0000103
868 Ga0495604_0104337
869 Ga0495674_0000367
870 Ga0495672_0111996
871 Ga0495676_0103320
872 Ga0495680_0025944
873 Ga0495683_0424922
874 Ga0495675_0218207
875 Ga0495675_0278460
876 Ga0495681_0082358
877 Ga0495681_0283066
878 Ga0495684_0185490
879 Ga0495684_0332676
880 Ga0495686_0033893
881 Ga0495686_0581189
882 Ga0495593_0000081
883 Ga0495614_0004594
884 Ga0495626_0039140
885 Ga0496100_0047562
886 Ga0496100_0137698
887 Ga0496101_0028681
888 Ga0496101_0965183
889 Ga0496102_0200644
890 Ga0496102_0260013
891 Ga0496102_0351500
892 Ga0496102_0952616
893 Ga0496103_0193215
894 Ga0496103_0243516
895 Ga0496104_0003524
896 Ga0496104_0007468
897 Ga0496105_0282289
898 Ga0496106_0005298
899 Ga0496106_0191357
900 Ga0496107_0009345
901 Ga0496107_0017275
902 Ga0496108_0000803
903 Ga0496108_0177157
904 Ga0496109_0001236
905 Ga0496109_0301919
906 Ga0496109_0338728
907 Ga0496109_0501815
908 Ga0496110_0002758
909 Ga0496110_0182376
910 Ga0496110_0241849
911 Ga0496110_1270609
912 Ga0496111_0095332
913 Ga0496112_0000015
914 Ga0496112_0000971
915 Ga0496112_0128876
916 Ga0496112_0313221
917 Ga0496112_1476506
918 Ga0496113_0165622
919 Ga0496113_0567248
920 Ga0496113_0638940
921 Ga0496114_0279578
922 Ga0496114_0557728
923 Ga0496114_0832099
924 Ga0496114_1147550
925 Ga0496115_0049844
926 Ga0496115_0442665
927 Ga0496116_0017808
928 Ga0496116_0293803
929 Ga0496117_0029505
930 Ga0496117_0061624
931 Ga0496117_0114529
932 Ga0496118_0055443
933 Ga0496118_0079511
934 Ga0496118_0135609
935 Ga0496119_0082665
936 Ga0496119_0096221
937 Ga0496120_0032227
938 Ga0496120_0041553
939 Ga0496121_0014101
940 Ga0496121_0075971
941 Ga0496121_0224520
942 Ga0496122_0037865
943 Ga0496122_0107651
944 Ga0496123_0050040
945 Ga0496123_0122150
946 Ga0496124_0109575
947 Ga0496124_0147725
948 Ga0496125_0008308
949 Ga0496125_0033092
950 Ga0496126_0072375
951 Ga0496126_0074325
952 Ga0496126_0258679
953 Ga0496126_0379409
954 Ga0496126_0968367
955 Ga0501031_0000413
956 Ga0501031_0020178
957 Ga0501031_0085166
958 Ga0501032_0000887
959 Ga0501032_0008175
960 Ga0501032_0019964
961 Ga0501032_0124980
962 Ga0501032_0469141
963 Ga0501033_0000205
964 Ga0501033_0001299
965 Ga0501033_0014479
966 Ga0501033_0049274
967 Ga0501034_0000058
968 Ga0501034_0099140
969 Ga0501034_0109041
970 Ga0501034_0194981
971 Ga0501034_0363735
972 Ga0501034_0378504
973 Ga0501034_0458825
974 Ga0501036_0000191
975 Ga0501036_0032478
976 Ga0501036_0111620
977 Ga0501036_0136144
978 Ga0501036_0841968
979 Ga0501037_0000078
980 Ga0501037_0003271
981 Ga0501037_0095389
982 Ga0501037_0119616
983 Ga0501038_0000799
984 Ga0501038_0001041
985 Ga0501038_0031495
986 Ga0501038_0076900
987 Ga0501038_0116851
988 Ga0501038_0118896
989 Ga0501039_0000646
990 Ga0501039_0015997
991 Ga0501039_0090085
992 Ga0501039_0261242
993 Ga0501039_0340088
994 Ga0501040_0012606
995 Ga0501041_0156709
996 Ga0501042_0009120
997 Ga0501042_0048328
998 Ga0501042_0223377
999 Ga0501043_0000400
1000 Ga0501043_0023227
1001 Ga0501043_0037948
1002 Ga0501043_0062603
1003 Ga0501043_0091805
1004 Ga0501043_0292830
1005 Ga0501043_0299934
1006 Ga0501043_0552467
1007 Ga0501046_0002690
1008 Ga0501046_0072237
1009 Ga0501046_0347349
1010 Ga0501046_0347387
1011 Ga0501047_0000022
1012 Ga0501047_0003563
1013 Ga0501047_0050373
1014 Ga0501047_0118657
1015 Ga0501047_0210604
1016 Ga0501047_1053377
1017 Ga0501048_0000041
1018 Ga0501048_0043863
1019 Ga0501048_0261509
1020 Ga0501067_0000623
1021 Ga0501067_0015867
1022 Ga0501067_0230246
1023 Ga0501068_0001006
1024 Ga0501068_0025630
1025 Ga0501069_0000994
1026 Ga0501069_0108870
1027 Ga0501069_0308539
1028 Ga0501069_0809548
1029 Ga0501070_0006297
1030 Ga0501070_0023285
1031 Ga0501070_0072494
1032 Ga0501070_0098406
1033 Ga0501070_0340579
1034 Ga0501070_0521122
1035 Ga0501071_0004628
1036 Ga0501071_0026928
1037 Ga0501072_0010286
1038 Ga0501072_0238397
1039 Ga0501072_0500690
1040 Ga0501073_0000707
1041 Ga0501073_0031873
1042 Ga0501073_0239782
1043 Ga0501074_0000403
1044 Ga0501074_0030023
1045 Ga0501076_0012159
1046 Ga0501077_0072284
1047 Ga0501079_0002506
1048 Ga0501079_0049657
1049 Ga0501080_0016575
1050 Ga0501080_0162573
1051 Ga0501080_0939834
1052 Ga0501081_0135271
1053 Ga0501083_0000623
1054 Ga0501083_0006657
1055 Ga0501083_0698031
1056 Ga0501035_0000517
1057 Ga0501035_0039305
1058 Ga0501035_0062675
1059 Ga0501035_0169543
1060 Ga0501035_0194731
1061 Ga0501035_0409217
1062 Ga0501044_0000370
1063 Ga0501044_0016896
1064 Ga0501044_0022684
1065 Ga0501044_0116420
1066 Ga0501044_0206572
1067 Ga0501044_0286860
1068 Ga0501044_0355062
1069 Ga0501044_0458367
1070 Ga0501044_0927926
1071 Ga0501045_0006554
1072 Ga0501045_0021112
1073 nmdc:mga03n38_234819_c1
1074 nmdc:mga00v17_216124_c1
1075 nmdc:mga0yw44_112301_c1
1076 nmdc:mga0yw44_2232_c1
1077 nmdc:mga0yw44_99305_c1
1078 nmdc:mga06z11_409223_c1
1079 nmdc:mga07m45_97798_c1
1080 nmdc:mga0n895_310544_c1
1081 nmdc:mga0sz30_34581_c1
1082 Ga0495601_0054483
1083 Ga0495595_0025812
1084 Ga0495619_0200492
1085 Ga0500578_0269654
1086 Ga0500643_025048
1087 Ga0500644_0150092
1088 Ga0500644_0159120
1089 Ga0500647_0017713
1090 Ga0500651_0084244
1091 Ga0500651_0142361
1092 Ga0500566_0000054
1093 Ga0500566_0000273
1094 Ga0500640_066194
1095 Ga0500641_0018037
1096 Ga0500641_0042888
1097 Ga0500641_0115977
1098 Ga0500648_152254
1099 Ga0500650_0001131
1100 Ga0500554_015338
1101 Ga0500556_0000081
1102 Ga0500557_101006
1103 Ga0500562_021264
1104 Ga0500569_004879
1105 Ga0500572_004102
1106 Ga0500592_000924
1107 Ga0500594_0117191
1108 Ga0500608_037882
1109 Ga0500618_002100
1110 Ga0500618_060980
1111 Ga0500642_0000042
1112 Ga0500652_001266
1113 Ga0500559_0000106
1114 Ga0500559_0425795
1115 Ga0500568_0001103
1116 Ga0500577_0071737
1117 Ga0500586_000217
1118 Ga0500590_021743
1119 Ga0500590_123677
1120 Ga0500604_0016891
1121 Ga0500616_0000227
1122 Ga0500619_117264
1123 Ga0500622_0001577
1124 Ga0500627_0263181
1125 Ga0500633_0006675
1126 Ga0500634_0099904
1127 Ga0500634_0194481
1128 Ga0500636_0004953
1129 Ga0500636_0103478
1130 Ga0500637_0073465
1131 Ga0500645_115189
1132 Ga0500596_015321
1133 Ga0501084_0000828
1134 Ga0501084_0136066
1135 Ga0501082_0003277
1136 Ga0501082_0071551
1137 Ga0530510_0349994
1138 Ga0530510_0523334
1139 2513888634
1140 2599332470
1141 2603858385
1142 2857526519
1143 2893067232
1144 2919073667
1145 8006969469
1146 8056675607

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00692

dUTPase

dUTPase

17

145

0.91

PF22769

DCD

dCTP deaminase-like

32

120

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mbq-assembly1.cif.gz_B crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from brucella melitensis, orthorhombic crystal form 0.9792 4 134
3mbq-assembly1.cif.gz_B crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from brucella melitensis, orthorhombic crystal form 0.9646 4 134
7n56-assembly3.cif.gz_K crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from rickettsia prowazekii str. madrid e 0.9587 1 138
3mbq-assembly1.cif.gz_C crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from brucella melitensis, orthorhombic crystal form 0.953 4 141
1sm8-assembly1.cif.gz_C m. tuberculosis dutpase complexed with chromium and dutp 0.9495 4 137
ID Description Score Start End Superfamily
3mbqA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9765 4 138 2.70.40.10
3mbqA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9695 4 138 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9489 4 137 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9418 4 137 2.70.40.10
af_D4A6V3_49_177_2.70.40.10 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9226 42 152 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A656KD48-F1-model_v4 deleted 0.9936 32 126
AF-A0A357CEZ8-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9876 2 137 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A1Q3IXS7-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9875 6 137 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A3S0G9I0-F1-model_v4 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (EC 3.6.1.23) (dUTP pyrophosphatase) 0.9864 3 147 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A349J258-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9859 3 135 GO:0000287
GO:0004170
GO:0006226
GO:0046081

Map